Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_628.625225213080.0
CAGL0F06919g2502477781e-105
Scas_685.82522437711e-103
ACR171C2512497461e-100
YIR035C2542487441e-99
CAGL0F06897g2582477015e-93
YIR036C2632576651e-87
ABR247W2502484861e-60
ABR249W2502484782e-59
ABR248W2612494662e-57
Sklu_2380.41601434208e-52
ABR246W2502514216e-51
KLLA0E08063g1861423671e-43
KLLA0E08052g1171083481e-41
AFR561W2672281909e-17
KLLA0E09834g2681901846e-16
YMR226C2672061783e-15
Kwal_26.91602671971759e-15
KLLA0B08371g2681971751e-14
KLLA0E13860g8891701781e-14
Scas_594.122672061732e-14
Sklu_1578.32681971688e-14
AGL060W8911801728e-14
Scas_666.17*2831941671e-13
Kwal_47.171022851861644e-13
CAGL0M11242g2681971591e-12
AER373C3001881602e-12
KLLA0F04455g3051671522e-11
Kwal_34.160242921981423e-10
Kwal_26.79508972251419e-10
KLLA0E24046g2802621362e-09
KLLA0D15521g2562211352e-09
Sklu_2348.52891931301e-08
CAGL0L02167g9011921302e-08
CAGL0J04774g3381891274e-08
YLR426W3262251265e-08
KLLA0D02596g3471901266e-08
Scas_478.29202191267e-08
Kwal_14.24442881901231e-07
CAGL0G08690g2942461221e-07
ABL163W2922311221e-07
YKR009C (FOX2)9001921241e-07
Scas_662.43072531168e-07
KLLA0D18909g2901911151e-06
Sklu_1570.17562211161e-06
AER111W3271931141e-06
Kwal_14.15112772131132e-06
KLLA0C12694g2592491122e-06
Kwal_55.195692882021123e-06
Sklu_268.12442071103e-06
YIL124W (AYR1)2971911105e-06
Sklu_2219.33631711105e-06
Kwal_26.88383232161097e-06
YNL202W (SPS19)2951921043e-05
Kwal_23.31072482021025e-05
Kwal_26.82822982231017e-05
Kwal_55.218222832281008e-05
AAL089W3282161009e-05
Sklu_2267.53501921009e-05
KLLA0D06127g3302181001e-04
AEL164C307197991e-04
ADL292C329173991e-04
YKL055C (OAR1)278228982e-04
Sklu_2420.5326119954e-04
Scas_613.18286192944e-04
Kwal_14.2598311197900.002
YBR265W (TSC10)320212890.002
YDL114W308150890.002
Scas_721.47344190890.002
Kwal_23.4572300132890.002
YOR246C330225870.004
CAGL0H08063g290191860.005
ABR076C27193840.010
Scas_655.19297225840.011
CAGL0J11264g40996830.016
Kwal_27.12155280119810.021
Scas_566.11346129790.037
Sklu_2377.6877166750.15
Scas_669.3163850740.23
Scas_652.19d1344160730.24
Kwal_33.1445140698720.33
Scas_641.3128743700.47
CAGL0M13013g270264690.59
Scas_650.8326218700.61
Scas_652.19d341166690.80
Scas_675.10312206680.87
KLLA0F17050g33883671.5
KLLA0B09812g346186661.7
YMR162C (DNF3)165651662.5
YMR090W22788642.6
KLLA0F01749g313201642.6
Sklu_2404.1330155624.6
CAGL0K09152g327216634.6
CAGL0M11616g488073635.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_628.6
         (252 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_628.6                                                            508   0.0  
CAGL0F06919g complement(677473..678225) similar to sp|P40579 Sac...   304   e-105
Scas_685.8                                                            301   e-103
ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH] (6...   291   e-100
YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member ...   291   1e-99
CAGL0F06897g complement(675416..676192) highly similar to sp|P40...   274   5e-93
YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reducta...   260   1e-87
ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   191   1e-60
ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   188   2e-59
ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   184   2e-57
Sklu_2380.4 YIR035C, Contig c2380 9858-10340                          166   8e-52
ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   166   6e-51
KLLA0E08063g complement(726232..726792) some similarities with s...   145   1e-43
KLLA0E08052g complement(725895..726248) similar to sp|P40580 Sac...   138   1e-41
AFR561W [3753] [Homologous to ScYMR226C - SH] complement(1438981...    78   9e-17
KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7 Ent...    75   6e-16
YMR226C (YMR226C) [4182] chr13 complement(721592..722395) NADP+-...    73   3e-15
Kwal_26.9160                                                           72   9e-15
KLLA0B08371g complement(747517..748323) highly similar to sp|Q05...    72   1e-14
KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces...    73   1e-14
Scas_594.12                                                            71   2e-14
Sklu_1578.3 YMR226C, Contig c1578 1774-2580                            69   8e-14
AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH] complement(...    71   8e-14
Scas_666.17*                                                           69   1e-13
Kwal_47.17102                                                          68   4e-13
CAGL0M11242g complement(1105723..1106529) highly similar to sp|Q...    66   1e-12
AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH] (1327314..1...    66   2e-12
KLLA0F04455g complement(428010..428927) similar to sp|P40471 Sac...    63   2e-11
Kwal_34.16024                                                          59   3e-10
Kwal_26.7950                                                           59   9e-10
KLLA0E24046g complement(2136583..2137425) similar to ca|CA3771|C...    57   2e-09
KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcin...    57   2e-09
Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement       55   1e-08
CAGL0L02167g 253055..255760 highly similar to sp|Q02207 Saccharo...    55   2e-08
CAGL0J04774g join(452094..452179,452259..453189) similar to tr|Q...    54   4e-08
YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109) M...    53   5e-08
KLLA0D02596g join(complement(219682..219797),complement(218659.....    53   6e-08
Scas_478.2                                                             53   7e-08
Kwal_14.2444                                                           52   1e-07
CAGL0G08690g complement(822798..823682) similar to sp|P40471 Sac...    52   1e-07
ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH] complement(...    52   1e-07
YKR009C (FOX2) [3265] chr11 complement(453995..456697) Multifunc...    52   1e-07
Scas_662.4                                                             49   8e-07
KLLA0D18909g complement(1592628..1593500) similar to sp|P32573 S...    49   1e-06
Sklu_1570.1 YKR009C, Contig c1570 100-2370                             49   1e-06
AER111W [2616] [Homologous to ScYLR426W - SH] complement(846805....    49   1e-06
Kwal_14.1511                                                           48   2e-06
KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces...    48   2e-06
Kwal_55.19569                                                          48   3e-06
Sklu_268.1 , Contig c268 57-791 reverse complement                     47   3e-06
YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacet...    47   5e-06
Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement         47   5e-06
Kwal_26.8838                                                           47   7e-06
YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal 2,4-di...    45   3e-05
Kwal_23.3107                                                           44   5e-05
Kwal_26.8282                                                           44   7e-05
Kwal_55.21822                                                          43   8e-05
AAL089W [98] [Homologous to ScYOR246C - SH] complement(184564..1...    43   9e-05
Sklu_2267.5 YNL202W, Contig c2267 5903-6955                            43   9e-05
KLLA0D06127g complement(526164..527156) similar to sgd|S0005772 ...    43   1e-04
AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH] (326834..3...    43   1e-04
ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [...    43   1e-04
YKL055C (OAR1) [3204] chr11 complement(334966..335802) 3-Oxoacyl...    42   2e-04
Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement        41   4e-04
Scas_613.18                                                            41   4e-04
Kwal_14.2598                                                           39   0.002
YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine re...    39   0.002
YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the shor...    39   0.002
Scas_721.47                                                            39   0.002
Kwal_23.4572                                                           39   0.002
YOR246C (YOR246C) [5035] chr15 complement(795801..796793) Member...    38   0.004
CAGL0H08063g 785331..786203 highly similar to sp|P32573 Saccharo...    38   0.005
ABR076C [667] [Homologous to ScYKL055C (OAR1) - SH] (527756..528...    37   0.010
Scas_655.19                                                            37   0.011
CAGL0J11264g complement(1094218..1095447) highly similar to sp|P...    37   0.016
Kwal_27.12155                                                          36   0.021
Scas_566.11                                                            35   0.037
Sklu_2377.6 YER070W, Contig c2377 15087-17720 reverse complement       33   0.15 
Scas_669.3                                                             33   0.23 
Scas_652.19d1                                                          33   0.24 
Kwal_33.14451                                                          32   0.33 
Scas_641.31                                                            32   0.47 
CAGL0M13013g complement(1281291..1282103) similar to sp|P35731 S...    31   0.59 
Scas_650.8                                                             32   0.61 
Scas_652.19d                                                           31   0.80 
Scas_675.10                                                            31   0.87 
KLLA0F17050g complement(1564921..1565937) similar to sp|P32419 S...    30   1.5  
KLLA0B09812g complement(856799..857839) similar to sp|P38286 Sac...    30   1.7  
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    30   2.5  
YMR090W (YMR090W) [4048] chr13 (449244..449927) Protein of unkno...    29   2.6  
KLLA0F01749g complement(163821..164762) similar to sp|P38342 Sac...    29   2.6  
Sklu_2404.13 YKL055C, Contig c2404 24100-25005                         28   4.6  
CAGL0K09152g 909456..910439 highly similar to tr|Q08651 Saccharo...    29   4.6  
CAGL0M11616g complement(1141541..1156183) similar to sp|Q12019 S...    29   5.2  

>Scas_628.6
          Length = 252

 Score =  508 bits (1308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/252 (100%), Positives = 252/252 (100%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDV 60
           MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDV
Sbjct: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDV 60

Query: 61  TNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQ 120
           TNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQ
Sbjct: 61  TNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQ 120

Query: 121 STLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPG 180
           STLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPG
Sbjct: 121 STLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPG 180

Query: 181 VVDTQMQVDIREKYGNEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGK 240
           VVDTQMQVDIREKYGNEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGK
Sbjct: 181 VVDTQMQVDIREKYGNEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGK 240

Query: 241 YSRYNDDRLASL 252
           YSRYNDDRLASL
Sbjct: 241 YSRYNDDRLASL 252

>CAGL0F06919g complement(677473..678225) similar to sp|P40579
           Saccharomyces cerevisiae YIR035c or sp|P40580
           Saccharomyces cerevisiae YIR036c, start by similarity
          Length = 250

 Score =  304 bits (778), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 145/247 (58%), Positives = 189/247 (76%), Gaps = 1/247 (0%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63
           KV++VTG SRGIG AIV  I+ L+SNAVV+GIAR    LK LK   G +F Y+ GD+T++
Sbjct: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDE 62

Query: 64  SDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123
             + +++   + + GR+DS+VANAGVLEPVA+VG      WK+L+DINFFSI+ L+  TL
Sbjct: 63  DKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTL 122

Query: 124 PFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVVD 183
           P +E +  N +FVSSGAS K Y+GW AY +SKAA+N   MS+A E   +KTI+VAPGVVD
Sbjct: 123 PHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVVD 182

Query: 184 TQMQVDIREKYG-NEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYS 242
           T+MQ DIR+K+G + MT ++LKRF DL KNGELLD+DVPG++YA+LAV+GIP ELNG+Y 
Sbjct: 183 TKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGEYV 242

Query: 243 RYNDDRL 249
           RYND RL
Sbjct: 243 RYNDSRL 249

>Scas_685.8
          Length = 252

 Score =  301 bits (771), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 144/243 (59%), Positives = 191/243 (78%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63
           KVIIVTGVSRGIG++IV +I  L+S+A+V+GIAR+ APLK LK  +G++FFY+ GD+T++
Sbjct: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQ 62

Query: 64  SDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123
             ++KL+  A  + G++DSVVANAGVLEPV +V  +D +AWK+LFDINFFS+VSL   TL
Sbjct: 63  VALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSITL 122

Query: 124 PFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVVD 183
           P+++ TN N VFVSS AS   +  W AYSASKA LN FAM+VANE+P VK +SVAPG+VD
Sbjct: 123 PYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIVD 182

Query: 184 TQMQVDIREKYGNEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYSR 243
           T MQV+IRE  G +MT+E    F DL ++ +LLDS+VP  VY+KLA+NGIP ++NGKY  
Sbjct: 183 TSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKYLS 242

Query: 244 YND 246
           ++D
Sbjct: 243 FDD 245

>ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH]
           (654580..654909,654959..655384) [756 bp, 251 aa]
          Length = 251

 Score =  291 bits (746), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 186/249 (74%), Gaps = 2/249 (0%)

Query: 3   PKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTN 62
           P++IIVTGVSRGIGR++V K+     + VV G+AR+ A L+EL++ +GE+F Y+VGDV +
Sbjct: 2   PRLIIVTGVSRGIGRSVVEKVC-RQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVAS 60

Query: 63  KSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQST 122
           + D +  + A    +GR+D+VVANAGVLEPV +V  +D  AW+RL+++NFFS+V LV   
Sbjct: 61  E-DAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRA 119

Query: 123 LPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVV 182
           LP ++    + VFVSSGAS KAY  W AY +SKAALN FAM++A E+P V+ ++VAPGVV
Sbjct: 120 LPLLKKAGGSVVFVSSGASTKAYSAWGAYGSSKAALNHFAMTLAAEEPAVRAVAVAPGVV 179

Query: 183 DTQMQVDIREKYGNEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYS 242
           DTQMQ DIR+K+G+ M  E+L+RF +L KN ELLD  +P  ++A LA+ GIPD  NGKY 
Sbjct: 180 DTQMQNDIRDKFGHRMAPEALRRFTELKKNSELLDPQIPATIFANLALRGIPDCANGKYL 239

Query: 243 RYNDDRLAS 251
           RYNDD LA+
Sbjct: 240 RYNDDILAA 248

>YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member of
           the short-chain alcohol dehydrogenase family [765 bp,
           254 aa]
          Length = 254

 Score =  291 bits (744), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 144/248 (58%), Positives = 190/248 (76%), Gaps = 1/248 (0%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63
           KVI+VTGVSRGIG++IV+ +  L+ + VV+G+AR+ APLK+LK K+G++FFY+VGD+T  
Sbjct: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITED 62

Query: 64  SDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123
           S +K+L+ AA+   G++DS+VANAGVLEPV  V ++D  AWK+L+DINFFSIVSLV   L
Sbjct: 63  SVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIAL 122

Query: 124 PFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVVD 183
           P ++ TN N VFVSS A    +  W AY +SKAALN FAM++ANE+ +VK I+VAPG+VD
Sbjct: 123 PELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGIVD 182

Query: 184 TQMQVDIREKYG-NEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYS 242
           T MQV+IRE  G + M+ E LK F  L +N +LLDS VP  VYAKLA++GIPD +NG+Y 
Sbjct: 183 TDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQYL 242

Query: 243 RYNDDRLA 250
            YND  LA
Sbjct: 243 SYNDPALA 250

>CAGL0F06897g complement(675416..676192) highly similar to sp|P40579
           Saccharomyces cerevisiae YIR035c, hypothetical start
          Length = 258

