Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_636.1028828812451e-175
YDR087C (RRP1)2782587921e-106
Kwal_56.234052802667483e-99
CAGL0M11110g2702567386e-98
AGR158C2672567056e-93
KLLA0C11979g2612555988e-77
Sklu_1568.32202095722e-73
Sklu_2430.1138985653.3
Sklu_2261.663334628.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_636.10
         (288 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_636.10                                                           484   e-175
YDR087C (RRP1) [939] chr4 complement(617464..618300) Protein inv...   309   e-106
Kwal_56.23405                                                         292   3e-99
CAGL0M11110g complement(1095317..1096129) similar to sp|P35178 S...   288   6e-98
AGR158C [4469] [Homologous to ScYDR087C (RRP1) - SH] (1043874..1...   276   6e-93
KLLA0C11979g complement(1027919..1028704) similar to sp|P35178 S...   234   8e-77
Sklu_1568.3 YDR087C, Contig c1568 3651-4313 reverse complement        224   2e-73
Sklu_2430.11 YMR101C, Contig c2430 20248-21417                         30   3.3  
Sklu_2261.6 YMR032W, Contig c2261 11239-13140                          28   8.3  

>Scas_636.10
          Length = 288

 Score =  484 bits (1245), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 246/288 (85%), Positives = 246/288 (85%)

Query: 1   MDTSTFVKQLSSNNRVVREKSLEALEKFLVSKKCLSFKQSQFNKLWKGLYFAMWFSDRPR 60
           MDTSTFVKQLSSNNRVVREKSLEALEKFLVSKKCLSFKQSQFNKLWKGLYFAMWFSDRPR
Sbjct: 1   MDTSTFVKQLSSNNRVVREKSLEALEKFLVSKKCLSFKQSQFNKLWKGLYFAMWFSDRPR 60

Query: 61  PQQRLANKLGQLYGLYFNEKDNENQENETRLSDNDKAFIKFSKAFWKILCLEWYSIDRFR 120
           PQQRLANKLGQLYGLYFNEKDNENQENETRLSDNDKAFIKFSKAFWKILCLEWYSIDRFR
Sbjct: 61  PQQRLANKLGQLYGLYFNEKDNENQENETRLSDNDKAFIKFSKAFWKILCLEWYSIDRFR 120

Query: 121 MDKYLLLTRRVFFNQLKYLQSRNWNAKLVEQYCQGVLVDLPLSGDAKVYSGIPFHIIDIL 180
           MDKYLLLTRRVFFNQLKYLQSRNWNAKLVEQYCQGVLVDLPLSGDAKVYSGIPFHIIDIL
Sbjct: 121 MDKYLLLTRRVFFNQLKYLQSRNWNAKLVEQYCQGVLVDLPLSGDAKVYSGIPFHIIDIL 180

Query: 181 LDEWERLLXXXXXXXXXXXXXXXXXXXXXAVKETPLNNFIKIFYGLVSNVNNSKILRTKI 240
           LDEWERLL                     AVKETPLNNFIKIFYGLVSNVNNSKILRTKI
Sbjct: 181 LDEWERLLTDKDDEHDDEEKETDEVDIVIAVKETPLNNFIKIFYGLVSNVNNSKILRTKI 240

Query: 241 KEDLLADPRLIEWGIIENTDEGKXXXXXXXXXXXXXXXXXXXXXWKGF 288
           KEDLLADPRLIEWGIIENTDEGK                     WKGF
Sbjct: 241 KEDLLADPRLIEWGIIENTDEGKSEEIDEPSSEDEEKATGEEEEWKGF 288

>YDR087C (RRP1) [939] chr4 complement(617464..618300) Protein
           involved in maturation of 25S rRNA [837 bp, 278 aa]
          Length = 278

 Score =  309 bits (792), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 154/258 (59%), Positives = 192/258 (74%), Gaps = 4/258 (1%)

Query: 1   MDTSTFVKQLSSNNRVVREKSLEALEKFLVSKKCLSFKQSQFNKLWKGLYFAMWFSDRPR 60
           M+TS FVKQLSSNNR  R  +LEAL+K+L +K+    KQ +FNKLWKGLY+AMWFSDRPR
Sbjct: 1   METSNFVKQLSSNNRKTRVNALEALKKYLTAKQFKENKQIEFNKLWKGLYYAMWFSDRPR 60

