Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_636.1135335318250.0
YDR088C (SLU7)3823718851e-117
Kwal_56.234073413617622e-99
CAGL0H04917g3183686141e-77
KLLA0F14531g3413363471e-37
AGR159C2662352422e-23
KLLA0C02805g15688671.3
KLLA0F14234g106479691.8
YIL079C (AIR1)36017644.9
CAGL0L11946g2140105655.1
Kwal_33.1350916126617.3
ADL317C97669638.3
Scas_688.321979118639.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_636.11
         (353 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_636.11                                                           707   0.0  
YDR088C (SLU7) [940] chr4 complement(618491..619639) Pre-mRNA sp...   345   e-117
Kwal_56.23407                                                         298   2e-99
CAGL0H04917g 469160..470116 similar to sp|Q02775 Saccharomyces c...   241   1e-77
KLLA0F14531g 1349155..1350180 weakly similar to sp|Q02775 Saccha...   138   1e-37
AGR159C [4470] [Homologous to ScYDR088C (SLU7) - SH] (1044766..1...    98   2e-23
KLLA0C02805g complement(253320..253790) highly similar to sp|P53...    30   1.3  
KLLA0F14234g 1317691..1320885 weakly similar to sp|P12954 Saccha...    31   1.8  
YIL079C (AIR1) [2592] chr9 complement(210920..212002) RING finge...    29   4.9  
CAGL0L11946g complement(1279970..1286392) similar to sp|P32639 S...    30   5.1  
Kwal_33.13509                                                          28   7.3  
ADL317C [1424] [Homologous to ScYPR055W (SEC8) - SH] (138477..14...    29   8.3  
Scas_688.32                                                            29   9.4  

>Scas_636.11
          Length = 353

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/353 (97%), Positives = 343/353 (97%)

Query: 1   MGMKRSTDKKQQTKENQHIPRYIKTQPWYYKDGNAKPEGKDDEDYLKHHRNKDHTLDHND 60
           MGMKRSTDKKQQTKENQHIPRYIKTQPWYYKDGNAKPEGKDDEDYLKHHRNKDHTLDHND
Sbjct: 1   MGMKRSTDKKQQTKENQHIPRYIKTQPWYYKDGNAKPEGKDDEDYLKHHRNKDHTLDHND 60

Query: 61  EPSIGAGISDKFIXXXXXXXXXXMSDNGDVRKCTNCGTMGHLAKDCFERPKKFKKLDSYS 120
           EPSIGAGISDKFI          MSDNGDVRKCTNCGTMGHLAKDCFERPKKFKKLDSYS
Sbjct: 61  EPSIGAGISDKFITTETKTLKTTMSDNGDVRKCTNCGTMGHLAKDCFERPKKFKKLDSYS 120

Query: 121 GDQIKIRNDEELDWDAKKDRWFGYEGKEYNELLQNWENKKKNELKMPSNGENEVNIWDSD 180
           GDQIKIRNDEELDWDAKKDRWFGYEGKEYNELLQNWENKKKNELKMPSNGENEVNIWDSD
Sbjct: 121 GDQIKIRNDEELDWDAKKDRWFGYEGKEYNELLQNWENKKKNELKMPSNGENEVNIWDSD 180

Query: 181 EEIELMKLGLYKDSVGLLKKDDYNNTHLKNRTSVRLREDRAAYLNDVNSGTINYDPKSRI 240
           EEIELMKLGLYKDSVGLLKKDDYNNTHLKNRTSVRLREDRAAYLNDVNSGTINYDPKSRI
Sbjct: 181 EEIELMKLGLYKDSVGLLKKDDYNNTHLKNRTSVRLREDRAAYLNDVNSGTINYDPKSRI 240

Query: 241 YKSEELGSIDEKSKMFRRHLTGEGIELNELNSFTRAHARQTGIRDEVEDSHKVEHVLVAN 300
           YKSEELGSIDEKSKMFRRHLTGEGIELNELNSFTRAHARQTGIRDEVEDSHKVEHVLVAN
Sbjct: 241 YKSEELGSIDEKSKMFRRHLTGEGIELNELNSFTRAHARQTGIRDEVEDSHKVEHVLVAN 300