 Score =  274 bits (701), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 130/247 (52%), Positives = 186/247 (75%), Gaps = 1/247 (0%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63
           KVI+VTGVSRGIG++IV+ +  L+ N +V+GIAR+ APLK LK  +G++FFY VGD+TN 
Sbjct: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66

Query: 64  SDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123
             +KK + +AI+  G+++S++ANAGVLEPV  +  +D  AWK+L++INFFSIVSLV   L
Sbjct: 67  DTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIAL 126

Query: 124 PFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVVD 183
           P ++ T+ + +FVSS AS   +  W AY +SKAALN FAM++ANE+  V+ ++VAPG+VD
Sbjct: 127 PHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVD 186

Query: 184 TQMQVDIREKYGNE-MTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYS 242
           T MQV+IRE  G + M+ E L+ F DL K+ +LL S +P  VY+KLA+NGIP+E+NG+Y 
Sbjct: 187 TDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQYL 246

Query: 243 RYNDDRL 249
            ++ + L
Sbjct: 247 SFDAEVL 253

>YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reductase
           in the short-chain dehydrogenase/reductase (SDR) family
           of proteins [792 bp, 263 aa]
          Length = 263

 Score =  260 bits (665), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 133/257 (51%), Positives = 180/257 (70%), Gaps = 10/257 (3%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHG-EKFFYIVGDVTN 62
           KVI++TG SRGIG  +V  +I  +   +V+G+ART A L+ L+ ++G +KF Y V D+T+
Sbjct: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62

Query: 63  KSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEE----AWKRLFDINFFSIVSL 118
           +S ++ L+     K G+LD +VANAG+LEPV  + + + E     W+RLFD+NFFSIVSL
Sbjct: 63  RSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSL 122

Query: 119 VQSTLPFMENTN--RNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKP--KVKT 174
           V   LP ++++    N VFVSSGASVK Y GW+AY  SKAALN FAM +A+E+P  KV+ 
Sbjct: 123 VALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRA 182

Query: 175 ISVAPGVVDTQMQVDIREKYGNE-MTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGI 233
           + +APGVVDTQMQ DIRE  G + MT ++L+RF  L+K   LLD  VP  V A+L + GI
Sbjct: 183 VCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLKGI 242

Query: 234 PDELNGKYSRYNDDRLA 250
           PD LNG+Y RYND+RL 
Sbjct: 243 PDSLNGQYLRYNDERLG 259

>ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(858589..859341) [753 bp, 250 aa]
          Length = 250

 Score =  191 bits (486), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 153/248 (61%), Gaps = 3/248 (1%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63
           +V+IVTG SRGIG A V K+    ++ VV G+AR    L++LK++HG+KF Y+VGDVT++
Sbjct: 2   RVVIVTGASRGIGEATVEKLCP-TADVVVVGVARAETKLQKLKARHGKKFDYVVGDVTDE 60

Query: 64  SDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123
             V+ +I     ++GRLD+VVANAGV      +   D + W+RLF+IN FS+V+LV   L
Sbjct: 61  RVVQAVIDKVSSEYGRLDAVVANAGVSRH-ERIATADIKEWRRLFEINLFSVVNLVSKAL 119

Query: 124 PFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVVD 183
           P +  +    + VSSG S   +   AAY++SK ALN FA+ +A E+P+++TI++ PG V 
Sbjct: 120 PLLRESQGTVIVVSSGLSQMGHPALAAYASSKIALNHFALILAMEEPEIRTIALDPGAVQ 179

Query: 184 TQMQVDIREKYGNEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYSR 243
           T M  +      +E          +L K   +   + PG V A LA  GIP+ELNGKY R
Sbjct: 180 TDMLAE-GINAADEAAGSQDNAVRELLKQVRVATPEEPGAVLAALAARGIPEELNGKYVR 238

Query: 244 YNDDRLAS 251
            + ++LA+
Sbjct: 239 ADSEKLAA 246

>ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(861237..861989) [753 bp, 250 aa]
          Length = 250

 Score =  188 bits (478), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 154/248 (62%), Gaps = 3/248 (1%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63
           KVIIVTG SRGIG A V+++     + VV G+AR    L+ELK++HG+KF Y+VGDVT++
Sbjct: 2   KVIIVTGASRGIGAATVDRLCS-TPDVVVVGVARAETKLQELKARHGKKFDYVVGDVTDE 60

Query: 64  SDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123
             V+ +I     ++GRLD+VVANAGV      + + D + W+RLF+IN FS+V+L    L
Sbjct: 61  RVVQAVIDKVSSEYGRLDAVVANAGV-SYQQRIAEADIKEWRRLFEINLFSVVNLASKAL 119

Query: 124 PFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVVD 183
           P +  +   ++ V+SG S   +   AAY++SK ALN FA+ +A E+ +++++++ PG+V 
Sbjct: 120 PLLRKSQGAFIAVTSGLSQMGHPALAAYASSKIALNHFALILAMEETEIRSLALDPGLVQ 179

Query: 184 TQMQVDIREKYGNEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYSR 243
           T M             T+      +L K   ++  + PG V A LA  GIP+ELNGKY  
Sbjct: 180 TDMTAAALVAADKAAGTQD-NSVRELTKQIRMVSPEEPGTVLAALAAKGIPEELNGKYVT 238

Query: 244 YNDDRLAS 251
           ++ ++LA+
Sbjct: 239 FDSEKLAA 246

>ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(859663..860448) [786 bp, 261 aa]
          Length = 261

 Score =  184 bits (466), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/249 (41%), Positives = 151/249 (60%), Gaps = 5/249 (2%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63
           KVIIVTG SRGIG A V+++       VV G+AR    L+ELK++HG+KF Y+VGDVT++
Sbjct: 13  KVIIVTGASRGIGAATVDRLCS-TPEVVVVGVARAETKLQELKARHGKKFDYVVGDVTDE 71

Query: 64  SDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123
             V+ +I      +GRLD+VVANAGV      +   D + W+RLF+IN FS+V+L    L
Sbjct: 72  RVVQAVIDKVSSGYGRLDAVVANAGVAGH-ERIEDADIKEWRRLFEINLFSVVNLASKAL 130

Query: 124 PFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVVD 183
           P +  +   ++ VSS  S       A Y++SK ALN FAM +A E+P+++TI++ PGV  
Sbjct: 131 PLLRKSQGAFLVVSSMLSQMGVPAVATYASSKIALNHFAMILAMEEPEIRTIALDPGVAQ 190

Query: 184 TQMQVD-IREKYGNEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYS 242
           T M  D +        T ++  R  ++ ++  +   D PG V A LA  GIP+ELNGK+ 
Sbjct: 191 TDMLTDGLNAADQAAGTQDNAAR--EMMRHVRVASPDEPGTVLAALAAKGIPEELNGKFV 248

Query: 243 RYNDDRLAS 251
            Y+ + LA+
Sbjct: 249 VYDSEELAA 257

>Sklu_2380.4 YIR035C, Contig c2380 9858-10340
          Length = 160

 Score =  166 bits (420), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 84/143 (58%), Positives = 106/143 (74%), Gaps = 1/143 (0%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIG-LNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTN 62
           KV++VTG SRGIG+AIVN +    NS  VV GIAR+  PL  +K  HG+KF YI+GD+++
Sbjct: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62

Query: 63  KSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQST 122
           +  +KK +  AI KFGR+D+VVANAGVLEPV +V  +D   WKRLFD+NFFSIVSLV  +
Sbjct: 63  EEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIVSLVSLS 122

Query: 123 LPFMENTNRNYVFVSSGASVKAY 145
           LP ++  N N VFVSSGAS K Y
Sbjct: 123 LPHLKKFNGNIVFVSSGASTKPY 145

>ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(857415..858167) [753 bp, 250 aa]
          Length = 250

 Score =  166 bits (421), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 103/251 (41%), Positives = 150/251 (59%), Gaps = 10/251 (3%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63
           +VIIVTG SRGIG A V K+     + VV G+AR    LK LK ++G KF Y+ GDVT++
Sbjct: 3   RVIIVTGASRGIGEATVEKLC-TAPDVVVVGVARAEKTLKVLKERYGSKFDYVAGDVTDE 61

Query: 64  SDVKKLITAAIDKFGRLDSVVANAGV--LEPVAEVGKVDEEAWKRLFDINFFSIVSLVQS 121
           S V+ ++      +GRLD+++ANAGV   E +AE    D + WKR F+I   S VSLV  
Sbjct: 62  SVVQAVLDKVSSDYGRLDAIIANAGVSRFERIAE---ADIQQWKRTFEI-IVSAVSLVSK 117

Query: 122 TLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGV 181
            LP +  +    + V+SG S   Y   A+ ++SK ALN F   +A E+P ++ ++VAPGV
Sbjct: 118 ALPMLRKSQGTVIVVTSGLSKVGYRASASSASSKIALNHFIRILAAEEPALRAVAVAPGV 177

Query: 182 VDTQMQVDIREKYGNEMTTESLKRFID-LHKNGELLDSDVPGEVYAKLAVNGIPDELNGK 240
           V T M V+  +   +E    +   F   + K G ++  D PG V A LAV GIP ELNG+
Sbjct: 178 VRTDMTVEALD--ASEDAPGARDNFFKAVLKQGRVVLPDAPGAVLAALAVKGIPQELNGR 235

Query: 241 YSRYNDDRLAS 251
           + +++ ++LA+
Sbjct: 236 FVQFDSEKLAA 246

>KLLA0E08063g complement(726232..726792) some similarities with
           sp|P40579 Saccharomyces cerevisiae YIR035c, hypothetical
           start
          Length = 186

 Score =  145 bits (367), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 99/142 (69%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63
           KV +VTGVSRGIG +IV K+  + +  +V GIAR+   L+ELK+++  KF YI GDV+++
Sbjct: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDE 62

Query: 64  SDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123
             + + +     K+ RLD +VANAGVL+PV +V  +    WK+LFDINFFS+VSLV   L
Sbjct: 63  ETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGHAL 122

Query: 124 PFMENTNRNYVFVSSGASVKAY 145
           P ++ +N N V VSSGAS K+Y
Sbjct: 123 PLLKQSNGNIVLVSSGASTKSY 144

>KLLA0E08052g complement(725895..726248) similar to sp|P40580
           Saccharomyces cerevisiae YIR036c, hypothetical start
          Length = 117

 Score =  138 bits (348), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 1/108 (0%)

Query: 146 FGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVVDTQMQVDIREKYG-NEMTTESLK 204
           +GW AY ASKAALN FA ++A E+P VK ISVAPGVV T+MQ DIRE +G + MT E+L+
Sbjct: 8   YGWGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQ 67

Query: 205 RFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYSRYNDDRLASL 252
           RF+DLH N +LL   VPG +YA LA  GIP EL+G Y RYND++L S 
Sbjct: 68  RFVDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSF 115

>AFR561W [3753] [Homologous to ScYMR226C - SH]
           complement(1438981..1439784) [804 bp, 267 aa]
          Length = 267

 Score = 77.8 bits (190), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 115/228 (50%), Gaps = 17/228 (7%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAV-VFGIARTSAPLKELKSKHGEKF---FYI 56
           ++ K+++VTG S GIGRA           A+ +  +AR +  L  LK +   K+      
Sbjct: 11  LANKIVLVTGASAGIGRATAINYADATDGAIKLILVARRAEKLTSLKQEIESKYPNAKIH 70

Query: 57  VG--DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFS 114
           VG  DVT    ++  +    ++F  +D ++ NAG       VG++  +  + +F+ N   
Sbjct: 71  VGQLDVTQLDQIRPFLEGLPEEFRDIDILINNAGKALGTERVGEISMDDIQEVFNTNVIG 130

Query: 115 IVSLVQSTLPFMENTNR-NYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE--KPK 171
           +V L Q  LP M+  N  + V V S A  +AY G + Y A+K A+ +F  ++  E    K
Sbjct: 131 LVHLTQEVLPIMKAKNSGDIVNVGSIAGREAYPGGSIYCATKHAVKAFTRAMRKELISTK 190

Query: 172 VKTISVAPGVVDTQMQVDIREKYGNEMTTESLKRFIDLHKNGELLDSD 219
           ++   +APG V+T+  + +R + GNE   E+ K+   +++  E LD D
Sbjct: 191 IRVFEIAPGSVETEFSM-VRMR-GNE---ENAKK---VYQGFEPLDGD 230

>KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7
           Enterobacter cloacae Putative oxidoreductase, start by
           similarity
          Length = 268

 Score = 75.5 bits (184), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 94/190 (49%), Gaps = 12/190 (6%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIART-SAPLKELKSKHGEKFFYIVGD 59
           M  +VI++TG S GIG +I   +   ++   VFG +R  S P KE        F  I  D
Sbjct: 1   MKKQVILITGASTGIGLSIAETL--RSAGYEVFGTSRKGSIPGKEYS------FKMIKLD 52

Query: 60  VTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLV 119
           +T++  VK  +   I+K GR+D +V NAG+    A V +   +  K +F+ NFF +  + 
Sbjct: 53  ITDEESVKSAVNEVIEKAGRIDVLVNNAGIAFKWAAVEECSTDLAKTIFETNFFGVHRMT 112

Query: 120 QSTLPFM-ENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPK--VKTIS 176
           ++ LP M E  +   + +SS   +      A Y +SK AL  +  S+  E  K  +   +
Sbjct: 113 RAVLPHMREQRHGKIINISSMGGIMPIPYGALYCSSKHALEGYTESLDYEVKKFGIHVST 172

Query: 177 VAPGVVDTQM 186
           + P ++ T M
Sbjct: 173 IDPHIIKTGM 182

>YMR226C (YMR226C) [4182] chr13 complement(721592..722395)
           NADP+-dependent L-allo-threonine dehydrogenase, member
           of the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases [804 bp, 267
           aa]
          Length = 267

 Score = 73.2 bits (178), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 106/206 (51%), Gaps = 11/206 (5%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKII-GLNSNAVVFGIARTSAPLKELKSKHGEKF----FY 55
           ++ K +++TG S GIG+A   + +   N +  +   AR    L+ELK    ++F     +
Sbjct: 11  LAKKTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQEFPNAKVH 70

Query: 56  IVG-DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFS 114
           +   D+T    +K  I     +F  +D +V NAG       VG++  E  + +FD N  +
Sbjct: 71  VAQLDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTA 130

Query: 115 IVSLVQSTLPFMENTNR-NYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE--KPK 171
           ++++ Q+ LP  +  N  + V + S A   AY   + Y ASK A+ +F  S+  E    K
Sbjct: 131 LINITQAVLPIFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKELINTK 190

Query: 172 VKTISVAPGVVDTQMQVDIREKYGNE 197
           ++ I +APG+V+T+  + +R + GNE
Sbjct: 191 IRVILIAPGLVETEFSL-VRYR-GNE 214

