Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_629.2044044023560.0
YLL002W (RTT109)43644310021e-133
KLLA0F12914g4304268621e-112
CAGL0D05786g4234358361e-108
Kwal_33.151954284008021e-103
AAL173C4204206546e-81
Kwal_26.942236546663.9
KLLA0F11726g73966664.4
Scas_697.567468656.4
KLLA0E03146g78881656.6
Scas_626.3*438106647.7
Scas_478.624977637.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_629.20
         (440 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_629.20                                                           912   0.0  
YLL002W (RTT109) [3417] chr12 (146290..147600) Protein involved ...   390   e-133
KLLA0F12914g complement(1190220..1191512) similar to sgd|S000392...   336   e-112
CAGL0D05786g 550165..551436 similar to tr|Q07794 Saccharomyces c...   326   e-108
Kwal_33.15195                                                         313   e-103
AAL173C [14] [Homologous to ScYLL002W (REM50) - SH] (38265..3952...   256   6e-81
Kwal_26.9422                                                           30   3.9  
KLLA0F11726g 1080554..1082773 no similarity, hypothetical start        30   4.4  
Scas_697.5                                                             30   6.4  
KLLA0E03146g complement(299014..301380) similar to sp|Q12386 Sac...    30   6.6  
Scas_626.3*                                                            29   7.7  
Scas_478.6                                                             29   7.9  

>Scas_629.20
          Length = 440

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/440 (100%), Positives = 440/440 (100%)

Query: 1   MSLNGTHTLDELLASVLPRGHDFELLHLQDEPAQTHDIVTPMPTTQERADTLTVKIQHFF 60
           MSLNGTHTLDELLASVLPRGHDFELLHLQDEPAQTHDIVTPMPTTQERADTLTVKIQHFF
Sbjct: 1   MSLNGTHTLDELLASVLPRGHDFELLHLQDEPAQTHDIVTPMPTTQERADTLTVKIQHFF 60

Query: 61  TLFHNKKAVFALEIYVYLTLSSLHNTKLIFVSKADTSGYCDIKLRMGDITKVFLQYLISV 120
           TLFHNKKAVFALEIYVYLTLSSLHNTKLIFVSKADTSGYCDIKLRMGDITKVFLQYLISV
Sbjct: 61  TLFHNKKAVFALEIYVYLTLSSLHNTKLIFVSKADTSGYCDIKLRMGDITKVFLQYLISV 120

Query: 121 DPLHYLRKVKPLRRVNDHDESLIRKGTSVERSLRILAVRVDLSPHPCQNTDKFYITRNDV 180
           DPLHYLRKVKPLRRVNDHDESLIRKGTSVERSLRILAVRVDLSPHPCQNTDKFYITRNDV
Sbjct: 121 DPLHYLRKVKPLRRVNDHDESLIRKGTSVERSLRILAVRVDLSPHPCQNTDKFYITRNDV 180

Query: 181 GGDTNWVTKICLFTRPADDYLFIGSSKNAKKHKLNGDQLLKWWMKIIDGLVCTDFDPNNV 240
           GGDTNWVTKICLFTRPADDYLFIGSSKNAKKHKLNGDQLLKWWMKIIDGLVCTDFDPNNV
Sbjct: 181 GGDTNWVTKICLFTRPADDYLFIGSSKNAKKHKLNGDQLLKWWMKIIDGLVCTDFDPNNV 240

Query: 241 SARLRVPGEDTGRVSRTYLNGDLTQSNNWQVGDIFGGTGNDLAVFHVPLFPDDPKSRFIR 300
           SARLRVPGEDTGRVSRTYLNGDLTQSNNWQVGDIFGGTGNDLAVFHVPLFPDDPKSRFIR
Sbjct: 241 SARLRVPGEDTGRVSRTYLNGDLTQSNNWQVGDIFGGTGNDLAVFHVPLFPDDPKSRFIR 300

Query: 301 HLVQENRIMKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKKIPDYLPNDREIFICSSR 360
           HLVQENRIMKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKKIPDYLPNDREIFICSSR
Sbjct: 301 HLVQENRIMKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKKIPDYLPNDREIFICSSR 360

Query: 361 RQFRYIRSYVAGEEYDNEEGTLESYVNVRDYLELRYSKKLLKLSGTREPEIRKPVVASTT 420
           RQFRYIRSYVAGEEYDNEEGTLESYVNVRDYLELRYSKKLLKLSGTREPEIRKPVVASTT
Sbjct: 361 RQFRYIRSYVAGEEYDNEEGTLESYVNVRDYLELRYSKKLLKLSGTREPEIRKPVVASTT 420

Query: 421 KRSAIPVTLLQPRKKAKPAK 440
           KRSAIPVTLLQPRKKAKPAK
Sbjct: 421 KRSAIPVTLLQPRKKAKPAK 440

>YLL002W (RTT109) [3417] chr12 (146290..147600) Protein involved in
           resistance to mutagens such as diepoxybutane and
           mitomycin C [1311 bp, 436 aa]
          Length = 436

 Score =  390 bits (1002), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 208/443 (46%), Positives = 288/443 (65%), Gaps = 26/443 (5%)

Query: 8   TLDELLASVLPRGHDFELLHLQDEPAQTHDIVTPMPTTQERADTLTVKIQHFFTLFHNKK 67
           +L++ L+SVLP    FE L LQ  P +TH +VTP     +R    T+K QHFF+LFH  K
Sbjct: 2   SLNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPN-KDDKRVPKSTIKTQHFFSLFHQGK 60

Query: 68  AVFALEIYVYLTL-SSLHNTKLIFVSKADTSGYCDIKLRMGDITKVFLQYLISVDPLHYL 126
             F+LE+YVY+TL       +LIFVSKADT+GYC+ ++ + DITK+ L++++S+DP +YL
Sbjct: 61  VFFSLEVYVYVTLWDEADAERLIFVSKADTNGYCNTRVSVRDITKIILEFILSIDPNYYL 120

Query: 127 RKVKP-LRRVNDHDESLIRKGTSVERSLRILAVRVDLS----------PHPCQNTDKFYI 175
           +KVKP +R        LI   ++  R+LRILA R+  S          P   Q+    + 
Sbjct: 121 QKVKPAIRSYKKISPELISAASTPARTLRILARRLKQSGSTVLKEIESPRFQQDLYLSFT 180

Query: 176 TRNDVGGDTNWVTKICLFTRPADDYLFIGSSKNAKKHKLNGDQLLKWWMKIIDGLVCTDF 235
              ++      +TKICLFTRPA  YLF  SSKN+KKH LNG++L+KWW  I+D L+   F
Sbjct: 181 CPREI------LTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIECF 234

Query: 236 DPNNVSARLRVPGEDTGRVSRTYLNGDLTQSNNWQVGDIFGGTGNDLAVFHVPLFPDDPK 295
             N+  A+LR+PGED  RV R+YL G   +   WQVGDIF    N LAV+++PLFPDDPK
Sbjct: 235 Q-NDTQAKLRIPGEDPARV-RSYLRG--MKYPLWQVGDIFTSKENSLAVYNIPLFPDDPK 290

Query: 296 SRFIRHLVQENRIMKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKKIPDYLPNDREIF 355
           +RFI  L +E+R++K +L ++W+ELQERQEFKLSV  SV+G+ G++   P   P+  ++ 
Sbjct: 291 ARFIHQLAEEDRLLKVSLSSFWIELQERQEFKLSVTSSVMGISGYSLATPSLFPSSADVI 350

Query: 356 ICSSRRQFRYIRSYVAGEEYDNEEGTLESYVNVRDYLELRYSKKLLKLSGTREPEIR-KP 414
           +  SR+QFR I+ Y+ GEEYD EEG +E++ N+RD+L LR +  L  L+G RE   R +P
Sbjct: 351 VPKSRKQFRAIKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTGKREHRERNQP 410

Query: 415 VVASTTKRSAIPVTLLQPRKKAK 437
           V AS     AI  T+L+PRKKAK
Sbjct: 411 VPASNINTLAI--TMLKPRKKAK 431

>KLLA0F12914g complement(1190220..1191512) similar to sgd|S0003925
           Saccharomyces cerevisiae YLL002w REM50 drug resistance,
           start by similarity
          Length = 430

 Score =  336 bits (862), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 187/426 (43%), Positives = 263/426 (61%), Gaps = 36/426 (8%)