Query: 301 PTKYEQLMREKKQNLPTERQNEDSTTPQSPMTQKPVGTAQTEETKDELKSLYG 353
           PTKYEQLMREKKQNLPTERQNEDSTTPQSPMTQKPVGTAQTEETKDELKSLYG
Sbjct: 301 PTKYEQLMREKKQNLPTERQNEDSTTPQSPMTQKPVGTAQTEETKDELKSLYG 353

>YDR088C (SLU7) [940] chr4 complement(618491..619639) Pre-mRNA
           splicing factor affecting 3' splice site choice,
           required for the second catalytic step of splicing [1149
           bp, 382 aa]
          Length = 382

 Score =  345 bits (885), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 186/371 (50%), Positives = 241/371 (64%), Gaps = 27/371 (7%)

Query: 4   KRSTDKKQQTKENQHIPRYIKTQPWYYKD----------GN---AKPEGKDDEDYLKHHR 50
           KR   + ++  EN HIPRYI+ QPWYYKD          GN   +  EG +  DYL HHR
Sbjct: 18  KRQLQQAKEKNENIHIPRYIRNQPWYYKDTPKEQEGKKPGNDDTSTAEGGEKSDYLVHHR 77

Query: 51  NKDHT----LDHNDEPSIGAGISDKFIXXXXXXXXXXMSDNGDVRKCTNCGTMGHLAKDC 106
            K       +D+N EP IG GI D+F           + D+  +  C NCG  GH  KDC
Sbjct: 78  QKAKGGALDIDNNSEPKIGMGIKDEF--KLIRPQKMSVRDSHSLSFCRNCGEAGHKEKDC 135

Query: 107 FERPKKFKKL----DSYSGDQIKIRNDEELDWDAKKDRWFGYEGKEYNELLQNWENKKKN 162
            E+P+K +KL    +S   +   +    + DWD++KDRW+GY GKEYNEL+  WE  K+N
Sbjct: 136 MEKPRKMQKLVPDLNSQKNNGTVLVRATDDDWDSRKDRWYGYSGKEYNELISKWERDKRN 195

Query: 163 ELKMPSNGENEVNIWDSDEEIELMKLGLYKDSVGLLKKDDYNNTHLKNRTSVRLREDRAA 222
           ++K     + +  +WD+DEEIELMKL LYKDSVG LKKDD +N+ L  RTS RLRED+AA
Sbjct: 196 KIKGKDKSQTDETLWDTDEEIELMKLELYKDSVGSLKKDDADNSQL-YRTSTRLREDKAA 254

Query: 223 YLNDVNSGTINYDPKSRIYKSEELGSIDEKSKMFRRHLTGEGIELNELNSFTRAHARQTG 282
           YLND+NS   NYDPKSR+YK+E LG++DEKSKMFRRHLTGEG++LNELN F R+HA++ G
Sbjct: 255 YLNDINSTESNYDPKSRLYKTETLGAVDEKSKMFRRHLTGEGLKLNELNQFARSHAKEMG 314

Query: 283 IRDEVEDSHKVEHVLVANPTKYEQLMREKKQNLPTERQNEDSTTPQSPMTQKPVGTAQTE 342
           IRDE+ED  KV+HVLVANPTKYE L ++++Q    E +     +      +K  GT Q+E
Sbjct: 315 IRDEIEDKEKVQHVLVANPTKYEYLKKKREQE---ETKQPKIVSIGDLEARKVDGTKQSE 371

Query: 343 ETKDELKSLYG 353
           E ++ LK LYG
Sbjct: 372 EQRNHLKDLYG 382

>Kwal_56.23407
          Length = 341

 Score =  298 bits (762), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 176/361 (48%), Positives = 216/361 (59%), Gaps = 31/361 (8%)