>Kwal_26.9160
          Length = 267

 Score = 72.0 bits (175), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 100/197 (50%), Gaps = 9/197 (4%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKII-GLNSNAVVFGIARTSAPLKELKSKHGEKF----FY 55
           ++ K +++TG S GIG+A   + +   N N  +   AR    LKE+KS+  + F     Y
Sbjct: 11  LAGKTVLITGASAGIGQATALEYLDASNGNIKLILAARRLEKLKEIKSQFEKDFPEAKVY 70

Query: 56  IVG-DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFS 114
           I   DVT+  ++K  I    ++F  +D ++ NAG       VG +D    + +   N  +
Sbjct: 71  IGQLDVTHTDEIKPFIDNLPEEFKDIDILINNAGKALGSDPVGTIDASDIEGMIQTNVVA 130

Query: 115 IVSLVQSTLPFMENTNR-NYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE--KPK 171
           ++++ Q+ LP  +  N  + V + S A  +AY   + Y A+K A+ +F  S+  E     
Sbjct: 131 LINMTQAVLPIFKAKNAGDIVNLGSVAGREAYPTGSIYCATKHAVRAFTQSLRKELINTN 190

Query: 172 VKTISVAPGVVDTQMQV 188
           ++ I +APG V+T+  +
Sbjct: 191 IRVIEIAPGNVETEFSL 207

>KLLA0B08371g complement(747517..748323) highly similar to sp|Q05016
           Saccharomyces cerevisiae YMR226c, start by similarity
          Length = 268

 Score = 72.0 bits (175), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 96/197 (48%), Gaps = 9/197 (4%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKII-GLNSNAVVFGIARTSAPLKELKSKHGEKF----FY 55
           +  K I +TG S GIG+A   + +   N N  +   AR  A L+ELK K   ++     Y
Sbjct: 11  LQNKTIFITGASAGIGQATALEYLDAANGNVKLILAARRLAKLEELKEKINAEYPQAKVY 70

Query: 56  IVG-DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFS 114
           I   DVT    ++  I    ++F  +D ++ NAG       VG +  E  K + D N  +
Sbjct: 71  IGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVA 130

Query: 115 IVSLVQSTLPFMENTNR-NYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE--KPK 171
           ++++ Q+ LP  +  N  + V + S A   AY   + Y ASK A+ +F  S+  E     
Sbjct: 131 LINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTG 190

Query: 172 VKTISVAPGVVDTQMQV 188
           ++ I +APG V+T+  +
Sbjct: 191 IRVIEIAPGNVETEFSL 207

>KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces
           cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase, peroxisomal
           singleton, start by similarity
          Length = 889

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 88/170 (51%), Gaps = 5/170 (2%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTN- 62
           KV+I+TG   G+G++         +  V+  I   SA + E+  K+G      V D  + 
Sbjct: 314 KVVIITGSGSGLGKSHAQWFARYGAKVVINDIRDPSAVVDEINKKYGSG--SAVADTHDI 371

Query: 63  KSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQST 122
             + ++++  A+DKFGR+D +V NAG+L   +   K+ E+ W  + +++ FS  +L ++ 
Sbjct: 372 VKEAQQVVQTAVDKFGRVDILVNNAGILRDRS-FAKMTEDEWNAVINVHLFSTFALSKAV 430

Query: 123 LPFMENTNRNYVF-VSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPK 171
            P        Y+   +S + +   FG   Y+A+KAA+  F+ ++A E  K
Sbjct: 431 WPIFLKQKSGYIINTTSTSGIYGNFGQCNYAAAKAAILGFSRTLALEGTK 480

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 88/186 (47%), Gaps = 17/186 (9%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAP--LKELKSKHGEKFFYIVGD-V 60
           +V+I+TG   G+GR    +        VV  + R++A   ++E+K   GE      GD V
Sbjct: 8   RVVIITGAGGGLGRVYALEYAKRGGKVVVNDLGRSAADSVVQEIKKLGGE------GDAV 61

Query: 61  TNKSDVKK----LITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIV 116
            N   V      ++  AI  FGR+D ++ NAG+L   +   K+ E+ ++++ D++     
Sbjct: 62  ANYDSVSDNGAAIVETAISNFGRVDILINNAGILRD-SSFAKMSEKQFQQVIDVHLNGAF 120

Query: 117 SLVQSTLPFMENTNRNYVF-VSSGASVKAYFGWAAYSASKAALNSFAMSVANE--KPKVK 173
            L ++  P M       +    S A +   FG A YSA+K  L  F  S+A E  K  + 
Sbjct: 121 KLTRAAWPHMRKQKFGRIINTCSPAGLYGNFGQANYSAAKLGLLGFGESLAKEGYKYNIN 180

Query: 174 TISVAP 179
             S+AP
Sbjct: 181 VNSIAP 186

>Scas_594.12
          Length = 267

 Score = 71.2 bits (173), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 106/206 (51%), Gaps = 10/206 (4%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAV-VFGIARTSAPLKELK----SKHGEKFFY 55
           ++ K++ +TG S GIG+A   + +  ++  V +  +AR    L++LK    +K+ +   Y
Sbjct: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVY 70

Query: 56  IVG-DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFS 114
           I   DVT    ++  +    ++F  +D ++ NAG       VG +D +  K + D N   
Sbjct: 71  IGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLG 130

Query: 115 IVSLVQSTLPFMENTNR-NYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE--KPK 171
           ++++ Q+ L   +  N  + V + S A   AY   + Y ASK A+ +F  S+  E    K
Sbjct: 131 LINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTK 190

Query: 172 VKTISVAPGVVDTQMQVDIREKYGNE 197
           ++ I +APG+V+T+  V +R K  NE
Sbjct: 191 IRVILIAPGIVETEFSV-VRYKGDNE 215

>Sklu_1578.3 YMR226C, Contig c1578 1774-2580
          Length = 268

 Score = 69.3 bits (168), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 97/197 (49%), Gaps = 9/197 (4%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGI-ARTSAPLKELKSK----HGEKFFY 55
           ++ K + +TG S GIG+A   +    ++  +   + AR    L+ELK K    + E   Y
Sbjct: 11  LANKTVFITGASAGIGQATALEYCDASNGKINLVLSARRLEKLQELKDKITKEYPEAKVY 70

Query: 56  I-VGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFS 114
           I V DVT    +K  +    ++F  +D ++ NAG       VG +  E  + + + N  +
Sbjct: 71  IGVLDVTETEKIKPFLDGLPEEFKDIDILINNAGKALGSDPVGTIKTEDIEGMINTNVLA 130

Query: 115 IVSLVQSTLPFMENTN-RNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE--KPK 171
           ++++ Q+ LP  +  N  + V + S A   AY   A Y ASK A+ +F  S+  E     
Sbjct: 131 LINITQAVLPIFKAKNFGDIVNLGSVAGRDAYPTGAIYCASKHAVRAFTQSLRKELVNTN 190

Query: 172 VKTISVAPGVVDTQMQV 188
           ++ I +APG V+T+  +
Sbjct: 191 IRVIEIAPGNVETEFSL 207

>AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH]
           complement(595270..597945) [2676 bp, 891 aa]
          Length = 891

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 92/180 (51%), Gaps = 7/180 (3%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTN- 62
           KV+I+TG   G+GR+         +  VV  +      + E+ S++GE     V D  N 
Sbjct: 320 KVVIITGAGAGLGRSHALWFAKYGARVVVNDLKGADGVVAEINSQYGEG--RAVADSHNI 377

Query: 63  KSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQST 122
            +D   ++  A+  F R+D +V NAG+L   + V   D+E W  +  ++  S+ +L ++ 
Sbjct: 378 VTDAAAVVETAMKAFERVDVLVNNAGILRDRSFVKMTDDE-WNSVLQVHLLSVFALSKAV 436

Query: 123 LP-FMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPK--VKTISVAP 179
            P FM+  +   V  +S + +   FG A YSA+KAA+  F+ S+A E  K  ++   +AP
Sbjct: 437 WPIFMQQRSGVIVNTTSTSGIYGNFGQANYSAAKAAVLGFSKSLAIEGAKRGIRVYVIAP 496

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 83/190 (43%), Gaps = 19/190 (10%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIART-----------SAPLKELKSKHGEK 52
           +V+I+TG   G+GR          +  VV  +  T              ++E++   G  
Sbjct: 8   RVVIITGAGGGLGREYALDYAKRGAKVVVNDLGGTLGGSGHDTRAADKVVEEIRKAGGTA 67

Query: 53  FFYIVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINF 112
               V +    +D  K++  AID FGR+D +V NAG+L       K+ E+ +  + D++ 
Sbjct: 68  ----VANYDTVTDGDKIVKTAIDAFGRVDVIVNNAGILRD-GSFAKMTEKNFSAVVDVHL 122

Query: 113 FSIVSLVQSTLPFMENTNRNYVF-VSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPK 171
                L ++  P+M       +   +S A +   FG   YSA+K  L   + ++A E  K
Sbjct: 123 NGSYKLCKAAWPYMRQQKYGRIVNTASPAGLYGNFGQTNYSAAKLGLVGLSETLAKEGHK 182

Query: 172 --VKTISVAP 179
             +K   +AP
Sbjct: 183 YNIKVNVIAP 192

>Scas_666.17*
          Length = 283

 Score = 68.9 bits (167), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 96/194 (49%), Gaps = 17/194 (8%)

Query: 2   SPKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVT 61
           SP V+I TG S G+G AIV + +       +  + + S+P      +   +   I  D++
Sbjct: 25  SPCVVI-TGGSHGLGHAIVVRFLNKVPKITIINVDKISSP------QDDPRMVTIQCDLS 77

Query: 62  NKSDVKKLITAAIDKFG-RLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQ 120
           N+ +++K ++    K+G R+  ++ NAG+         +D+    R+F +N F+ V  +Q
Sbjct: 78  NQVEMEKTLSLIKRKYGERIAVIINNAGMRMKYQNFQHLDQNECMRVFQLNTFNAVRFMQ 137

Query: 121 STLPFMENTNRNYVFVSSGASVKAYFG---WAAYSASKAALNSFAMSVANEKP-----KV 172
           S +P  EN+N    ++ + AS          A Y ASK+AL +F  S + E        +
Sbjct: 138 SLVP-EENSNDRQCYIVNVASTLGTLTPAKVAGYGASKSALIAFHQSYSMELQTRRVSNI 196

Query: 173 KTISVAPGVVDTQM 186
           +T+ V PG ++T M
Sbjct: 197 RTLLVVPGQLNTAM 210

>Kwal_47.17102
          Length = 285

 Score = 67.8 bits (164), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 89/186 (47%), Gaps = 10/186 (5%)

Query: 5   VIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNKS 64
           V +VTG S G+GRAIV + +    N  +  +        E   K     ++   D++N S
Sbjct: 34  VCVVTGGSNGLGRAIVQEFLLKLPNVTLISLD------IEPPKKSFPNVYHYTCDLSNSS 87

Query: 65  DVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTLP 124
           DV + +       G +  ++ NAG+        ++ +E   ++F +N F+ + LVQ   P
Sbjct: 88  DVDQTLKIVKRNHGDVTVLINNAGIRAKYQNFRELSKEVADKVFQVNVFTPMRLVQELSP 147

Query: 125 FMENTNRNY-VFVSSGASVKAYFGWAAYSASKAALNSFAMSVA---NEKPKVKTISVAPG 180
              +  + Y V V+S   V A    + Y ASKAA  +F  + A   +E  +++T+ V PG
Sbjct: 148 KAGDLRQFYAVTVASALGVCAPARGSCYGASKAAAIAFHEAWAQELDETSRIRTLLVTPG 207

Query: 181 VVDTQM 186
            +DT M
Sbjct: 208 QLDTTM 213

>CAGL0M11242g complement(1105723..1106529) highly similar to
           sp|Q05016 Saccharomyces cerevisiae YMR226c, start by
           similarity
          Length = 268

 Score = 65.9 bits (159), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 95/197 (48%), Gaps = 9/197 (4%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAV--VFGIARTSAPLKELKSKHGE----KFF 54
           +  K+  +TG S GIG+A   + +  ++ +V  V G  R     +  K    +    K  
Sbjct: 11  LQGKIAFITGASAGIGKATAIEYLDASNGSVKLVLGARRMEKLEELKKELLAQYPDAKIH 70

Query: 55  YIVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFS 114
               DVT+  +VK+ +    ++F  +D ++ NAG      +VG +D E    + + N  +
Sbjct: 71  IGKLDVTDFENVKQFLADLPEEFKDIDILINNAGKALGSDKVGDIDPEDIAGMVNTNVLA 130

Query: 115 IVSLVQSTLPFMENTNR-NYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE--KPK 171
           +++L Q  LP  +  N  + V + S A   AY   A Y A+K A+ +F  S+  E     
Sbjct: 131 LINLTQLLLPLFKKKNSGDIVNLGSIAGRDAYPTGAIYCATKHAVRAFTQSLRKELINTD 190

Query: 172 VKTISVAPGVVDTQMQV 188
           ++ I +APG+V+T+  V
Sbjct: 191 IRVIEIAPGMVETEFSV 207

>AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH]
           (1327314..1328216) [903 bp, 300 aa]
          Length = 300

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 96/188 (51%), Gaps = 8/188 (4%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHG-EKFFYIVGDVTN 62
           KV++VTG S GIG  +  ++   N   VV+  AR+  P++ L+ K G EK   +  DVT+
Sbjct: 15  KVVLVTGASSGIGYELTKELA--NRGYVVYAAARSIEPIEALRDKCGPEKVIPVQLDVTD 72

Query: 63  KSDVKKLITAAIDKF--GRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQ 120
           +  V KL      +   G+L ++  NAG    +  V  V  E  ++ F +N F+ +++ +
Sbjct: 73  EEQVTKLRRRMSKEIPGGKLHALFNNAGQSCTMPAV-DVTPEMIEKCFRVNVFAPMNITR 131

Query: 121 STLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE-KP-KVKTISVA 178
              P +   +   VF  S A +  +   + YSA+KAA++ +A  +  E KP  V+ I+  
Sbjct: 132 EFAPLLIRAHGTIVFTGSLAGIIPFPFGSVYSATKAAVHQYARVLHLELKPFGVRVINAV 191

Query: 179 PGVVDTQM 186
            G V T +
Sbjct: 192 TGGVATNI 199

>KLLA0F04455g complement(428010..428927) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 305

 Score = 63.2 bits (152), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 81/167 (48%), Gaps = 5/167 (2%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63
           K  +VTG S GIG  +  ++  L     V+  AR + P++EL+++ G++      DV+N+
Sbjct: 5   KYALVTGASSGIGYEVTKEL--LRRGWYVYACARRTHPMEELRAEFGDRCIPRKLDVSNQ 62

Query: 64  SDVKKLITAAIDKF--GRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQS 121
           +D+ +L      +    +L  +  NAG    +  +  V EE     F +N +  ++  + 
Sbjct: 63  NDITQLKLKLEQELPDQKLHLLYNNAGQSCSLPAI-DVSEEIIDNTFRVNVYGPINSCRE 121