Query: 8   TLDELLASVLPRGHDFELLHLQDEPAQTHDIVTPMPTTQE-RADTL-TVKIQHFFTLFHN 65
           +L+  +   LP GH+FE+++LQ  P +T  I  P    ++    T+ T+K QHF  L   
Sbjct: 2   SLECYIKDALPFGHEFEIINLQSIPRETSPITFPKREAEDVNGKTVKTIKTQHFVALCFE 61

Query: 66  KKAVFALEIYVYLTLSSLHN---TKLIFVSKADTSGYCDIKLRMGDITKVFLQYLISVDP 122
           +K VFALEI VY +L+S +N    +L+FVSKADT+GYCD++L +G ITK  + Y++++ P
Sbjct: 62  EKVVFALEIVVYFSLNSANNGPVERLLFVSKADTNGYCDLRLDIGQITKSIIAYILAISP 121

Query: 123 LHYLRKVKPLRRVNDHDESLIRKGTSVERSLRILAVRVDLSPHPCQN-TDKFYITRNDVG 181
            HYLR VKPL R       +I++ TSV+R+L IL+ R    P   +  T +  I   D+ 
Sbjct: 122 GHYLRAVKPLIRKALSGAKIIKRSTSVQRALEILSNR----PLDSKGITSRVKIPDQDLY 177

Query: 182 GD----TNWVTKICLFTRPADDYLFIGSSKNAKKHKLNGDQLLKWWMKIIDGLVCTDFDP 237
                 T  VTK+ LFTR    YLF  SSKN +KH L+GD+LLKWW+KI+D +V  DFD 
Sbjct: 178 VSFPVPTEIVTKVSLFTRAEPQYLFSNSSKNPRKHVLSGDKLLKWWLKIVDQIVVEDFD- 236

Query: 238 NNVSARLRVPGEDTGRVSRTYLNGDLTQSNNWQVGDIFGGTGNDLAVFHVPLFPDDPKSR 297
           N   A L++PGE+  RV   YL    T   NW VGDIF  +  D+A++ +PLFPDDPK R
Sbjct: 237 NKTKATLQIPGEEK-RVISNYLRN--TAYQNWTVGDIFSESPQDIALYRIPLFPDDPKGR 293

Query: 298 FIRHLVQENRIMKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKKIPDYL-----PNDR 352
           F+ HL+ + RI K N+ T+W ELQ RQEF+L   VSVIGV G       Y+     P   
Sbjct: 294 FLDHLISDGRISKVNVLTFWTELQARQEFRLGSTVSVIGVSGK------YIGRCNEPERT 347

Query: 353 EIFICSSRRQFRYIRSYVAGEEYDNEEGTLESYVNVRDYLELRYSKKLLKLSG------- 405
           +I I +S++ F+ +++Y+ GEEYD EEG  E+Y+N+RD  ++ YS K++K+ G       
Sbjct: 348 DIIIPTSKKNFKNLKNYITGEEYDTEEGAEEAYMNIRDIFDMHYSTKMIKVIGNHHKIAT 407

Query: 406 TREPEI 411
           T+ PEI
Sbjct: 408 TKRPEI 413

>CAGL0D05786g 550165..551436 similar to tr|Q07794 Saccharomyces
           cerevisiae YLL002w REM50 drug resistance, start by
           similarity
          Length = 423

 Score =  326 bits (836), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/435 (42%), Positives = 263/435 (60%), Gaps = 22/435 (5%)

Query: 9   LDELLASVLPRGHDFELLHLQDEPAQTHDIVTPMPTTQERADTLTVKIQHFFTLFHNKKA 68
           L  +L  VLP+   FE+LHLQ  P+++  +V    + Q RA   T+K +H F L +  + 
Sbjct: 2   LQAILKEVLPQDSSFEILHLQSPPSESAPLVNNT-SKQNRA--TTIKTEHLFCLAYKGRI 58

Query: 69  VFALEIYVYLTLSSLHNT----KLIFVSKADTSGYCDIKLRMGDITKVFLQYLISVDPLH 124
            + LE+YVY+T +  +      +L+FVSKADT+GYCDI++ +  +T   ++Y++S++P +
Sbjct: 59  FYGLELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKLVTLQLIRYVLSINPDY 118

Query: 125 YLRKVKPLRRVNDHDES----LIRKGTSVERSLRILAVRVDLSPHPCQNTDKFYITRNDV 180
           YL +V P  R  D+ +S    LI K T+  ++L+ILA R  L  H     + F       
Sbjct: 119 YLHRVIPKER--DYKKSGRTNLITKATNSRKALKILADR--LQNHNLIEPEIFNAFYTKF 174

Query: 181 GGDTNWVTKICLFTRPADDYLFIGSSKNAKKHKLNGDQLLKWWMKIIDGLVCTDFDPNNV 240
                 VTKI LFTRPAD YLF  SSKN  KH L+GD LLKWW  ++D L+ +DF+ N  
Sbjct: 175 HSGKELVTKIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWASLLDNLLVSDFNLNKT 234

Query: 241 SARLRVPGEDTGRVSRTYLNGDLTQSNNWQVGDIFGGTGNDLAVFHVPLFPDDPKSRFIR 300
            A++R+PGED  R  R Y N    +   W  GDIF    +D  +  +P+FPDDPKSRF++
Sbjct: 235 KAKIRIPGEDKYRFRR-YTNA--LKCGIWTHGDIFSDNDSDSVIKCIPMFPDDPKSRFMK 291

Query: 301 HLVQENRIMKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKKIPDYLPNDREIFICSSR 360
            L +ENRI  T+L T+W ELQERQEFKLSV+VSV+G+ G  +   +Y P+  +++ C S+
Sbjct: 292 QLFEENRIQTTSLDTFWTELQERQEFKLSVVVSVMGISGIYEIDTNYKPST-DVYRCRSK 350

Query: 361 RQFRYIRSYVAGEEYDNEEGTLESYVNVRDYLELRYSKKLLKLSGTREPEIRKPVVASTT 420
           RQF  I++Y+ GEEYD EEG LESY NV DYL  R    LL ++G    +  K     TT
Sbjct: 351 RQFHCIKNYITGEEYDTEEGALESYQNVNDYLS-REGTSLLTVTGN--ADYSKFKQNRTT 407

Query: 421 KRSAIPVTLLQPRKK 435
             + + V  LQ R+K
Sbjct: 408 TSTPVVVNTLQVRRK 422

>Kwal_33.15195
          Length = 428

 Score =  313 bits (802), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 162/400 (40%), Positives = 242/400 (60%), Gaps = 10/400 (2%)

Query: 8   TLDELLASVLPRGHDFELLHLQDEPAQTHDIVTPMPTTQERADTLTVKIQHFFTLFHNKK 67
           +L+ LL  VLP+  + E+ HLQ  P +T+ +V  +P +Q       VKIQHFF L  + K
Sbjct: 5   SLEVLLRDVLPQDVEVEVAHLQSPPRETYPVV--LPHSQANGKQQVVKIQHFFGLCTDNK 62

Query: 68  AVFALEIYVYLTLS-SLHNTKLIFVSKADTSGYCDIKLRMGDITKVFLQYLISVDPLHYL 126
             + LE++VY+ +  S    K++F+SKADT+GYC  +L + +ITK  ++Y+ S+DPL+YL
Sbjct: 63  LFYGLEVFVYVVVQHSKVVDKILFISKADTNGYCARRLSIKNITKALIEYVTSLDPLYYL 122

Query: 127 RKVKPLRRVNDHDESLIRKGTSVERSLRILAVRVDLSPHPCQNTDKFYITRNDVGGDTNW 186
            KV P+ R   +  + I K T+ +R+L+I+  R         +    Y        D  W
Sbjct: 123 VKVIPMNRTRQNYANAITKSTTTKRALQIIRNRHTAGKTSTPDISNLYTQFEKC--DPGW 180

Query: 187 VTKICLFTRPADDYLFIGSSKNAKKHKLNGDQLLKWWMKIIDGLVCTDFDPNNVSARLRV 246
             KICLFTR    YLF  SSKN +KH L+G+QLL WW+ ++D ++  +F  ++  ARL++
Sbjct: 181 TCKICLFTRSEPHYLFSESSKNPEKHILSGEQLLHWWLSVVDAVLFKNFT-SDTKARLQI 239