Query: 2   GMKRSTDKKQQTKENQHIPRYIKTQPWYYKDGNAKPEGKDDEDYLKHHR-----NKDHTL 56
           G    TDKKQ   EN HIP+YIK QPW+YKD   K       DYL HHR     + D  +
Sbjct: 3   GTASKTDKKQ---ENVHIPKYIKDQPWFYKD--LKSGDDQSNDYLSHHRRLNRPDSDLDI 57

Query: 57  DHNDEPSIGAGISDKFIXXXXXXXXXXMSDNGDVR-KCTNCGTMGHLAKDCFERPKKF-K 114
           D+N EP IG GI D++                 VR KC NCG M H+ +DC E P+K   
Sbjct: 58  DNNAEPKIGRGIKDEYEGYSEVVTSR-------VRPKCNNCGGMDHIRRDCLEAPRKRPA 110

Query: 115 KLDSYSGDQIKIRNDEELDWDAKKDRWFGYEGKEYNELLQNWENKKKNELKMPSNGENEV 174
              S     I  R D   +WDA++DRWFGYEGKEY + L+ WE  K  E    S G +E+
Sbjct: 111 TTKSVLKSSILRRKDMSGNWDAQRDRWFGYEGKEYEDTLRTWETAKDKE----SQGNDEI 166

Query: 175 -NIWDSDEEIELMKLGLYKDSV-GLLKKDDYNNTHLKNRTSVRLREDRAAYLNDVNSGTI 232
            ++ D+DEEIEL  LGLYKD V G +  DD N + L  R SVRLREDRAAYLND+NS T+
Sbjct: 167 EDLIDTDEEIELAALGLYKDEVTGAVAPDDENGSRL--RASVRLREDRAAYLNDINSETL 224

Query: 233 NYDPKSRIYKSEELGSIDEKSKMFRRHLTGEGIELNELNSFTRAHARQTGIRDEVEDSHK 292
           NYDPKSR+YKSE+LG ID +SKMF RHLTGE +EL +L+ F R      GIRDEVED  K
Sbjct: 225 NYDPKSRLYKSEDLGEIDTESKMFHRHLTGESLELAKLSRFAREKTLAAGIRDEVEDDAK 284

Query: 293 VEHVLVANPTKYEQLMREKKQNLPTERQNEDSTTPQSPMTQKPVGTAQTEETKDELKSLY 352
             HVLVANPTKYE LM++ K   P   +       ++   +K  GT Q++E + +L   Y
Sbjct: 285 TNHVLVANPTKYELLMKQDKNTAPLTLEER----YRNQTAKKITGTKQSDEQRSQLLKKY 340

Query: 353 G 353
           G
Sbjct: 341 G 341

>CAGL0H04917g 469160..470116 similar to sp|Q02775 Saccharomyces
           cerevisiae YDR088c SLU7, hypothetical start
          Length = 318

 Score =  241 bits (614), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 163/368 (44%), Positives = 215/368 (58%), Gaps = 72/368 (19%)

Query: 4   KRSTDKKQQTKE---NQHIPRYIKTQPWYYKD--GNAKPEGKDDEDYLKHHRNK--DHTL 56
           K + D+K+ TK    N+HIP YIK  PWYY+D   N+K   K+ +DYL+HHR +  D T+
Sbjct: 5   KVTKDEKKNTKTKDVNEHIPNYIKNLPWYYQDIDKNSKNNSKE-QDYLRHHRQRRDDKTI 63

Query: 57  D--HNDEPSIGAGISDKFIXXXXXXXXXXMSDNGDVRKCTNCGTMGHLAKDCFERPKKFK 114
           D  +ND+  IG GI D+F           + +N   +K T  G                 
Sbjct: 64  DIDNNDQAKIGTGIKDEF---------EVIVEN---KKTTIDGI---------------- 95