Query: 122 TLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE 168
             P + N     VF  S A +  +   A YSASKAA++ +A  +  E
Sbjct: 122 FAPLIINAKGTIVFTGSLAGICPFPFGAVYSASKAAIHQYARVLHGE 168

>Kwal_34.16024
          Length = 292

 Score = 59.3 bits (142), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 86/198 (43%), Gaps = 20/198 (10%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHG-EKFFYIVGDVTN 62
           K++IVTG +  IGRAI        ++  V      +     L  K+G E   Y V D+TN
Sbjct: 40  KLVIVTGAAGVIGRAICEGFASAGADVCVVDYKYDADLATLLAQKYGVEARAYQV-DITN 98

Query: 63  KSDVKKLITAAIDKFGR--LDSVVANAGVLEPVAEV--GKVDEEAWKRLFDINFFSIVSL 118
             DV+  I A    F    +D+ +ANAGV      V       EAW+R+ D+N       
Sbjct: 99  DEDVRACIQAVQKDFPSRDIDTFIANAGVAWTHGSVLNESATPEAWRRVMDVNVQGTFHC 158

Query: 119 VQSTLPFMENTNRNYVFVSSG-----ASVKAYFGWAAYSASKAALNSFAMSVANE----- 168
            Q      +      + +++      A+V  Y     Y+ASKAA+   A   A E     
Sbjct: 159 AQEVAHVFKRQGHGCLILTASMSSHIANVPNY--QTCYNASKAAVRHMARGFAVEFAHLT 216

Query: 169 KP--KVKTISVAPGVVDT 184
           +P  +++  SV+PG  DT
Sbjct: 217 EPAGRIRCNSVSPGYTDT 234

>Kwal_26.7950
          Length = 897

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 102/225 (45%), Gaps = 24/225 (10%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHG-----EKFFYIVG 58
           KV+I+TG   G+GR          S+A+ F        + ++K  H      EK +    
Sbjct: 325 KVVIITGAGAGLGR----------SHALTFAKYGAKVVVNDIKDPHTVVSEIEKLYGRNS 374

Query: 59  DVTNKSDVKK----LITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFS 114
            V +K DV K    ++ +A   FGR+D +V NAGVL   +   K+ +E W+ +  ++ FS
Sbjct: 375 AVADKHDVVKDPGEIVKSAFQTFGRVDILVNNAGVLRDRS-FAKMSDEEWEIVLKVHLFS 433

Query: 115 IVSLVQSTLPFMENTNRNYVF-VSSGASVKAYFGWAAYSASKAALNSFAMSVANE--KPK 171
              L ++  P        Y+   +S + +   FG A Y+A+KAA+  F+ ++A E  K  
Sbjct: 434 TFGLCKAVWPIFVKQKSGYIINTTSTSGIYGNFGQANYAAAKAAVLGFSKTLALEGSKHN 493

Query: 172 VKTISVAPGVVDTQMQVDIREK-YGNEMTTESLKRFIDLHKNGEL 215
           ++   VAP       +    EK  GN      +  F  L  + EL
Sbjct: 494 IRVNIVAPHAETAMTKTIFSEKELGNHFYPSQVSPFYVLLASDEL 538

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 53/101 (52%), Gaps = 2/101 (1%)

Query: 69  LITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTLPFMEN 128
           ++  A+D FGR+D ++ NAG+L   +    + + A+  + D++     +L ++  P M+N
Sbjct: 85  IVQTAVDNFGRVDIIINNAGILRD-SSFANMSDSAFASVVDVHLTGAYNLTRAAWPHMKN 143

Query: 129 TNRNYVF-VSSGASVKAYFGWAAYSASKAALNSFAMSVANE 168
                +    S A +   FG A YSA+K  L  F+ ++A E
Sbjct: 144 QKFGRIVNTCSPAGLYGNFGQANYSAAKMGLVGFSETLAQE 184

>KLLA0E24046g complement(2136583..2137425) similar to
           ca|CA3771|CaSOU1 Candida albicans Sorbitol utilization
           protein Sou1p [Candida albicans], hypothetical start
          Length = 280

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 108/262 (41%), Gaps = 49/262 (18%)

Query: 4   KVIIVTGVSRGIGRAIVNKI--------IGLNSNAVVFGIARTSAPLKELKSKHGEKFFY 55
           KV +VTG S GIG A+   +        +  NSNA +   A       EL +K+  K   
Sbjct: 31  KVAVVTGASSGIGYAVAEGLAQAGASLAVWYNSNAALVERAV------ELSAKYNVKVVA 84

Query: 56  IVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGV------LEPVAEVGKVDEEAWKRLFD 109
               VT ++ VKK I   I +FG++D  +ANAGV      L   AE G  D + W ++  
Sbjct: 85  YQCPVTEEAKVKKTIEDVIQEFGKIDVFIANAGVPWTKGPLVEAAESG-TDTDEWNKVIH 143

Query: 110 INFFSIVSLVQST-LPFMENTNRNYVFVS--SGASVKAYFGWAAYSASKAALNSFAMSVA 166
            +F  +    +     F    + + V  +  SG  V      A Y+A+KA +  FA S+A
Sbjct: 144 TDFNGVYYCAKYVGAQFKRQGSGSMVITASMSGHIVNIPQLQACYNAAKAGVIHFAKSLA 203

Query: 167 NEKPKVKTI-SVAPGVVDTQMQVDIREKYGNEMTTESLKRFIDLHKNGELLDSDVPGEVY 225
            E      + +V+PG + T +   + E   N+                    S +P    
Sbjct: 204 VEWAGFARVNTVSPGYIATPISNFVDEDLKNKW------------------HSLIP---- 241

Query: 226 AKLAVNGIPDELNGKYSRYNDD 247
             +   G+P EL G Y  +  D
Sbjct: 242 --MGREGLPQELVGAYLYFASD 261

>KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcina
           acetivorans Cyclohexanol dehydrogenase, start by
           similarity
          Length = 256

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 101/221 (45%), Gaps = 20/221 (9%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGE---KFFYIVG-- 58
           K+ +VTG S G+G  I   +    +  V+     TS  L E++   G        ++G  
Sbjct: 9   KIALVTGASTGVGEGIARALFVRGATVVI-----TSRHLSEVQETAGNIDPSGSRVIGKE 63

Query: 59  -DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAE-VGKVDEEAWKRLFDINFFSIV 116
            DVT    V+ LI    ++FG L  +V NAG+  P    +   D ++W+++ D N     
Sbjct: 64  VDVTVAKAVEDLIQEIREEFGALHYLVNNAGITGPHQTGIEDYDIDSWRQVIDTNINGTF 123

Query: 117 SLVQSTLPFMENTNRN-----YVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE--K 169
             ++  LP ME+++        V +S+   +    G + Y+A+K A+     SVA E  +
Sbjct: 124 YTLKYALPLMESSSSPDSEAAVVNLSAVNGLVGIPGISPYTATKHAVIGITQSVALEYAE 183

Query: 170 PKVKTISVAPGVVDT-QMQVDIREKYGNEMTTESLKRFIDL 209
             V+  +VAPG V T ++Q   +E      +   +KR   +
Sbjct: 184 RNVRVNAVAPGYVSTPKIQALPKETQQWMSSQHPMKRMATM 224

>Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement
          Length = 289

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 92/193 (47%), Gaps = 19/193 (9%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63
           KV +VTG S GIG  I  K++  +    V+  AR + P+K L+ +  EK   +  DV++ 
Sbjct: 5   KVALVTGASSGIGYEI-TKLLA-SKGYTVYAAARRTTPIKPLEEEFPEKVIAVSLDVSDL 62

Query: 64  SDVKKLITAAIDKFGR------LDSVVANAG--VLEPVAEVGKVDEEAWKRLFDINFFSI 115
             ++ L      +F R      L  +  NAG     P  +VG    +  ++ F +N F  
Sbjct: 63  QQIQDLKA----RFSRDLPDSKLHILYNNAGQSCTFPAVDVGN---DKIEQCFKVNVFGP 115

Query: 116 VSLVQSTLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE-KP-KVK 173
           ++L +    F+ N     VF  S A +  +   + YS++KAA++ +A  +  E KP  VK
Sbjct: 116 MNLCREMSDFVINARGTIVFTGSLAGIVPFPFGSIYSSTKAAIHQYARVLHVEMKPFGVK 175

Query: 174 TISVAPGVVDTQM 186
            I+   G V T +
Sbjct: 176 VINAITGGVATNI 188

>CAGL0L02167g 253055..255760 highly similar to sp|Q02207
           Saccharomyces cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase peroxisomal, start by
           similarity
          Length = 901

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 87/192 (45%), Gaps = 22/192 (11%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGD---- 59
           +V+++TG   G+G+    +     +  VV  +  T        S H  K   +V D    
Sbjct: 10  RVVVITGAGGGLGKVYALEYAKRGAKVVVNDLGGTLG-----GSGHDSKAADVVVDEIVK 64

Query: 60  -----VTNKSDV----KKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDI 110
                V N   V    ++++  AI  FGR+D ++ NAG+L  V+   K+ E+ +  + D+
Sbjct: 65  SGGTAVANYDSVNDNGEQIVETAIKAFGRIDILINNAGILRDVS-FAKMTEKEFSAVLDV 123

Query: 111 NFFSIVSLVQSTLPFMENTNRNYVF-VSSGASVKAYFGWAAYSASKAALNSFAMSVANE- 168
           +      L ++  P+M       +   +S A +   FG A YSA+K  L  FA ++A E 
Sbjct: 124 HLTGAYRLTKAAWPYMRQQKFGRIINTASPAGLFGNFGQANYSAAKLGLVGFAETLAKEG 183

Query: 169 -KPKVKTISVAP 179
            K  +   S+AP
Sbjct: 184 YKYNINVNSIAP 195

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 89/170 (52%), Gaps = 5/170 (2%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTN- 62
           KV+I+TG   G+G++         +  VV  I   +  + E+ SK+GE     + D  N 
Sbjct: 324 KVVIITGAGGGLGKSHALWFAKYGARVVVNDIKDPNTVVNEINSKYGEG--RAIPDTHNV 381

Query: 63  KSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQST 122
            ++  ++I  A+  +GR+D +V NAG+L   + +   D+E W  +  ++ +S   L ++ 
Sbjct: 382 VTEANQVIETAMKAYGRVDVLVNNAGILRDRSFLKMTDQE-WFAVVQVHLYSTFLLSKAV 440

Query: 123 LP-FMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPK 171
            P F++    + +  +S + +   FG A Y+A+KAA+  F+ ++A E  K
Sbjct: 441 WPIFLKQKGGHIINTTSTSGIYGNFGQANYAAAKAAILGFSRTIAVEGAK 490

>CAGL0J04774g join(452094..452179,452259..453189) similar to
           tr|Q06417 Saccharomyces cerevisiae YLR426w
          Length = 338

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 93/189 (49%), Gaps = 13/189 (6%)

Query: 5   VIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNKS 64
           ++++TG S G+GR I++K++   +N  V  +      L         +   I  D+ N  
Sbjct: 71  IVLITGGSNGLGRCIIHKLLRSYNNIKVINLD-----LDVQYWSEEARVINIECDLVNAD 125

Query: 65  DVK-KLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123
            ++  L    ++   +++ ++ NAGV            +  +R+ +IN +S   ++Q+ +
Sbjct: 126 GLELALKKIKLEYEDKINLLICNAGVRSRFNWFEDTPIDEMQRIMNINTWSTARILQAII 185

Query: 124 PFMENTNRNYVF-VSSGASVKAYFGWAAYSASKAALNSFAMSVANE-----KPKVKTISV 177
           P  +N  + Y+  +SS   + A    A+Y+ASKAA+ +   S+ N+        ++T+ V
Sbjct: 186 P-RDNQRQLYIVTISSVLGILAPSKVASYAASKAAITALHNSMTNDFLVRGIGNIRTLLV 244

Query: 178 APGVVDTQM 186
            PG +DTQM
Sbjct: 245 LPGQIDTQM 253

>YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109)
           Member of the short chain alcohol dehydrogenase/ribitol
           dehydrogenase family [981 bp, 326 aa]
          Length = 326

 Score = 53.1 bits (126), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 116/225 (51%), Gaps = 20/225 (8%)

Query: 5   VIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNKS 64
           ++++TG S+G+GRAIV++++   SN  +  +    + ++  + K       ++ D+++  
Sbjct: 72  IVLITGGSKGLGRAIVSQLLQDYSNLTILNVDICPSSVRNTRVKD------LICDLSDDE 125

Query: 65  DVKKLITAAIDKF-GRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123
           +V  L+     K+   +  +V NAGV         ++ +   ++F IN F+ +  +Q   
Sbjct: 126 EVAALLNLLKRKYKNEIRLIVNNAGVRANFTGFNGMERDNLDKIFKINTFAPLQFIQELA 185

Query: 124 PFMENTNRNYVF-VSSGASVKAYFGWAAYSASKAAL----NSFAMSVANEKPK-VKTISV 177
           P   +T + Y+  ++S   +      AAY+ASKAAL     S++  + NE  + ++T+ V
Sbjct: 186 PSRHSTRQCYIVNIASILGILTPAKVAAYAASKAALIAFHQSYSFELQNEGVRNIRTLLV 245

Query: 178 APGVVDTQMQVDI---REKYGN--EMTTESLK--RFIDLHKNGEL 215
            PG ++T+M       R+ +    ++TT + K  R+ +L + G+L
Sbjct: 246 TPGQLNTEMFAGFKPPRQFFAPVIDITTLAAKIVRYCELGQRGQL 290

>KLLA0D02596g
           join(complement(219682..219797),
           complement(218659..219586)) similar to sgd|S0004418
           Saccharomyces cerevisiae YLR426w, start by similarity
          Length = 347

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 92/190 (48%), Gaps = 11/190 (5%)

Query: 5   VIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNKS 64
           V ++TG S G+G  +V  ++  +   +   I     P  +L S   ++  ++  D+++  
Sbjct: 85  VCVITGGSLGLGNELVKSLMS-DIPDIKIVILDVVDPKLDL-SITKDRIEFLRCDLSSDE 142

Query: 65  DVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTLP 124
           +V+  I    +KF ++D ++ NA +    + +  +      ++F  N  S + L+Q+  P
Sbjct: 143 EVENAIKTIKNKFPKVDLLINNAAIRGRFSRLADMPCVEMNKIFHANVLSTIRLIQAFHP 202

Query: 125 FMENTNRNYVFVSSGASVKAYFGWA---AYSASKAALNSFAMSVANE-----KPKVKTIS 176
             ++ N ++ +V + AS       A    Y+ASKAAL S+  S   E        V+T+ 
Sbjct: 203 -KKSANNDFYYVVNIASALGIMSPARASTYAASKAALISYHESWTYELLNDNAMNVRTLL 261