Query: 247 PGEDTGRVSRTYLNGDLTQSNNWQVGDIFGGTGNDLAVFHVPLFPDDPKSRFIRHLVQEN 306
           PGE+    +  YLNG   +   W+VGDIF    NDLA+F +P+FPDDPK RF+  LV EN
Sbjct: 240 PGEEK-LCTEKYLNGK--KFPQWRVGDIFNSEPNDLAIFKIPVFPDDPKGRFLEQLVDEN 296

Query: 307 RIMKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKKIPDYLPNDREIFICSSRRQFRYI 366
           R  K  +  +W ELQ +QEF++   V+VIG++G     P  +P + EI +  S + F  I
Sbjct: 297 RAKKVQVTGFWTELQIQQEFRMGATVAVIGIDGRVAN-PCIMPRECEIILPKSIKAFNMI 355

Query: 367 RSYVAGEEYDNEEGTLESYVNVRDYLELRYSKKLLKLSGT 406
           ++Y+ GEEYD  +G  E+  N+RD++ LR  + LLK+ GT
Sbjct: 356 KTYITGEEYDTIDGAYEACANIRDFVALRLGRSLLKVQGT 395

>AAL173C [14] [Homologous to ScYLL002W (REM50) - SH] (38265..39527)
           [1263 bp, 420 aa]
          Length = 420

 Score =  256 bits (654), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 155/420 (36%), Positives = 228/420 (54%), Gaps = 19/420 (4%)

Query: 9   LDELLASVLPRGHDFELLHLQDEPAQTHDIVTPMPTTQERADTLTVKIQHFFTLFHNKKA 68
           L ELLA  LP GHDF++LHLQ  PA       P  T        T+  QHFFTL +N K 
Sbjct: 3   LKELLAEALPAGHDFDVLHLQ-SPATER----PPLTEASGCSPTTIAAQHFFTLSNNSKV 57

Query: 69  VFALEIYVYLTLSSLHNTKLIFVSKADTSGYCDIKLRMGDITKVFLQYLISVDPLHYLRK 128
            +AL++ VY+ +      +++FVSKADT+GYCD+++ +   T+  LQ+L+S+DP HYL++
Sbjct: 58  FYALQVVVYICIEGTSGDRMLFVSKADTNGYCDVRVDVRRATRALLQFLLSIDPSHYLQR 117

Query: 129 VKPLRRVNDHDESLIRKGTSVERSLRILAVRV---DLSPHPCQNTDKFYITRNDVGGDTN 185
           V+ +R      + LI   T+   +LRILA R    +L      +  ++            
Sbjct: 118 VRRMRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAADRARY----TSFPCPPQ 173

Query: 186 WVTKICLFTRPADDYLFIGSSKNAKKHKLNGDQLLKWWMKIIDGLVCTDFDPNNVSARLR 245
           + T++ LFTR    YLF  S++N  KH L GD+LL+WW+  +D L+ T FDP   +A L 
Sbjct: 174 YTTRLALFTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDLLVTLFDPATDAA-LL 232

Query: 246 VPGEDTGRVSRTYLNGDLTQSNNWQVGDIFGGTGNDLAVFHVPLFPDDPKSRFIRHLVQE 305
           +PGED+  V+  YL     +   W+VG +FGG+  D A+  +P FPDDPK RF+  L  E
Sbjct: 233 IPGEDSA-VTAHYLRP--VRFPRWRVGHVFGGSAEDPALTRIPRFPDDPKGRFLDDLAHE 289

Query: 306 NRIMKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKKIPDYLPNDREIFICSSRRQFRY 365
            R    +L+ +W EL  RQEF+L V+V V+G  G     P   P   ++   +S   + +
Sbjct: 290 GR--NPSLRAFWTELVARQEFRLGVVVGVVGAAGLYTG-PCARPAPEDLLCPASPADYVH 346

Query: 366 IRSYVAGEEYDNEEGTLESYVNVRDYLELRYSKKLLKLSGTREPEIRKPVVASTTKRSAI 425
           ++ YV  EEY    G  E++ N+ D L LRY   + ++ G      R       TKR A+
Sbjct: 347 VKHYVTAEEYATAAGASEAHRNLVDCLLLRYGVAMPRVRGAHSTTPRPAPTQDATKRPAV 406