Query: 61  PQQRLANKLGQLYGLYFNEKDNENQENETRLSDNDKAFIKFSKAFWKILCLEWYSIDRFR 120
           PQQRLAN+LG+L+GLYF+ KDN   +    L+ NDKAFIKFS+ FWK++C EW++IDR+R
Sbjct: 61  PQQRLANELGELHGLYFDPKDNSTADE---LTTNDKAFIKFSRGFWKVMCFEWFNIDRYR 117

Query: 121 MDKYLLLTRRVFFNQLKYLQSRNWNAKLVEQYCQGVLVDLPLSGDAKVYSGIPFHIIDIL 180
           +DKYLLL RRV F+QLKYLQSRNW+ KLV++Y + VL  LPLSG  KVY+GIP HI+DIL
Sbjct: 118 LDKYLLLIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIHIVDIL 177

Query: 181 LDEWERLLXXXXXXXXXXXXXXXXXXX-XXAVKETPLNNFIKIFYGLVSNVNNSKILRTK 239
           LDEWERLL                      + K+TPL + I IF  +V++ NNSK+LR K
Sbjct: 178 LDEWERLLKDGDEDDEDEENKEEEMRKIAESAKKTPLADVIAIFQDIVADYNNSKVLREK 237

Query: 240 IKEDLLADPRLIEWGIIE 257
           IKEDL +D RL+ W I+E
Sbjct: 238 IKEDLFSDTRLVSWDILE 255

>Kwal_56.23405
          Length = 280

 Score =  292 bits (748), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 143/266 (53%), Positives = 187/266 (70%), Gaps = 10/266 (3%)

Query: 1   MDTSTFVKQLSSNNRVVREKSLEALEKFLVSKKCLSFKQSQFNKLWKGLYFAMWFSDRPR 60
           M++S FVKQL+SN R VRE++L++L+K+L +K+    KQ+ F+KLWKGLY+AMWFSDRPR
Sbjct: 1   MESSAFVKQLASNTRTVREEALDSLKKYLTTKQFKENKQASFDKLWKGLYYAMWFSDRPR 60

Query: 61  PQQRLANKLGQLYGLYFNEKDNENQENETRLSDNDKAFIKFSKAFWKILCLEWYSIDRFR 120
           PQQRLAN LG+L+ LYF++ DN+    E  L+ ND+AF+KFSKAFW+++CLEWY ID  R
Sbjct: 61  PQQRLANSLGELHVLYFDKADNQKSNGE--LTLNDRAFLKFSKAFWRVICLEWYGIDHHR 118

Query: 121 MDKYLLLTRRVFFNQLKYLQSRNWNAKLVEQYCQGVLVDLPLSGDAKVYSGIPFHIIDIL 180
           +DKYLLL RRV  +QL+YLQ R W+ ++V  Y + VL  LPLSGD KVY+GIPFHIIDI 
Sbjct: 119 LDKYLLLVRRVLAHQLRYLQLREWDEEVVSNYIRAVLRKLPLSGDKKVYNGIPFHIIDIF 178

Query: 181 LDEWERLLXXXXXXXXXXXXXXXXXXXXXA--------VKETPLNNFIKIFYGLVSNVNN 232
           +DEWE+L+                     A        + ETPL  F++IF  L SN+NN
Sbjct: 179 VDEWEKLILHNGEDEDEEDDEKTNQEDEEAKLQEECARIAETPLAQFVEIFEDLASNINN 238

Query: 233 SKILRTKIKEDLLADPRLIEWGIIEN 258
            K LR KIKED+  D RL +WG++E 
Sbjct: 239 IKSLRDKIKEDIFKDERLKKWGVLET 264

>CAGL0M11110g complement(1095317..1096129) similar to sp|P35178
           Saccharomyces cerevisiae YDR087c RRP1 involved in
           processing rRNA precursor species to mature rRNAs, start
           by similarity
          Length = 270

 Score =  288 bits (738), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 183/256 (71%), Gaps = 6/256 (2%)

Query: 1   MDTSTFVKQLSSNNRVVREKSLEALEKFLVSKKCLSFKQSQFNKLWKGLYFAMWFSDRPR 60
           M+TS FVKQL+SNNRVVREK+LE LE+F+VS +    KQ QF+KLWKGLY+AMWF DRPR
Sbjct: 1   METSKFVKQLASNNRVVREKALETLEQFIVSAQFKKSKQVQFDKLWKGLYYAMWFCDRPR 60