Query: 177 VAPGVVDTQM 186
           V PG +DTQM
Sbjct: 262 VLPGQMDTQM 271

>Scas_478.2
          Length = 920

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 103/219 (47%), Gaps = 8/219 (3%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHG-EKFFYIVGDVTN 62
           KV+I+TG + G+G++         +  ++  I      + E+ SK G +  F    ++  
Sbjct: 326 KVVIITGANGGLGKSHAMWFAKYGAKVIINDITNPETTVNEINSKFGADTAFPDSHNIIT 385

Query: 63  KSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQST 122
           +S++  ++  AID FG +D +V NAG+L   + + K+ E+ W  +  ++  +  ++ ++ 
Sbjct: 386 ESEL--VVKTAIDHFGHVDILVNNAGILRDKSFL-KMTEKEWYPVLQVHLQATFAMCKAV 442

Query: 123 LPFMENTNRNYVF-VSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTIS--VAP 179
            P     N  ++   +S + +   FG A Y+A+KAA+  F+ ++A E  K   I   +AP
Sbjct: 443 WPHFSKQNSGFIINTTSTSGIYGNFGQANYAAAKAAILGFSRTIAIEGAKKGIIVNIIAP 502

Query: 180 GVVDTQMQVDIREK-YGNEMTTESLKRFIDLHKNGELLD 217
                  +    EK   N      +  F+ L    EL D
Sbjct: 503 HAETAMTKTIFGEKELANHFDVNQVSPFVVLLATKELQD 541

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 60/114 (52%), Gaps = 4/114 (3%)

Query: 69  LITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTLPFMEN 128
           +I  AID FG++D ++ NAG+L  V+   K+ E+ ++ + D++      L  +  P+M+ 
Sbjct: 85  IIKTAIDNFGKIDILINNAGILRDVS-FNKMSEKEFQAVIDVHLNGAFQLTHAAWPYMKA 143

Query: 129 TNRNYVF-VSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTI--SVAP 179
                +   +S A +   FG A YSA+K  L   A ++A E  K   +  S+AP
Sbjct: 144 QKFGRIINTASPAGLFGNFGQANYSAAKLGLVGLAETLAKEGFKYNILVNSIAP 197

>Kwal_14.2444
          Length = 288

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 88/190 (46%), Gaps = 13/190 (6%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63
           KV +VTG S GIG  +  ++   +    V+  AR    L+ L  +  E    +  DV+  
Sbjct: 5   KVAVVTGASSGIGYELTRQLA--SKGYKVYAAARREQRLETLAKEFPELVVPVKLDVSEP 62

Query: 64  SDVKKLITAAIDKF--GRLDSVVANAG--VLEPVAEV-GKVDEEAWKRLFDINFFSIVSL 118
             +  L      +    +LD +  NAG     P ++V   V E+A    F +N F  V+L
Sbjct: 63  EQIIHLRERLAKELPSQKLDVLYNNAGQSCTFPASDVTNDVLEQA----FKVNVFGPVNL 118

Query: 119 VQSTLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE-KP-KVKTIS 176
            +  LPF+       +F  S A +  +   + YSA+K A++S+A  +  E KP  V+ ++
Sbjct: 119 CKELLPFVIKAKGTVLFTGSVAGLMPFPFGSIYSATKGAIHSYARCLHTEMKPFGVRVLN 178

Query: 177 VAPGVVDTQM 186
           V  G V T +
Sbjct: 179 VVTGGVKTDI 188

>CAGL0G08690g complement(822798..823682) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 294

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 117/246 (47%), Gaps = 30/246 (12%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVG---DV 60
           KV +VTG S GIG  +  ++        VF  AR +AP++ L +  G++   IV    D+
Sbjct: 8   KVAVVTGASSGIGYEVTKELA--RKGFKVFACARRTAPIEPLVNSFGKEL--IVPHHLDI 63

Query: 61  TNKSDV---KKLITAAIDKFGRLDSVVANAG--VLEPVAEVGKVDEEAWKRLFDINFFSI 115
           +   +V   K+ + + + +  +LD +  NAG     P  +V     +  ++ F +N F  
Sbjct: 64  SELDEVLKFKEFLASELPE-QKLDILYNNAGQSCTFPALDVSN---DVMEQCFKVNVFGH 119

Query: 116 VSLVQSTLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE-KP-KVK 173
           +++ +    ++ N     +F  S A        + Y+A+KAA++ +A ++  E KP  V+
Sbjct: 120 INMTRELAQYLINAKGTVIFTGSIAGFSTLPFGSIYAATKAAIHEYARTLHLELKPFGVR 179

Query: 174 TISVAPGVVDTQMQVDIREKYGNEMTTESLKRF---IDLHKNGELLDSD---VPGEVYAK 227
            I+   G V T    DI +K   ++   S+ +F   ID  +  + +  D   +P +VYAK
Sbjct: 180 VINAITGGVLT----DIADK--RDLPEGSIYKFPQGIDAFRTRQTMAKDNHPMPADVYAK 233

Query: 228 LAVNGI 233
             V  +
Sbjct: 234 KVVEDL 239

>ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH]
           complement(93017..93895) [879 bp, 292 aa]
          Length = 292

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 110/231 (47%), Gaps = 16/231 (6%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFG--IARTSAPLKELKSKHGEKFFYIVG--- 58
           KV+ VTG +  I R     ++ L + A + G  + +T     E+ ++ G+    ++G   
Sbjct: 23  KVVFVTGGAGTICRVQAEAMVLLGAKAAIIGRNVEKTKKAAAEI-AELGDSADCVLGIGG 81

Query: 59  -DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVS 117
            DV   +D+K+ +   +  FGR+D V+A A     +A++  +   A+K + DI+     +
Sbjct: 82  VDVREVADMKRAVEQTVAAFGRIDYVIAGA-AGNFLADMTNLSSRAFKTVLDIDLVGSYN 140

Query: 118 LVQSTLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE--KPKVKTI 175
            V++TL  +       +FVS+          A  SA+KA +++ +  +A E     ++  
Sbjct: 141 TVKATLSELAKNKGAVLFVSATLHYTGTPLQAHVSAAKAGVDALSNVLAVELGPLGIRCN 200

Query: 176 SVAPGVVDTQMQVDIREKYGNEMTTESLKRFIDLHKNGELLDSDVP-GEVY 225
            +APG++     VD     G    T+++K+ I L + G  L  D+  G VY
Sbjct: 201 CIAPGLIGGTEGVD--RLSGGLPVTDAVKK-IPLQRPG--LTKDIADGTVY 246

>YKR009C (FOX2) [3265] chr11 complement(453995..456697)
           Multifunctional enzyme of the peroxisomal fatty acid
           beta-oxidation pathway possessing 2-enoyl-CoA hydratase
           2 and D-3-hydroxyacyl-CoA dehydrogenase activities [2703
           bp, 900 aa]
          Length = 900

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 86/192 (44%), Gaps = 22/192 (11%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63
           +V+++TG   G+G+          +  VV  +  T        S H  K   +V D   K
Sbjct: 10  RVVVITGAGGGLGKVYALAYASRGAKVVVNDLGGTLG-----GSGHNSKAADLVVDEIKK 64

Query: 64  S-------------DVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDI 110
           +             + +K+I  AI +FGR+D ++ NAG+L  V+   K+ E  +  + D+
Sbjct: 65  AGGIAVANYDSVNENGEKIIETAIKEFGRVDVLINNAGILRDVS-FAKMTEREFASVVDV 123

Query: 111 NFFSIVSLVQSTLPFMENTNRNYVF-VSSGASVKAYFGWAAYSASKAALNSFAMSVANEK 169
           +      L ++  P+M +     +   +S A +   FG A YSA+K  L   A ++A E 
Sbjct: 124 HLTGGYKLSRAAWPYMRSQKFGRIINTASPAGLFGNFGQANYSAAKMGLVGLAETLAKEG 183

Query: 170 PK--VKTISVAP 179
            K  +   S+AP
Sbjct: 184 AKYNINVNSIAP 195

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 56/104 (53%), Gaps = 2/104 (1%)

Query: 69  LITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTLPFMEN 128
           +I  AI KF R+D +V NAG+L   + +   DEE W  +  ++ FS  SL ++  P    
Sbjct: 387 IIQTAISKFQRVDILVNNAGILRDKSFLKMKDEE-WFAVLKVHLFSTFSLSKAVWPIFTK 445

Query: 129 TNRNYVF-VSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPK 171
               ++   +S + +   FG A Y+A+KAA+  F+ ++A E  K
Sbjct: 446 QKSGFIINTTSTSGIYGNFGQANYAAAKAAILGFSKTIALEGAK 489

>Scas_662.4
          Length = 307

 Score = 49.3 bits (116), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 110/253 (43%), Gaps = 32/253 (12%)

Query: 2   SPKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVG--- 58
           S K  IVTG S GIG  I  ++    +  +V+  AR   P+ +L +    +    +    
Sbjct: 8   SRKTAIVTGASSGIGYEITKELA--RNGFIVYACARRLGPIDDLINDLAPELTTELAKAV 65

Query: 59  ------DVTNKSDVKKLITAAIDKF--GRLDSVVANAG--VLEPVAEVGKVDEEAWKRLF 108
                 D++ + +VK+       +   G+LD +  NAG     P  +V     +  ++ F
Sbjct: 66  IKPYQLDISKEDEVKQFRVFLEKELPNGKLDLLYNNAGQSCTFPALDV---TNDVMEQCF 122

Query: 109 DINFFSIVSLVQSTLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE 168
            +N F  V++ +    ++       VF  S A +  +   + YSA+KAA++ +A  +  E
Sbjct: 123 KVNVFGHVNMCRELASYLIQARGTIVFTGSLAGITPFPFGSIYSATKAAIHEYARVLHLE 182

Query: 169 -KP-KVKTISVAPGVVDTQMQVDIREKYGNEMTTESLKRFIDLHKNGELLDS------DV 220
            KP  V+ I+V  G V T +  D R      +  +S+  F +  K  E   S       +
Sbjct: 183 MKPFGVRVINVVTGGVATNI-ADTR-----PLPDDSVYNFPEGRKAFEYRQSMAKNHHPM 236

Query: 221 PGEVYAKLAVNGI 233
           P +VYAK  +  I
Sbjct: 237 PADVYAKELIKDI 249

>KLLA0D18909g complement(1592628..1593500) similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19 peroxisomal 2,
           4-dienoyl-CoA reductase singleton, start by similarity
          Length = 290

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 87/191 (45%), Gaps = 18/191 (9%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFG-----IARTSAPLKELKSKHGEKFFYIVG 58
           KV+ VTG +  I R     ++ L   AV+ G       +T+  + +L             
Sbjct: 23  KVVFVTGGAGTICRVQTEAMVLLGCKAVIVGRNPEKTRKTAHEIGQLVHDPHSCLPISSV 82

Query: 59  DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSL 118
           DV N   + + +  AI KFGRLD V+A A     +A+   +   A+K +  I+     + 
Sbjct: 83  DVRNVDQLHEAVKVAIQKFGRLDYVIAGAAG-NFLADFTHLSSNAFKSVVSIDLLGSFNT 141

Query: 119 VQSTLPFMENTNRNYVFVSS-----GASVKAYFGWAAYSASKAALNSFAMSVANEKPK-- 171
           V++  P +  T  + +FVSS     G   +++ G     A+KA +++ + ++A E     
Sbjct: 142 VKACFPELVKTKGSVLFVSSTLHYYGVPFQSHVG-----AAKAGIDALSNALAVEMGPLG 196

Query: 172 VKTISVAPGVV 182
           ++   VAPG +
Sbjct: 197 LRFNCVAPGAI 207

>Sklu_1570.1 YKR009C, Contig c1570 100-2370
          Length = 756

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 101/221 (45%), Gaps = 16/221 (7%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63
           K++IVTG   G+GR+         +  VV  I      + E+   +G         + +K
Sbjct: 185 KIVIVTGAGGGLGRSHALWFAKYGAKVVVNDIKAPEPVVDEINKIYGGG-----SAIPDK 239

Query: 64  SDV----KKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLV 119
            DV     +++  A++ FGR+D +V NAG+L   + +   DEE W  +  ++ FS   L 
Sbjct: 240 HDVVTQPTEIVKTALEAFGRVDVLVNNAGILRDRSFLKMTDEE-WYAVLKVHLFSTYGLS 298

Query: 120 QSTLPFMENTNRNYVF-VSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPK--VKTIS 176
           ++  P        Y+   +S + +   FG A Y+A+KAA+   + ++A E  K  +K   
Sbjct: 299 KAVWPVFLKQRSGYIINTTSTSGIYGNFGQANYAAAKAAILGLSKTLALEGSKHGIKVNI 358

Query: 177 VAPGVVDTQMQVDI--REKYGNEMTTESLKRFIDLHKNGEL 215
           +AP   +T M   I  + +  N      +  F+ L  + EL
Sbjct: 359 IAPH-AETAMTKTIFSQTELSNHFDPSQVSPFVVLLASDEL 398

>AER111W [2616] [Homologous to ScYLR426W - SH]
           complement(846805..846884,846937..847840) [984 bp, 327
           aa]
          Length = 327

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/193 (20%), Positives = 89/193 (46%), Gaps = 16/193 (8%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDV 60
           M     ++TG ++G+G  I+  ++        F             +    +  ++  D+
Sbjct: 69  MPDATCVLTGGAQGLGACILRNLLA------QFPRLTVVVVDVADPAVVHRRVRFLRADL 122

Query: 61  TNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQ 120
           +  +DV++++     ++ R+D ++  AG+      +  V  E   + F +N F+    +Q
Sbjct: 123 SKPADVERVLEQVTREYSRVDVLINCAGMRSRYQGLQAVAPEELHKTFQVNVFAPQRFIQ 182

Query: 121 STLPFMENTNRNYVFVSSGAS--VKAYFGWAAYSASKAALNSFAMS-----VANEKPKVK 173
              P     +R +  V+ G++  + A    +AY+A+KAA  ++  S     +++ + +V+
Sbjct: 183 KLAP---RDDRQFYLVTVGSTLGILAPARLSAYAATKAATIAYHDSWTFELLSSGRQRVR 239

Query: 174 TISVAPGVVDTQM 186
           T+ V  G +DT+M
Sbjct: 240 TLLVVLGQMDTRM 252

>Kwal_14.1511
          Length = 277

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 94/213 (44%), Gaps = 33/213 (15%)

Query: 3   PKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIA-------RTSAPLKELKS-KHGEKF- 53
           PK I++TG ++GIG+AI    + L        IA       +  A LKE+K  + G K  
Sbjct: 2   PKTILITGAAQGIGKAIA---VDLARKGYQLAIADLPQQNEKAQAVLKEIKELQSGVKAP 58

Query: 54  FYIVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFF 113
            ++  DV+NK  V  ++      FG  D ++ NAG+   VA++ +   E   R+  IN  
Sbjct: 59  IFLPIDVSNKESVFGVVDKVASHFGAFDVMINNAGI-AMVAKILEATPEELDRIMKINVG 117