Query: 115 KLDSYSGDQIKIRNDEELDWDAKKDRWFGYEGKEYNELLQNWENKKKNELKMPSNGENEV 174
                    IK R DE+ DWDA+KDRW+GY GKEY E+L+ WE K + +L    N   E 
Sbjct: 96  ---------IKRRKDEK-DWDARKDRWYGYSGKEYEEVLKKWE-KSREDL----NNTTEE 140

Query: 175 NIWDSDEEIELMKLGLYKDSVGLLKKDDYNNTHLKNRTSVRLREDRAAYLNDVNSGTINY 234
           + +D+DEEIE+MKLGL         KD   N      +SVRLRED+AAYL D+ S T NY
Sbjct: 141 SAYDTDEEIEMMKLGL-------TPKDLEQNIK---GSSVRLREDKAAYLKDIYSSTTNY 190

Query: 235 DPKSRIYKSEELGSIDEKSKMFRRHLTGEGIELNELNSFTRAHARQTGIRDEVEDSHKVE 294
           DPKSR+YKS++LGSIDE S MF RHLTGEG ELN+LN F R +A+++GIRDE+ D+ KV 
Sbjct: 191 DPKSRLYKSDDLGSIDEHSNMFLRHLTGEGKELNDLNKFARENAKESGIRDELVDADKVN 250

Query: 295 HVLVANPTKYEQLMREK---------KQNLPTERQNEDSTTPQSPMTQKPVGTAQTEETK 345
           HVLVANPTK E L ++K         +QN   +R+ +          +KP GT Q++ TK
Sbjct: 251 HVLVANPTKLEVLRKQKELDSLKLTEEQNRQEQRKLKRKAKLLKKKAKKPKGTPQSDSTK 310

Query: 346 DELKSLYG 353
            +L  +YG
Sbjct: 311 AQLMDMYG 318

>KLLA0F14531g 1349155..1350180 weakly similar to sp|Q02775
           Saccharomyces cerevisiae YDR088c SLU7 pre-mRNA splicing
           factor affecting 3 splice site choice singleton,
           hypothetical start
          Length = 341

 Score =  138 bits (347), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 111/336 (33%), Positives = 163/336 (48%), Gaps = 82/336 (24%)

Query: 15  ENQHIPRYIKTQPWYYKDGNAKPEGK--------------------DDEDYLKHHRNKDH 54
           +N+HIP +IK +PWY  + +                          +++DYL HHR K  
Sbjct: 21  QNEHIPNFIKNKPWYLAEESEVSASTSAINSNSTISGTGTGTGTELEEKDYLSHHRLKKS 80

Query: 55  TLDHNDEPSIG-AGISDKFIXXXXXXXXXXMSDNGDVRKCTNCGTMGHLAKDCFERP--K 111
           ++     P  G A I D F                                  + RP  +
Sbjct: 81  SV-----PDSGTAEIDDAF---------------------------------TYVRPSGR 102

Query: 112 KFKKLDSYSGD---QIKIRNDE--ELDWDAKKDRWFGYEGKEYNELLQNWENKKKNELKM 166
             KK DSY  D    ++ R+++  E ++DAK+DRW+GY   +  E+ +N +    +  +M
Sbjct: 103 NRKKKDSYDLDLDAPVRRRDEKVIESNYDAKRDRWYGY-TPDIKEIERNHKGPDTSHREM 161

Query: 167 PSNGENEVNIWDSDEEIELMKLGLYKDSVGLLKKDDYNNTHLKNRTSVRLREDRAAYLND 226
                +EV I       E+ +LGL  + VG       +    K    VRLRED+AAYL D
Sbjct: 162 -----DEVQIQ------EMERLGLKPEDVGFDATQPLSGPKEKY-NPVRLREDKAAYLQD 209

Query: 227 VNSGTINYDPKSRIYKSEELGSIDEKSKMFRRHLTGEGIELNELNSFTRAHARQTGIRDE 286
           ++S  + YDPKSRIYKS+E G+ID KSKMF RHLTG+ +++  +N   R  A ++GI+D 
Sbjct: 210 MSSEEMLYDPKSRIYKSKEEGTIDPKSKMFHRHLTGDALQVGVINERVRQEAVRSGIKDF 269