Query: 61  PQQRLANKLGQLYGLYFNEKDNENQENETRLSDNDKAFIKFSKAFWKILCLEWYSIDRFR 120
           PQQRLA+ LG L+  +F+E+D+  +E    L+ NDKAF++FSKAFW+I+CLEW  IDRFR
Sbjct: 61  PQQRLASTLGALHVRFFDERDSGAEE----LTVNDKAFVRFSKAFWRIMCLEWLGIDRFR 116

Query: 121 MDKYLLLTRRVFFNQLKYLQSRNWNAKLVEQYCQGVLVDLPLSGDAKVYSGIPFHIIDIL 180
           +DKYLLL RR  FNQ KYLQ R W+A LV +Y + VL  +PLSGD KVY+GIP H++DI+
Sbjct: 117 LDKYLLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGIPIHVMDIM 176

Query: 181 LDEWERLLXXXXXXXXXXXXXXXXXXXXXAVKETPLNNFIKIFYGLVSNVNNSKILRTKI 240
           LDEWERL                       V  +PL+  + I   L+ N +NSKILR KI
Sbjct: 177 LDEWERL--ALEDEEEELEEDKKLEIMKEFVSGSPLDQVLDILRNLLKNYDNSKILRDKI 234

Query: 241 KEDLLADPRLIEWGII 256
           K+++L D RL +WGI+
Sbjct: 235 KKEVLTDKRLAQWGIV 250

>AGR158C [4469] [Homologous to ScYDR087C (RRP1) - SH]
           (1043874..1044677) [804 bp, 267 aa]
          Length = 267

 Score =  276 bits (705), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 178/256 (69%), Gaps = 11/256 (4%)

Query: 1   MDTSTFVKQLSSNNRVVREKSLEALEKFLVSKKCLSFKQSQFNKLWKGLYFAMWFSDRPR 60
           + TS FV+QL+SN+R VRE++LE+L  +L S++     Q QF++LWKGLYFAMWFSDRPR
Sbjct: 4   VQTSPFVRQLASNSRSVREQALESLRSYLASQQLRKAPQLQFDQLWKGLYFAMWFSDRPR 63

Query: 61  PQQRLANKLGQLYGLYFNEKDNENQENETRLSDNDKAFIKFSKAFWKILCLEWYSIDRFR 120
           PQQRLA +LG+L  L+ +         +T L   D+AF++FSKAFWK++CLEWY+ID  R
Sbjct: 64  PQQRLAAQLGELSLLFLD--------GDTAL--GDRAFVRFSKAFWKVMCLEWYNIDHHR 113

Query: 121 MDKYLLLTRRVFFNQLKYLQSRNWNAKLVEQYCQGVLVDLPLSGDAKVYSGIPFHIIDIL 180
           +DKYLLL RRV +NQL++L+ R W+A LVE+Y   VL  LPLSG  KVY+GIPFHIIDI 
Sbjct: 114 LDKYLLLVRRVLYNQLRFLRERGWDAALVERYVAKVLQGLPLSGSPKVYNGIPFHIIDIF 173

Query: 181 LDEWERLLXXXXXXXXXXXXXXXXXXXXXAVKETPLNNFIKIFYGLVSNVNNSKILRTKI 240
           +DEWERL+                      +  TPL  F+ +F GL +N+ N KILR KI
Sbjct: 174 VDEWERLVLRDGRDAEDADMPELPEQRDL-IAATPLPRFVAVFQGLAANIANIKILREKI 232

Query: 241 KEDLLADPRLIEWGII 256
           K+DLLAD RL +WG++
Sbjct: 233 KQDLLADQRLYDWGVL 248

>KLLA0C11979g complement(1027919..1028704) similar to sp|P35178
           Saccharomyces cerevisiae YDR087c RRP1 involved in
           processing rRNA precursor species to mature rRNAs
           singleton, start by similarity
          Length = 261

 Score =  234 bits (598), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 123/255 (48%), Positives = 161/255 (63%), Gaps = 14/255 (5%)

Query: 4   STFVKQLSSNNRVVREKSLEALEKFLVSKKCLSFKQSQFNKLWKGLYFAMWFSDRPRPQQ 63
           +T VKQL+ + +  RE++ E+L K+L ++   + KQSQF+KLWKGLY++MW  D+P PQQ
Sbjct: 3   NTLVKQLAGHRKETREQAFESLRKYLTTRNFQNAKQSQFDKLWKGLYYSMWHCDKPIPQQ 62

Query: 64  RLANKLGQLYGLYFNEKDNENQENETRLSDNDKAFIKFSKAFWKILCLEWYSIDRFRMDK 123
            LA  LG+L+ LY   K             N +AFI+FSKAFWK++C+EWY ID  R+DK
Sbjct: 63  SLAYSLGELHLLYLKGK-------------NQQAFIRFSKAFWKVICIEWYRIDHHRLDK 109