Query: 114 SIVSLVQ-STLPFME-NTNRNY----------------VFVSSGASVKAYFGWAAYSASK 155
            ++   Q +T  F+E N   +Y                +   S A  +A      Y +SK
Sbjct: 118 GVLYGTQAATRKFVELNRAGDYTPATVKTASKKLTGKIINCCSIAGNEAIGSLGLYCSSK 177

Query: 156 AALNSFAMSVANE-KPKVKTISV-APGVVDTQM 186
            A+     + A E  P   T++  APG+V T M
Sbjct: 178 FAVKCLTQASAKELAPLGITVNAYAPGIVLTPM 210

>KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces
           cerevisiae YKL055c OAR1 putative 3-oxoacyl-(acyl carrier
           protein) reductase singleton, start by similarity
          Length = 259

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 105/249 (42%), Gaps = 62/249 (24%)

Query: 5   VIIVTGVSRGIGRAIVNKI---------IGLNSNAVVFGIARTSAPLKELKSKHGE---- 51
           V IV+G +RGIG  I +++         IG N ++VV    R       +K  HG+    
Sbjct: 6   VSIVSGATRGIGSKIRDELLLSGYSVIYIGSNDDSVVKNQPR-------IKLNHGQFAKG 58

Query: 52  -----------------KFFYIVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVA 94
                            +F    G +  K +   L+     K  RLD +V  AG+ +  A
Sbjct: 59  ISINFKGWPTWVDTTWSQFICRNGKIETKIESNDLMAGFDKKQYRLDLLVNCAGITQTTA 118

Query: 95  EVGKVDEEAWKRLFDINFFSIVSLVQSTLPFM-ENT----------NRNYVFVSSGASVK 143
            + K +      + ++NF S VSL Q  L  M  NT          N   V   S +++ 
Sbjct: 119 AI-KANTNEMADIMNVNFMSSVSLTQLALKQMIRNTKLHGHRGKIVNIASVLGDSSSNI- 176

Query: 144 AYFGWAAYSASKAALNSFAMSVANE--KPKVKTISVAPGVV---------DTQMQVDIRE 192
              G A YSASKAA+  +   ++ E  +  +   +++PG+V         D ++Q  +RE
Sbjct: 177 IVPGTAMYSASKAAMIQYNRVLSEELKRLSIDVQTISPGLVESTDMIKTLDPEIQQKLRE 236

Query: 193 KYGN-EMTT 200
           K  N E+T+
Sbjct: 237 KLPNGELTS 245

>Kwal_55.19569
          Length = 288

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 90/202 (44%), Gaps = 27/202 (13%)

Query: 4   KVIIVTGVSRGIGRAIV--------NKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFY 55
           KV  ++G S GIG A+         +  +  NSN  +   A      KEL   +G +   
Sbjct: 39  KVACISGASSGIGGAVAVAFAQAGADIAVWYNSNDKLIQTA------KELSETYGVRAKA 92

Query: 56  IVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEE-------AWKRLF 108
               VT+++ VK+ I      F ++D  VANAGV  P +E   ++ E        W+++F
Sbjct: 93  YKCPVTDEAKVKETILQVEKDFSKIDIFVANAGV--PWSEGPLIEAEERGVATKEWEKVF 150

Query: 109 DINFFSIVSLVQSTLPFMENTNRNYVFVS---SGASVKAYFGWAAYSASKAALNSFAMSV 165
           + +F  +    +      +   R  + ++   SG  V      A Y+A+KA +   + S+
Sbjct: 151 NTDFQGVYYCSKVIGAIFKKQGRGSLVITASMSGHVVNVPQLQACYNAAKAGVIHLSRSL 210

Query: 166 ANEKPKVKTI-SVAPGVVDTQM 186
           A E      + S++PG +DT +
Sbjct: 211 AVEWAGFARVNSISPGYIDTPI 232

>Sklu_268.1 , Contig c268 57-791 reverse complement
          Length = 244

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 86/207 (41%), Gaps = 7/207 (3%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIV--G 58
           +S + +IVTG + GIG+AIVN+   L   A V         L  LK    +         
Sbjct: 2   LSNRKVIVTGAASGIGKAIVNQC--LQEGASVIACDLNEQALLVLKESLNDSTVLDTYPM 59

Query: 59  DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSL 118
           DV    +V         +   +D +V NAG+      +    E+   ++ DIN    +  
Sbjct: 60  DVRKYEEVAAFFAYVETEHSDVDGLVNNAGIY-LAKHILDYQEDEIDKVLDINVKGYIYF 118

Query: 119 VQSTLPFMENTNRNYVFVS-SGASVKAYFGWAAYSASKAALNSFAMSVA-NEKPKVKTIS 176
            Q     + ++ R  V V+ S  S +     A Y +SKAA+     S A N  P ++  +
Sbjct: 119 SQMFGKKLFHSQRKGVIVNLSSVSGQEGSSDAIYGSSKAAILGLTKSCAMNFSPYIRVNA 178

Query: 177 VAPGVVDTQMQVDIREKYGNEMTTESL 203
           VAP +V+T M   I E    E  +  L
Sbjct: 179 VAPTMVNTSMMDSIPEWRKKEYLSHQL 205

>YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacetone
           phosphate reductase [894 bp, 297 aa]
          Length = 297

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 90/191 (47%), Gaps = 14/191 (7%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGE---KFFYIVGDV 60
           K+ +VTG S GIG  +  ++    +  +V+  AR   P+ +L  + G    K + +  D+
Sbjct: 10  KIAVVTGASGGIGYEVTKELA--RNGYLVYACARRLEPMAQLAIQFGNDSIKPYKL--DI 65

Query: 61  TNKSDV---KKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVS 117
           +   ++      + A +   G+LD +  NAG       +   D  A ++ F +N F  ++
Sbjct: 66  SKPEEIVTFSGFLRANLPD-GKLDLLYNNAGQSCTFPALDATDA-AVEQCFKVNVFGHIN 123

Query: 118 LVQSTLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE-KP-KVKTI 175
           + +    F+       VF  S A V ++   + YSASKAA++ +A  +  E KP  V+ I
Sbjct: 124 MCRELSEFLIKAKGTIVFTGSLAGVVSFPFGSIYSASKAAIHQYARGLHLEMKPFNVRVI 183

Query: 176 SVAPGVVDTQM 186
           +   G V T +
Sbjct: 184 NAITGGVATDI 194

>Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement
          Length = 363

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 77/171 (45%), Gaps = 7/171 (4%)

Query: 7   IVTGVSRGIGRAIVNKIIGLNSNAVVFGI-ARTSAPLKELKSKHGEKFFYIVGDVTNKSD 65
           ++TG S G+G  IV +   LN    +  I           + K     FY   D++N  +
Sbjct: 87  LITGGSGGLGLEIVQQFQLLNIKTFILDIVPPPQMVFGNCEIKSNTNVFYYPCDISNPKE 146

Query: 66  VKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTLPF 125
           + +L      + G +  ++ NAG+      + ++ ++  ++   +N+ S    +Q  LP 
Sbjct: 147 IAELHKKIKLQHGNVTILINNAGITSGY-RLQELSDKVIEKTIQVNYVSAFYTIQEFLPD 205

Query: 126 MENTNRNYVFVSSGASVKAYFGWA---AYSASKAALNSFAMSVANEKPKVK 173
           M + +R Y+   + ASV  +   A   AY ASK  L S   ++ NE  ++K
Sbjct: 206 MVSMSRGYIV--NVASVLGFMSPARLTAYGASKGGLISLHEALVNELYQIK 254

>Kwal_26.8838
          Length = 323

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 96/216 (44%), Gaps = 45/216 (20%)

Query: 4   KVIIVTGVSRGIGRAIVNKII---------GLNSNAVVFGI------ARTSAPLKELKSK 48
           KV +VTG + GIG   V  +          G NS+ V   I      ART    ++ +S+
Sbjct: 19  KVALVTGGNSGIGWYTVLHLYLHGFAVYVAGRNSSRVNRAIKDIKKEARTRIKKEDPESR 78

Query: 49  H--GEKFFYIVGDVTNKSDVKKLITAAIDKF----GRLDSVVANAGVLEPVAEVGKVDEE 102
           H  GE +F  + D+T      KL+  A  +F     RLD ++ NAGV+   A    V E+
Sbjct: 79  HPVGELYFLSL-DLTEL----KLVDKAAKRFRSLETRLDVLINNAGVM---ALPYSVTED 130

Query: 103 AWKRLFDINFFSIVSLVQSTLPFMENTNRNYVFVSS-GASVK-AYFG------------- 147
            ++     N+ +   L    LP ++      + VSS G +++ +YF              
Sbjct: 131 GFEIQLQTNYIAHFLLTMRLLPSVKRCRGRIITVSSIGHNLEFSYFSLAQSFNYKPNMLF 190

Query: 148 -WAAYSASKAALNSFAMSVANEKPKVKTISVAPGVV 182
            W  Y+ +K A   FA  +A + P V  +SV PG+V
Sbjct: 191 TWMRYAMAKTASIQFAKMLAIKHPDVLCMSVHPGLV 226

>YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal
           2,4-dienoyl-CoA reductase [888 bp, 295 aa]
          Length = 295

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 88/192 (45%), Gaps = 18/192 (9%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFG--IARTSAPLKELK--SKHGEKFFYIVG- 58
           KV  VTG +  I R     ++ L   A + G    RT    K +   +K  +    I   
Sbjct: 28  KVAFVTGGAGTICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKDAVLAIANV 87

Query: 59  DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSL 118
           DV N   V+  +   ++KFG++D V+A A     V +   +   A+K + DI+     + 
Sbjct: 88  DVRNFEQVENAVKKTVEKFGKIDFVIAGAAG-NFVCDFANLSPNAFKSVVDIDLLGSFNT 146

Query: 119 VQSTLPFMENTNRNYVFVSS-----GASVKAYFGWAAYSASKAALNSFAMSVANE--KPK 171
            ++ L  ++ +  + +FVS+     G   + + G     A+KA +++ A ++A E     
Sbjct: 147 AKACLKELKKSKGSILFVSATFHYYGVPFQGHVG-----AAKAGIDALAKNLAVELGPLG 201

Query: 172 VKTISVAPGVVD 183
           +++  +APG +D
Sbjct: 202 IRSNCIAPGAID 213

>Kwal_23.3107
          Length = 248

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 88/202 (43%), Gaps = 38/202 (18%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLK----ELKSKHGEKFFYIVGD 59
           KV ++TG ++ +GR    ++   +   +      T    K    EL SK+  K     G+
Sbjct: 6   KVALITGGTKNLGRLTAIELASRHKANLFLHYNSTQGDEKKLADELSSKYNVKVELYQGN 65

Query: 60  VTNKSDVKKLITAAIDKFGRLDSVVANAG--VLEPVAEVGKVDEEAWKRLFDIN----FF 113
           + +  +V+KL  AA  KFG +D  + N G  + +P+ E   V EE +  +  +N    FF
Sbjct: 66  LGSAKNVEKLFEAAKAKFGSIDIAINNVGKVLKKPMVE---VTEEEFDEMDLVNNKIAFF 122

Query: 114 SIVSLVQSTLPFMENTNRNYVFVSSGASV--------KAYFG-WAAYSASKAALNSFAMS 164
            I    +               VSSG S+         AY   +A Y  +K+A+  +  S
Sbjct: 123 FIAQATKH--------------VSSGGSIISLVTSLLAAYTPFYAVYQGTKSAVEFYTKS 168

Query: 165 VANE--KPKVKTISVAPGVVDT 184
            + E  + +V    +APG +DT
Sbjct: 169 ASKELIEKRVSVNCIAPGPMDT 190

>Kwal_26.8282
          Length = 298

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 96/223 (43%), Gaps = 43/223 (19%)

Query: 5   VIIVTGVSRGIGRAIVNKI-------IGLNSNAVVFGIARTSAPLKELKSKH-------- 49
           V +VTG +RGIGRAIV+K+       + + S    F   R   P  ++++KH        
Sbjct: 37  VALVTGATRGIGRAIVDKLADKGVSCLMIGSQMTSFDRMRKRPP--KIRNKHQWHRALAI 94

Query: 50  --GEKFFYIVGDVT-----NKSDVKKLITAAIDKFGRLD-------SVVANAGVLEPVAE 95
             G+   +   DV      N S  ++L     +++   D       +++ N   +   + 
Sbjct: 95  DLGKWPQWTEQDVYTGVHFNGSMHEQLYAQEANQWSLFDIPDTHDIALLVNCAGITQASP 154

Query: 96  VGKVDEEAWKRLFDINFFSIVSLVQSTLPFMENTNRNYVFVSSGASVKAYF--------- 146
             +   E   R+ +IN+ S V+L   +   M  + ++        +V +           
Sbjct: 155 ALRCSPEDILRITNINYMSAVTLCSLSAKKMLRSRKHLATPPCIINVSSILGDPKTPPLP 214

Query: 147 GWAAYSASKAALNSFAMSVANE--KPKVKTISVAPGVV-DTQM 186
           G A YSASKAAL  ++  ++ E  +  ++  S++P +V DT M
Sbjct: 215 GTALYSASKAALTQYSRVLSEELARSGIQVHSLSPSLVSDTDM 257

>Kwal_55.21822
          Length = 283

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 105/228 (46%), Gaps = 32/228 (14%)

Query: 4   KVIIVTGVSRGIG--------RAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFY 55
           KV  VTG S GIG        +A  +  +  NSN  +  +      + E+  K+G K   
Sbjct: 31  KVAAVTGASSGIGYDVAVAFAQAGADVAMWYNSNPHITEL------VGEISEKYGVKVKA 84

Query: 56  IVGDVTNKSDVKKLITAAIDKF-GRLDSVVANAGVLE---PVAEVGKVDEE----AWKRL 107
               VT+  DV   I      F G++D +V NAGV     P+ ++ + DEE     W ++
Sbjct: 85  YKCSVTSSKDVASTIDQIKKDFGGKIDIMVGNAGVAWSEGPLIDLVEKDEEKCDAEWNKV 144

Query: 108 FDINFFSIVSLVQST-LPFMENTNRNYVFVS--SGASVKAYFGWAAYSASKAALNSFAMS 164
            D++   I  + ++    F E  + +++  +  SG  V       AY+A+KA +   + S
Sbjct: 145 IDVDLNGIYRVAKNIGRVFKEQGHGSFIITASMSGHVVNVPQMQTAYNAAKAGVLHMSKS 204

Query: 165 VANEKPKVKTI-SVAPGVVDTQM----QVDIREKYG--NEMTTESLKR 205
           +A E      + +V+PG + T++    + ++++K+     M  E+L R
Sbjct: 205 LAVEWAGFARVNTVSPGYIATEITNFAEDELKDKWHKLTPMGREALPR 252

>AAL089W [98] [Homologous to ScYOR246C - SH]
           complement(184564..185550) [987 bp, 328 aa]
          Length = 328