>Kwal_26.9422
          Length = 365

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 25/46 (54%)

Query: 379 EGTLESYVNVRDYLELRYSKKLLKLSGTREPEIRKPVVASTTKRSA 424
           +G LE++ N    + + Y K L+    +++P ++K V A  T R +
Sbjct: 218 QGLLENFQNKLKEISIEYEKSLIARKASKDPSLQKQVTADLTTRES 263

>KLLA0F11726g 1080554..1082773 no similarity, hypothetical start
          Length = 739

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/66 (22%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 270 QVGDIFGGTGNDLAVFHVPLFPDDPKSRFIRHLVQENRIMKTNLKTYWMELQERQEFKLS 329
           QVG + G T   + + H+     D  SR ++   Q    +    + YW + Q++QE   +
Sbjct: 14  QVGLLCGRTATSMGLIHIAY---DTLSRLLQRNPQNGTCLLLLCENYWKQNQQQQESNHA 70

Query: 330 VIVSVI 335
           +++ ++
Sbjct: 71  IVIDLL 76

>Scas_697.5
          Length = 674

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 184 TNWVTKICLFTRPADDYLFIGSSKNA-KKHKLNGDQLLKWWMKIIDGLVCTDFDPNNVSA 242
           TNW     L+ R ++D+L I  SKN  + + L+ +    +  K    + C D DPN+   
Sbjct: 367 TNWEH---LYCRLSNDFLVISGSKNVFRVYSLHKEGEPIYTYKSSFAIRCIDIDPNSKLI 423

Query: 243 RLRVPGED 250
              + G+D
Sbjct: 424 ACSILGKD 431

>KLLA0E03146g complement(299014..301380) similar to sp|Q12386
           Saccharomyces cerevisiae YOR141c ARP8 Actin-related
           protein singleton, hypothetical start
          Length = 788

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 33/81 (40%), Gaps = 8/81 (9%)

Query: 292 DDPKSRFIRHLVQENRI--------MKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKK 343
           D P  +  +HL+++ R+            LK   +E QE +     + +  + V      
Sbjct: 34  DIPSKKVPQHLLEKRRLGRIKAAEEFAKKLKIIGIERQENEHIAQPITLKPVSVINQKNY 93

Query: 344 IPDYLPNDREIFICSSRRQFR 364
             +YL ND +IF    R+  R
Sbjct: 94  SSNYLKNDDQIFYMRERKHLR 114

>Scas_626.3*
          Length = 438

 Score = 29.3 bits (64), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 48/106 (45%), Gaps = 5/106 (4%)

Query: 239 NVSARLRVPGEDTGRVSRTYLNGDLTQSNNWQVGDIFGGTGNDLAVFHVPLFPDDPKSRF 298
           ++SA+ RVP +         +  D+ Q+    +GD+   TG    + + PLF     S +
Sbjct: 161 SLSAQNRVPDQALVTAEMNLVMSDMEQNFLSYMGDVLTITGKKAFLTYYPLFTAGSLSDY 220

Query: 299 IRHLVQENRIMKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKKI 344
             +L Q + ++ T+L  Y   L      KL+V+VS +    +   +
Sbjct: 221 SMNLSQFSSLV-TDLPDYTARLST----KLAVLVSSMEAAANAASV 261

>Scas_478.6
          Length = 249

 Score = 28.9 bits (63), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 2/77 (2%)

Query: 364 RYIRSYVAGEEYDNEEGTLESYVNVRDYLELRYSKKLLKLSGTREPEIRKPVVASTTKRS 423
           R  R+ V+  +Y ++  T  S +N+ D+   R +KK  +L  T     ++ VVAS  K  
Sbjct: 6   RTPRTIVSHTKYVSQFHTTGSALNIMDWF--RSNKKKEQLMETVASATKEGVVASKDKLE 63

Query: 424 AIPVTLLQPRKKAKPAK 440
            IP   +  +K  K AK
Sbjct: 64  LIPENFIGRKKNRKRAK 80

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,376,347
Number of extensions: 709340
Number of successful extensions: 1744
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1755
Number of HSP's successfully gapped: 16
Length of query: 440
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 335
Effective length of database: 12,961,219
Effective search space: 4342008365
Effective search space used: 4342008365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)