Query: 287 VEDSHKVEHVLVANPTKYEQLMR---EKKQNLPTER 319
             +  K+ HV  ANPTKYE +MR   E+KQ    E+
Sbjct: 270 EVNKEKLNHVFAANPTKYELMMRTEPERKQETSVEQ 305

>AGR159C [4470] [Homologous to ScYDR088C (SLU7) - SH]
           (1044766..1045566) [801 bp, 266 aa]
          Length = 266

 Score = 97.8 bits (242), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 105/235 (44%), Gaps = 50/235 (21%)

Query: 15  ENQHIPRYIKTQPWYYKDGNAKPEGKDDEDYLKHHRN------KDHTLDHNDEPSIGAGI 68
           EN+HIP+YI+ +PWY + G+      DD DYL HHR       +D ++        G+ I
Sbjct: 3   ENKHIPKYIRDKPWYVESGD------DDADYLGHHRREPGEGAQDFSVAQQ-----GSVI 51

Query: 69  SDKFIXXXXXXXXXXMSDNGDVRKCTNCGTMGHLAKDCFERPKKFKKLDSYSGDQ-IKIR 127
           SD+F+                  +CTNCG   H  +DC  RP+K  + D   G++  ++R
Sbjct: 52  SDRFVAGSAPRAGRGRG------RCTNCGA-NHDRRDCLLRPRKQARGD--GGERAFQVR 102

Query: 128 NDEELDWDAKKDRWFGYEGKEYNELLQNWENKKKNELKMPSNGENEVNIWDSDEEIELMK 187
           ++  L ++AK+DRW+G+EG     +                          +   +E  K
Sbjct: 103 DENALSFEAKRDRWYGFEGPVAPAVAAAAAEPPAAAED-------------AAAAVERYK 149

Query: 188 LGLYKDSVGLLKKDDYNNTHLKNRTSVRLREDRAAYLNDVNSGTINYDPKSRIYK 242
           LGL          D           ++R R DRA YL+DV      YDPKSR+Y+
Sbjct: 150 LGL----------DARAARAGVGAPAIRPRHDRARYLDDVRGEETRYDPKSRVYR 194

>KLLA0C02805g complement(253320..253790) highly similar to sp|P53849
           Saccharomyces cerevisiae YNL255c GIS2 singleton, start
           by similarity
          Length = 156

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 42/88 (47%), Gaps = 5/88 (5%)

Query: 90  VRKCTNCGTMGHLAKDCFERPKKFKKLDSYSGDQI---KIRNDEELDWDAKKDRWFGYEG 146
           V+KC NC   GH++++C ++PK+F+  +  SG ++   K      +  D  K     Y  
Sbjct: 64  VQKCYNCDGFGHISREC-DQPKRFRN-NERSGPKVSCYKCGGPNHIAKDCLKSEPTCYNC 121

Query: 147 KEYNELLQNWENKKKNELKMPSNGENEV 174
            +   L ++ +N +  ++    NG   +
Sbjct: 122 GQAGHLSKDCQNGENEKVCYNCNGVGHI 149

>KLLA0F14234g 1317691..1320885 weakly similar to sp|P12954
           Saccharomyces cerevisiae YJL092w HPR5 ATP-dependent DNA
           helicase, hypothetical start
          Length = 1064

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 4/79 (5%)

Query: 106 CFERPKKFKKLDSYSGDQIKIRNDEELDWDAKKDRWFGYEGKEYNELLQNWENKKKNELK 165
           CFE  +   KL  Y   +++I N + + +D     ++ Y G    +LL  W++ K + + 
Sbjct: 756 CFESIEHLFKL--YYTLKVQIPNQDRISYDQLIKDYYNY-GFNSRQLL-FWKDNKYSHVD 811