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 86/216 (39%), Gaps = 41/216 (18%)

Query: 4   KVIIVTGVSRGIGRAIVNKII---------GLNSNAVVFGIARTSA------------PL 42
           KV +VTG + GIG   V  +          G NS+ V   I                 P 
Sbjct: 20  KVALVTGGNSGIGWYTVLHLYMHGFIVYVGGRNSSRVHKAIKEIKQEAENRLETARQDPH 79

Query: 43  KELKSKHGEKFFYIVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEE 102
            EL+   GE   Y+  D+T+   V+K       +   LD ++ NAGV+    E+     +
Sbjct: 80  DELERCLGE-LRYLPIDLTDLRSVEKAAKKFRAQESTLDVLINNAGVMALPYEL---THD 135

Query: 103 AWKRLFDINFFSIVSLVQSTLPFMENTNRNYVFVSS-GASVK---------------AYF 146
            ++     N+ S   L    LP+++ +    V +SS G  ++                +F
Sbjct: 136 GFEVQMQTNYVSHFLLTMRLLPYVKRSGGRVVTLSSIGHKIQFTYCPLDCHFDYRPNIFF 195

Query: 147 GWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVV 182
            W  Y+ +K A   F   +A + P V  I+V PG+V
Sbjct: 196 TWLRYAMAKTAAIQFTKMLAIKHPDVMCIAVHPGLV 231

>Sklu_2267.5 YNL202W, Contig c2267 5903-6955
          Length = 350

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 90/192 (46%), Gaps = 21/192 (10%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFG-----IARTSAPLKELKSKHGEKFFYIVG 58
           KV+ VTG +  I R     ++ L   A + G       + +  + +L   HG     + G
Sbjct: 84  KVLFVTGGAGTICRVQTEAMVLLGCKAAIVGRDKEKTIKVAGEISQLG--HGTSVLPVYG 141

Query: 59  -DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVS 117
            DV +   ++  ++  +++FGR+D V+A A     +++   +   A+K +  I+     +
Sbjct: 142 VDVRDIKQLEDAVSQTVNEFGRIDFVIAGAAG-NFISDFTNLSSNAFKSVVSIDLLGSFN 200

Query: 118 LVQSTLPFMENTNRNYVFVSS-----GASVKAYFGWAAYSASKAALNSFAMSVANEKP-- 170
            V++  P ++      +FVS+     G   +++ G     A+KA +++ + ++A E    
Sbjct: 201 TVKACFPQLKKNKGAIIFVSATFHYYGVPFQSHVG-----AAKAGIDALSNALAVELGVL 255

Query: 171 KVKTISVAPGVV 182
            +++  +APG +
Sbjct: 256 GIRSNCIAPGAI 267

>KLLA0D06127g complement(526164..527156) similar to sgd|S0005772
           Saccharomyces cerevisiae YOR246c, start by similarity
          Length = 330

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 89/218 (40%), Gaps = 43/218 (19%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFG---IARTSAPLKELKS------KHGE--- 51
           KV +VTG + GIG   V  +  L+   V  G    +R +  +KE+K       + G+   
Sbjct: 20  KVALVTGGNSGIGYYTVLHLY-LHGFKVYLGGRNSSRVNHAIKEIKKEAEIRLRKGQDEK 78

Query: 52  -----------KFFYIVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVD 100
                      K  Y+  D+T+ + V+K  T    +   LD ++ NAGV+    E+ K +
Sbjct: 79  PHDGLMIRKTGKLEYLHIDLTDLNSVEKAATKFTVQEDHLDVLINNAGVMAIPYELTKDN 138

Query: 101 EEAWKRLFDINFFSIVSLVQSTLPFME----------NTNRNYVFVSSGASVK------A 144
            E        N+ S   L    LP ++          +   N +F +     +       
Sbjct: 139 FEI---QMQTNYVSHFLLTMRLLPLIKARKGRVITVSSLGHNLIFFNCNPGAQFNYWPSM 195

Query: 145 YFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVV 182
           +F W  Y+ +K A   F   +A + P +  +S+ PG+V
Sbjct: 196 FFMWCRYALAKTASIQFTKMLAIKNPDILCMSLHPGLV 233

>AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH]
           (326834..327757) [924 bp, 307 aa]
          Length = 307

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 87/197 (44%), Gaps = 28/197 (14%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFF------ 54
           ++ +V++++G S+G+GRA   K I  + + VV  ++R+    +E  ++ GE         
Sbjct: 5   LNGQVVLISGGSQGLGRAFAQKYIEESDSTVVI-VSRS----EEKLTRAGEAICGGARRL 59

Query: 55  ---------YIVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEP--VAEVGKVDEEA 103
                    Y   ++ + + V  L     D   ++  V+  AG   P   AE+      A
Sbjct: 60  GAGGAGRLLYYACNLGDAAAVGGLFATLADAGLQVTQVLFCAGGAVPGLFAELSSAQLAA 119

Query: 104 WKRLFDINFFSIVSLVQSTLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAM 163
                ++N+ + + L       + +  R+ VF SS A+V  + G++ Y+  KAAL +   
Sbjct: 120 G---VEMNYGTALHLAHGA---VRHGARHLVFFSSAAAVYPFIGYSQYAPLKAALRALVA 173

Query: 164 SVANEKPKVKTISVAPG 180
            +  E   V+   V PG
Sbjct: 174 VLRQECDGVRVSCVYPG 190

>ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [990
           bp, 329 aa]
          Length = 329

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 81/173 (46%), Gaps = 14/173 (8%)

Query: 1   MSPK--VIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVG 58
           + PK  + +VTG + G+G+ IV ++       V+  +     P  +L+S  G  F+    
Sbjct: 56  LDPKRDIALVTGGAGGLGKEIVRELRRRQIVTVILDVV----PPPDLESLTGVHFY--AC 109

Query: 59  DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSL 118
           D++    ++ +    I   G +  ++ NA +   +  + +VD +  +++  +N     +L
Sbjct: 110 DISLPGRIRVIHENIIRDVGHVTILINNAAITSDLP-LDRVDNDKIEQIIRVNLLGPYTL 168

Query: 119 VQSTLPFMENTNRNYVFVSSGASVKAYFGWA---AYSASKAALNSFAMSVANE 168
           ++  LP M   +R Y+   + ASV  +   A   AY ASK  L +   S+ +E
Sbjct: 169 IREFLPSMIAIDRGYIV--NIASVLGFVTPARLTAYGASKGGLIALHESLVDE 219

>YKL055C (OAR1) [3204] chr11 complement(334966..335802)
           3-Oxoacyl-[acyl-carrier-protein] reductase [837 bp, 278
           aa]
          Length = 278

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 95/228 (41%), Gaps = 52/228 (22%)

Query: 5   VIIVTGVSRGIGRAIVNKIIGLNSNAVVFG-----IARTSAPLKELKS------------ 47
           V IVTG +RGIG+AI  K+     + ++ G     I RT+    +L+S            
Sbjct: 6   VAIVTGATRGIGKAICQKLFQKGLSCIILGSTKESIERTAIDRGQLQSGLSYQRQCAIAI 65

Query: 48  ---KHGEKFFYIVGD----VTNKSDVKKLITAAIDKFGRLDS---------VVANAGVLE 91
              K      Y   D      ++  +K+  +   D   +  +         ++  AG+ +
Sbjct: 66  DFKKWPHWLDYESYDGIEYFKDRPPLKQKYSTLFDPCNKWSNNERRYYVNLLINCAGLTQ 125

Query: 92  PVAEVGKVDEEAWKRLFDINFFSIVSLVQSTLPFMENTNRNYVFVSSGASVKAYF----- 146
               V     +  + + ++NF S V++    + +M  + R +  +S G S +        
Sbjct: 126 ESLSVRTTASQI-QDIMNVNFMSPVTMTNICIKYMMKSQRRWPELS-GQSARPTIVNISS 183

Query: 147 ----------GWAAYSASKAALNSFAMSVANE-KPK-VKTISVAPGVV 182
                     G + YSASKAAL+ F   +A E +P+ ++  +++PG+V
Sbjct: 184 ILHSGKMKVPGTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLV 231

>Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement
          Length = 326

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 54/119 (45%), Gaps = 19/119 (15%)

Query: 80  LDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTLPFMENTNRNYVFVSS- 138
           LD ++ NAGV+    E+ K   + ++     N+ S   L    LP ++  N   + VSS 
Sbjct: 114 LDVLINNAGVMALPYEITK---DGFEIQLQTNYISHFLLTMRLLPRIKRCNGRVITVSSI 170

Query: 139 GASVK-AYFG--------------WAAYSASKAALNSFAMSVANEKPKVKTISVAPGVV 182
           G +++  YF               W  Y+ +K AL  F   +A + P V  ISV PG+V
Sbjct: 171 GHNLEFTYFNLNRDFNYMPNIIFTWMRYAMAKTALIQFTKMLAIKHPDVLCISVHPGLV 229

>Scas_613.18
          Length = 286

 Score = 40.8 bits (94), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 81/192 (42%), Gaps = 23/192 (11%)

Query: 5   VIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNKS 64
           V +VTG S G+G  IV +++      ++  I   +      K+       Y   DV ++ 
Sbjct: 37  VALVTGGSSGLGLEIVKQLLSKRCTVIILDIYPPNIQFGADKA-----LTYYKCDVGSQE 91

Query: 65  DVKKLITAAIDKFGRLDSVVANAGV--LEPVAEVGKVDEEAWKRLFDINFFSIVSLVQST 122
           +++K           +  ++ NAG+  L+P+ E  K   E   ++ ++N+     L+   
Sbjct: 92  EIEKTYKRISKDHASIHILINNAGITCLKPITEFSK---EEVNKVINVNYLGACKLMHLW 148

Query: 123 LPFMENTNRNYVFVSSGASVKAYFG---WAAYSASKAALNSFAMSV-----ANEKPKVKT 174
           L     +  N  F+ + ASV         AAY ASK  L SF  S+          K+K 
Sbjct: 149 L-----SANNEGFIVNIASVLGLITPARLAAYGASKGGLISFHQSLNLLLKKRTTNKIKM 203

Query: 175 ISVAPGVVDTQM 186
           + V  G + T+M
Sbjct: 204 LLVCTGKIRTKM 215

>Kwal_14.2598
          Length = 311

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 82/197 (41%), Gaps = 25/197 (12%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKE-------LKS--------- 47
           +V+++ G S+G+G+A  +K     SN  V  ++R+   L+        LK+         
Sbjct: 9   QVVLIAGGSQGLGKAFASKFYNEGSNNKVIVVSRSRTKLQNAVCDVSGLKTAPELLPDTE 68

Query: 48  --KHGEKFFYIVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEP--VAEVGKVDEEA 103
             K+G   +Y   D+   + V+KL  +          V+  AG   P    ++   + E 
Sbjct: 69  IPKNGNHIWYSPCDLAEYAQVEKLYESLKACSLEPTQVLLCAGGSTPGLFKDLQGPELEL 128

Query: 104 WKRLFDINFFSIVSLVQSTLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAM 163
             R   +N+ + V+L    +        + VF SS  +   + G++ Y+  K ++ S   
Sbjct: 129 GVR---VNYMTCVNLAH--IAVCHWPTSHLVFFSSEVAFFPFIGYSQYAPLKQSIKSLVA 183

Query: 164 SVANEKPKVKTISVAPG 180
            +  E P+ +   V PG
Sbjct: 184 ILRQECPQQRISCVYPG 200

>YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine
           reductase, catalyzes the second step in the synthesis of
           phytosphingosine [963 bp, 320 aa]
          Length = 320

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 85/212 (40%), Gaps = 29/212 (13%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPL------------------ 42
           +  +V+++TG S+G+G+    K      N  +  ++R+ A L                  
Sbjct: 5   LEDQVVLITGGSQGLGKEFAKKYYNEAENTKIIIVSRSEARLLDTCNEIRIEAHLRRETT 64

Query: 43  KELKSKHG--------EKFFYIVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVA 94
            E + +H         ++ FY   D++    V+ L  A  D        +  AG   P  
Sbjct: 65  DEGQVQHKLAAPLDLEQRLFYYPCDLSCYESVECLFNALRDLDLLPTQTLCCAGGAVPKL 124

Query: 95  EVGKVDEEAWKRLFDINFFSIVSLVQSTLPFMENTNRNYVFV-SSGASVKAYFGWAAYSA 153
             G    E      DIN+ + ++ V   +   E T  +++ + SS  ++  + G++ Y+ 
Sbjct: 125 FRGLSGHEL-NLGMDINYKTTLN-VAHQIALAEQTKEHHLIIFSSATALYPFVGYSQYAP 182

Query: 154 SKAALNSFAMSVANEKPKVKTISVAPGVVDTQ 185
           +KAA+ S    +  E    +   V PG  +++
Sbjct: 183 AKAAIKSLVAILRQELTNFRISCVYPGNFESE 214

>YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the
           short-chain dehydrogenase-reductase family, which are
           NAD- or NADP-dependent oxidoreductases, has low
           similarity to S. cerevisiae Ylr426p [927 bp, 308 aa]
          Length = 308

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 70/150 (46%), Gaps = 17/150 (11%)

Query: 54  FYIVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFF 113
           FY   D+T+  ++K L  A     G ++ ++ NAGV   + ++  +  +  ++L DIN  
Sbjct: 85  FYYQCDITSLDEIKNLKKAIERDHGNINIIINNAGVAH-IKKLEHMTNKEVEQLIDINLI 143

Query: 114 SIVSLVQSTLPFMENTNRNYV-FVSSGASVKAYFGWA---AYSASKAALNSF-------- 161
               ++ +   F E+   N   F+ + ASV      A   +Y ASK A+  F        
Sbjct: 144 GAYRIIST---FAEDMIDNREGFIINIASVLGELTPARLTSYGASKGAMIGFHKCMSRHF 200

Query: 162 -AMSVANEKPKVKTISVAPGVVDTQMQVDI 190
            ++S    K  +KT+ V PG + T M +D+
Sbjct: 201 RSLSTECNKTGIKTLLVCPGKIKTNMFIDV 230

>Scas_721.47
          Length = 344

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 84/190 (44%), Gaps = 34/190 (17%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKS----KHGEKFFYIVGD 59
           K  +VTG S GIG+   N++     N V+  I+RT + L+ LK     K+G K   +  D
Sbjct: 63  KYCVVTGASDGIGKEFANQMAARGFNLVL--ISRTLSKLEALKEEFEKKYGIKVEILAID 120

Query: 60  VTNKSD-----VKKL-----ITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFD 109
           +++ S      +K L     IT  I+  G+  S+        PV  + + +EE  + +  
Sbjct: 121 ISSDSQDNYEFIKGLCKDLPITVLINNVGQSHSI--------PVPFL-ETEEEELRNIIT 171