Query: 124 YLLLTRRVFFNQLKYLQSRNWNAKLVEQYCQGVLVDLPLSGDAKVYSGIPFHIIDILLDE 183
           +LLL RR    Q+KYL    W   LV+ Y   VL  +PLSGD KVY+GIPFHIIDILLDE
Sbjct: 110 FLLLIRRCLHFQIKYLHECEWEQALVDDYINKVLKKIPLSGDRKVYNGIPFHIIDILLDE 169

Query: 184 WERLLXXXXXXXXXXXXXXXXXXXXXAVKETPLNNFIKIFYGLVSNVNNSKILRTKIKED 243
           W ++                      AV +TPL++FI IF  L S+ NN KILR KIKED
Sbjct: 170 WVKVC-YGEEEDEEDNEDDKEEEIKEAVSKTPLSDFISIFQELSSDTNNIKILRDKIKED 228

Query: 244 LLADPRLIEWGIIEN 258
           LL D RL  W ++++
Sbjct: 229 LLKDQRLRAWDVLQS 243

>Sklu_1568.3 YDR087C, Contig c1568 3651-4313 reverse complement
          Length = 220

 Score =  224 bits (572), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 112/209 (53%), Positives = 140/209 (66%), Gaps = 5/209 (2%)

Query: 53  MWFSDRPRPQQRLANKLGQLYGLYFNEKDNENQENETRLSDNDKAFIKFSKAFWKILCLE 112
           MWFSDRPRPQ RL N+LG+L+ L+F        EN+  ++  DKAFIKF+  FWK++CLE
Sbjct: 1   MWFSDRPRPQHRLGNELGELHLLFFAA-----VENKQEITLVDKAFIKFTNGFWKVICLE 55

Query: 113 WYSIDRFRMDKYLLLTRRVFFNQLKYLQSRNWNAKLVEQYCQGVLVDLPLSGDAKVYSGI 172
           WYSID  R+DKY+LL RRV FNQLKYL+ RNWN +LV +Y   VL  LPLSGD KVY+GI
Sbjct: 56  WYSIDHHRLDKYILLVRRVLFNQLKYLKLRNWNEELVLKYIDSVLKKLPLSGDKKVYNGI 115

Query: 173 PFHIIDILLDEWERLLXXXXXXXXXXXXXXXXXXXXXAVKETPLNNFIKIFYGLVSNVNN 232
           PFHIIDI +DEWE+L+                      +  TPL+ F++IF  L SN+ N
Sbjct: 116 PFHIIDIFVDEWEKLVIRDGEDEGEDGEEKDSEECKQLIAATPLSLFVEIFQDLSSNIEN 175

Query: 233 SKILRTKIKEDLLADPRLIEWGIIENTDE 261
            K+LR KIKED+L D RL  WGI+   D+
Sbjct: 176 IKVLREKIKEDILGDQRLHLWGILTQGDD 204

>Sklu_2430.11 YMR101C, Contig c2430 20248-21417
          Length = 389

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 20/85 (23%)

Query: 74  GLYFNEKDNE-----NQENETRLSD------NDKAFIKFSKAFWKILCLEWYSIDRFRMD 122
            +YF+E  N+          TRLSD      ++   I+FS   W       Y+   F   
Sbjct: 276 AMYFDEFSNKCDLLIRTSGHTRLSDYMLWQSHENGMIEFSTTLWP-----SYTFLEF--- 327

Query: 123 KYLLLTRRVFFNQLKYLQSRNWNAK 147
            YL+L R  FF  L+  Q+  ++A+
Sbjct: 328 -YLVLVRWSFFTSLQRFQTSGFSAR 351

>Sklu_2261.6 YMR032W, Contig c2261 11239-13140
          Length = 633

 Score = 28.5 bits (62), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (64%)

Query: 98  FIKFSKAFWKILCLEWYSIDRFRMDKYLLLTRRV 131
            IK++KA +  +     ++  FR+D Y+LLT+R+
Sbjct: 567 VIKYAKALYTYMEPNENNLVNFRVDDYILLTKRL 600

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.138    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,771,832
Number of extensions: 369701
Number of successful extensions: 1117
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1103
Number of HSP's successfully gapped: 17
Length of query: 288
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 187
Effective length of database: 13,099,691
Effective search space: 2449642217
Effective search space used: 2449642217
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)