Query: 166 MPSNGENEVNIWDSDEEIE 184
           +P+  EN + I     EIE
Sbjct: 812 LPNMTENTIGIVTKKNEIE 830

>YIL079C (AIR1) [2592] chr9 complement(210920..212002) RING finger
           protein that inhibits arginine methylation of Npl3p
           [1083 bp, 360 aa]
          Length = 360

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 10/17 (58%), Positives = 10/17 (58%)

Query: 93  CTNCGTMGHLAKDCFER 109
           C NCG  GH   DC ER
Sbjct: 175 CYNCGNAGHFGDDCAER 191

>CAGL0L11946g complement(1279970..1286392) similar to sp|P32639
           Saccharomyces cerevisiae YER172c RNA helicase-related
           protein, start by similarity
          Length = 2140

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 50/105 (47%), Gaps = 11/105 (10%)

Query: 210 NRTSVRLREDRAAYLNDVNSGTINYDPKSRIYKSEELGSIDEKSKMFRRHLTGEGIELNE 269
           N   + + +  + Y+N+ ++ ++  +    +Y +     + E+ + F R L+  GI+++E
Sbjct: 518 NVAVLTILQVLSQYINE-DTDSLKLNDFRIVYVAPLKALVQEQVREFERRLSNFGIKVSE 576

Query: 270 LNSFTRAHARQTGIRDEVEDSHKVEHVLVANPTKYEQLMREKKQN 314
           L   T      T  R E+E       VLV  P K++ L R+  +N
Sbjct: 577 LTGDT------TLTRSEIEKF----QVLVTTPEKWDVLTRKNDEN 611

>Kwal_33.13509
          Length = 161

 Score = 28.1 bits (61), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 1/26 (3%)

Query: 89  DVRKCTNCGTMGHLAKDCFERPKKFK 114
           DV++C NC   GH+++DC + PKK K
Sbjct: 65  DVQRCYNCNQTGHISRDCAD-PKKPK 89

>ADL317C [1424] [Homologous to ScYPR055W (SEC8) - SH]
           (138477..141407) [2931 bp, 976 aa]
          Length = 976

 Score = 28.9 bits (63), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 7/69 (10%)

Query: 260 LTGEGIELNELNSFTRAHARQTGIRDEVEDSHKVEHVLVANPTKYEQLMREKKQNLPTER 319
           LT E  EL+ELN+ +  HA+       +E  + +EHVL+  P + E+ + E++ +   E 
Sbjct: 134 LTVEDPELDELNNESMKHAKM------IETLNAIEHVLLI-PGRVEKFISERQFSSALES 186

Query: 320 QNEDSTTPQ 328
             +  T  Q
Sbjct: 187 LVQGFTLAQ 195

>Scas_688.32
          Length = 1979

 Score = 28.9 bits (63), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 53/118 (44%), Gaps = 8/118 (6%)

Query: 106  CFERPKKFKKLDSYSGDQIKIRNDEELDWDAKKDRWFGYEGKEYNELLQNWENKKKNELK 165
            C    K F +L + SG+   I    +++ D       GY   EY + L +     ++  +
Sbjct: 1592 CLILIKVFHELLNESGEAPFIIEGIDIENDL-----VGYSTPEYIDTLISLLTYHRSLKE 1646

Query: 166  MPSNGENEVNIWDSDEEIELMKLGLYKDSVGLLKKDD---YNNTHLKNRTSVRLREDR 220
            + + G   +    SD EI+     +  +  G++K  D   Y NT++ N   ++LRE++
Sbjct: 1647 LLTIGTKALEAMGSDREIDPYLQNIPYEYCGIVKMVDLAKYLNTYITNTRDIKLREEQ 1704

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.130    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,764,138
Number of extensions: 700904
Number of successful extensions: 2521
Number of sequences better than 10.0: 90
Number of HSP's gapped: 2493
Number of HSP's successfully gapped: 96
Length of query: 353
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 250
Effective length of database: 13,030,455
Effective search space: 3257613750
Effective search space used: 3257613750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)