Query: 110 INFFSIVSLVQSTLPFMENT------NRNYVFV--SSGASVKAYFGWAAYSASKAALNSF 161
           IN  + + + Q   P +  T      +R  +    S G  +      A YS SKA L  +
Sbjct: 172 INNTATLLITQIIAPIISKTVKETKKSRGLILTMGSFGGLIPTPL-LATYSGSKAFLQQW 230

Query: 162 AMSVANEKPK 171
           + S+A E  K
Sbjct: 231 STSLAGELQK 240

>Kwal_23.4572
          Length = 300

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 67/132 (50%), Gaps = 13/132 (9%)

Query: 59  DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSL 118
           DV     +++ +   +++FGR+D V+A A     +A   K+   A+K +  I+     + 
Sbjct: 93  DVREIEQLEEAVARTVERFGRIDFVIAGAAG-NFIAPFSKLSANAFKSVVSIDLLGSFNT 151

Query: 119 VQSTLPFMENTNRNYVFVSS-----GASVKAYFGWAAYSASKAALNSFAMSVANEK--PK 171
            ++ L  ++ T  + +FVS+     G   +++ G     A+KA +++ + ++A E     
Sbjct: 152 AKACLAELQRTKGSILFVSATFHYYGVPYQSHVG-----AAKAGVDALSNALAVELGVSG 206

Query: 172 VKTISVAPGVVD 183
           V++  +APG ++
Sbjct: 207 VRSNCIAPGAIE 218

>YOR246C (YOR246C) [5035] chr15 complement(795801..796793) Member of
           the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases, has low
           similarity to a region of WW domain-containing
           oxidoreductase (mouse Wwox), which is an apoptosis
           activator [993 bp, 330 aa]
          Length = 330

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 85/225 (37%), Gaps = 54/225 (24%)

Query: 4   KVIIVTGVSRGIG---------RAIVNKIIGLNSNAVVFGIART--------------SA 40
           K+ +VTG + GIG            V  I G NS+ +   I                 S+
Sbjct: 17  KIAVVTGGNTGIGWYTVLHLYLHGFVVYICGRNSHKISKAIQEILAEAKKRCHEDDDGSS 76

Query: 41  P-------LKELKSKHGEKFFYIVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPV 93
           P       ++ L S H     YI  D+T+   V++     +     +D +V NAG++   
Sbjct: 77  PGAGPGPSIQRLGSLH-----YIHLDLTDLKCVERAALKILKLEDHIDVLVNNAGIMAVP 131

Query: 94  AEVGKVDEEAWKRLFDINFFSIVSLVQSTLPFMENTNRNYVFVSS-GASVK--------- 143
            E+ K   + ++     N+ S        LP + +     + +SS G  ++         
Sbjct: 132 LEMTK---DGFEVQLQTNYISHFIFTMRLLPLLRHCRGRIISLSSIGHHLEFMYWKLSKT 188

Query: 144 ------AYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVV 182
                   F W  Y+ SK AL      +A + P V  +SV PG+V
Sbjct: 189 WDYKPNMLFTWFRYAMSKTALIQCTKMLAIKYPDVLCLSVHPGLV 233

>CAGL0H08063g 785331..786203 highly similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19, start by
           similarity
          Length = 290

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 89/191 (46%), Gaps = 18/191 (9%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFG--IARTSAPLKELKSKHGEKFFYIVGDVT 61
           KV  VTG +  I R  V  ++ L     + G    +T    KE+ S        +     
Sbjct: 23  KVGFVTGGAGTICRVQVEALVLLGCKVAIIGRDHEKTERVAKEISSLVDNPDAVLPISKV 82

Query: 62  NKSDVKKLITA---AIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSL 118
           +  +VK+L +A    +D++GR+D V+A A     + +   +   A+K +  I+     + 
Sbjct: 83  DVREVKQLESAVKRTVDRYGRIDYVIAGAAG-NFICDFNHLSANAFKSVVSIDLLGSFNT 141

Query: 119 VQSTLPFMENTNRNYVFVSS-----GASVKAYFGWAAYSASKAALNSFAMSVANEKPK-- 171
            ++T+P +  +  + +FVS+     G   +++ G     A+KA +++ + ++A E     
Sbjct: 142 AKATMPELIKSRGSILFVSATFHYYGVPFQSHVG-----AAKAGIDALSNALAVEMGPFG 196

Query: 172 VKTISVAPGVV 182
           V++  +APG +
Sbjct: 197 VRSNCIAPGAI 207

>ABR076C [667] [Homologous to ScYKL055C (OAR1) - SH]
           (527756..528571) [816 bp, 271 aa]
          Length = 271

 Score = 37.0 bits (84), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 12/93 (12%)

Query: 106 RLFDINFFSIVSLVQSTLPFMENTNR---------NYVFVSSGASVKAYFGWAAYSASKA 156
           RL  +N  S+VSL Q ++  M    R         N   V   A  +   G A Y+ASK+
Sbjct: 135 RLLHVNLGSLVSLCQLSVRPMLRARRVAHARPTIVNVASVLGCAHAQPPPGTAVYAASKS 194

Query: 157 ALNSFAMSVAN--EKPKVKTISVAPGVV-DTQM 186
           A+  ++ ++A   E+  +   +VAPG+V DT M
Sbjct: 195 AVIQYSRALAAELERTGIACHAVAPGLVPDTDM 227

>Scas_655.19
          Length = 297

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 95/225 (42%), Gaps = 31/225 (13%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIA--RTSAPLKELKS--------KHGEKF 53
           KV+ VTG +  I R  V  ++ L   A + G    +T    KE++S           +  
Sbjct: 23  KVVFVTGGAGTICRVQVEAMVLLGCKAAILGREEKKTIDAAKEIESLVRSPTENDDADPI 82

Query: 54  FYIVG--DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDIN 111
              +G  DV N   +K  +   +D FG +D ++A A     + +   +   A+K + DI+
Sbjct: 83  VLPLGNIDVRNFDQLKNAVKKTVDTFGHIDYLIAGAAG-NFICDFMNLSPNAFKSVIDID 141

Query: 112 FFSIVSLVQSTLPFMENTNRNYVFVSS-----GASVKAYFGWAAYSASKAALNSFAMSVA 166
                + V++    +     + +FVS+     G   + + G     A+KA +++ + ++A
Sbjct: 142 LLGSFNTVKACASQLIKNKGSVLFVSATFHYYGVPFQLHVG-----AAKAGIDALSNNLA 196

Query: 167 NE--KPKVKTISVAPGVVDTQ------MQVDIREKYGNEMTTESL 203
            E     V++  +APG +            D  EK  N++  + L
Sbjct: 197 VELGPLGVRSNCIAPGAIGQTEGFKRLTGTDFEEKSLNKIPLQRL 241

>CAGL0J11264g complement(1094218..1095447) highly similar to
           sp|P53878 Saccharomyces cerevisiae YNL181w, start by
           similarity
          Length = 409

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 7/96 (7%)

Query: 4   KVIIVTG-VSRGIGRAIVNKIIGLNSNAVVFGI---ARTSAPLKELKSK-HGEKFFYIVG 58
           KV IVTG  S+G+G ++V ++  L +  ++        T+   ++L+ +   E  F    
Sbjct: 54  KVYIVTGATSQGMGTSVVLEMARLGAQLIILCRDVDEWTTDWCEDLRERTQNELIFVEQC 113

Query: 59  DVTNKSDVKKLITAAIDKFG--RLDSVVANAGVLEP 92
           D+++  +V+K  T  +D     RLD VVA +G +EP
Sbjct: 114 DLSDLYEVRKFATTWLDNSPPRRLDGVVALSGDMEP 149

>Kwal_27.12155
          Length = 280

 Score = 35.8 bits (81), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 13/119 (10%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVF-----GIARTSAPLKELKSKHGEKFFYIVG 58
           KV  ++G S GIG A+        ++  V+      +  T+   ++L + +  +      
Sbjct: 31  KVACISGASSGIGAAVAEAFAQAGADLAVWYNSHPALVETA---RDLANTYHVRVVAYKC 87

Query: 59  DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLE---PV--AEVGKVDEEAWKRLFDINF 112
            V ++  V+  I   I +FGR+D  VANAGV     P+  A+   V ++ W R+   +F
Sbjct: 88  PVDDEQQVQATIARVITEFGRIDVFVANAGVAWHEGPLLDAQRRSVADQEWNRIIQTDF 146

>Scas_566.11
          Length = 346

 Score = 35.0 bits (79), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 52/129 (40%), Gaps = 16/129 (12%)

Query: 73  AIDKFGRLDSVVANA--GVLEP---VAEVGKVDEEAWKRLFDINFFSIVSLVQSTLPFME 127
            ID  G +  V++N    V  P   +  +G   ++    +F  N F    L+Q  LP ++
Sbjct: 109 GIDWIGAVKEVISNPLEAVTNPTYKIQRIGVKSKDGMGLVFQANVFGPYYLIQKLLPLLK 168

Query: 128 NTNRNYVFVSSGASVKAYFGW---------AAYSASKAALNSFAMSVANEKPK--VKTIS 176
             N   V++SS  S   Y            A+Y  SK  ++   ++   E+ K  +    
Sbjct: 169 AGNGTIVWISSVMSAPKYLSLQDIELLKTDASYEGSKRLVDLLHLATYEERKKLGIHQYV 228

Query: 177 VAPGVVDTQ 185
           V PG+  + 
Sbjct: 229 VQPGIFTSH 237

>Sklu_2377.6 YER070W, Contig c2377 15087-17720 reverse complement
          Length = 877

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/166 (19%), Positives = 72/166 (43%), Gaps = 11/166 (6%)

Query: 81  DSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTLPFMENTNRNYVFVSSGA 140
           + ++ + G ++ +  + K  +E +K +++I   S++ L     PF++ +    +++    
Sbjct: 693 NRIILDNGSIQNIEGIPKATKEIYKTVWEIPQRSLIDLSSERAPFIDQSQSLNLYLREPT 752

Query: 141 SVK----AYFGWAA-------YSASKAALNSFAMSVANEKPKVKTISVAPGVVDTQMQVD 189
             K     ++GW         Y  ++AA ++   ++  E   + ++SVAPG  +      
Sbjct: 753 MGKLTSMHFYGWKKGLKTGMYYLRTQAASSAIQFTLNQENTLLGSVSVAPGSKELSFLPA 812

Query: 190 IREKYGNEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPD 235
              KY +  T  S  + +    +    +S+   +V  K  V GI D
Sbjct: 813 FIGKYPSNTTGASDNKSVTFSCSSTDDESNGSSQVPEKEDVYGIHD 858

>Scas_669.3
          Length = 1638

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 110  INFFSIVSLVQSTLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALN 159
            INF +IV+LV     F+E  NRN+V  +S   + +  GW  +  +   LN
Sbjct: 1381 INFTAIVALVNVKCQFIEMNNRNWVVFTS--VILSCGGWLVWCCALPILN 1428

>Scas_652.19d1
          Length = 344

 Score = 32.7 bits (73), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 72/160 (45%), Gaps = 22/160 (13%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSK------HGEKFF 54
           +S K  +VTG + GIG+ +V  +   N N  V G+ RT A  +E K +        +   
Sbjct: 39  LSDKTAVVTGCNTGIGKHVVELLYQKNCN--VIGVVRTDAKGEEAKKEIIANNPKSKGNI 96

Query: 55  YIVG-----DVTNKSDVKKLITAAI-DKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLF 108
            I+G     D+     V   I  A+ DK   L+ ++ NAG++ P  +   V  + ++ +F
Sbjct: 97  TIIGGCDYLDLEKVPAVGGKIKEALGDK--PLNIIIHNAGLMAPDNKGTSV--QGYEAMF 152

Query: 109 DINFFSIVSLVQSTLP-FMENTN---RNYVFVSSGASVKA 144
             N      L     P F++  +   +  V+VSSGA   A
Sbjct: 153 QTNVLGSQLLQHFLDPLFLKEDDISLKRIVWVSSGAHFLA 192

>Kwal_33.14451
          Length = 406

 Score = 32.3 bits (72), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 52/98 (53%), Gaps = 11/98 (11%)

Query: 4   KVIIVTG-VSRGIGRAIVNKIIGLNSNAVVFGIART-----SAPLKELKSKHGEKFFYI- 56
           KV I+TG  ++G+G A+  ++    +  ++  + RT     +  +++L+S+   +  Y+ 
Sbjct: 54  KVYILTGATTQGMGTAVALEMAQRGAQLII--LTRTIDEWSTEWVEDLRSRTSNELIYLE 111

Query: 57  VGDVTNKSDVKKLITAAIDKFG--RLDSVVANAGVLEP 92
             D+ +  +V+K  T  +D     RLD VV  +G LEP
Sbjct: 112 QCDLCDLYEVRKFATKWLDNSPPRRLDGVVVMSGDLEP 149

>Scas_641.31
          Length = 287

 Score = 31.6 bits (70), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 3/43 (6%)

Query: 147 GWAAYSASKAALNSFAMSVANEKPK--VKTISVAPGVV-DTQM 186
           G + YSASKAAL  +  +++ E     ++ +S+APG+V DT M
Sbjct: 207 GTSIYSASKAALIQYTRTLSQETETWGIRALSMAPGLVTDTDM 249

>CAGL0M13013g complement(1281291..1282103) similar to sp|P35731
           Saccharomyces cerevisiae YKL055c OAR1, hypothetical
           start
          Length = 270

 Score = 31.2 bits (69), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 106/264 (40%), Gaps = 65/264 (24%)

Query: 7   IVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK--- 63
           IVTG + G+G+AIV K+     N +  G + T +  K+L+   G+   +      N+   
Sbjct: 8   IVTGATGGVGKAIVRKLTREGVNCIAIG-SSTDSITKKLR--FGDDLLFTGAHHRNRAVA 64

Query: 64  ---------------------------SDVKKLITAAIDKFGRLDS-------VVANAGV 89
                                      +  K+L+ +    F   DS       +V  AG+
Sbjct: 65  LDLARWDGEFNHSAATIEGYIAEGNISTSNKELVLSNALAFDNNDSNRYTLRVLVNCAGI 124

Query: 90  LEPVAEVG-KVDEEAWKRLFDINFFSIVSLVQSTLPF-MENTNRNYVFVSSGASVKAYF- 146
            +  A VG ++       + ++NF S V L        M+  +R  + + + +S+   F 
Sbjct: 125 TQ--ASVGIRMSPNVISNMINVNFASAVYLSNYAARLQMKQKSRKRLDIINVSSILGGFA 182

Query: 147 --------GWAAYSASKAALNSFAMSVAN--EKPKVKTISVAPGVV-DTQMQVDIREKYG 195
                   G + YSA+KAAL+ F        E+  +    +APG++ +T M  ++ E+  
Sbjct: 183 DKRNFMIQGTSIYSATKAALSQFTRVYGKEVERLSINCHDIAPGLIPETDMIKNLPER-- 240

Query: 196 NEMTTESLKRFIDLHKNGELLDSD 219
                E+L R I    NGE+   D
Sbjct: 241 ---AQENLLRTI----NGEITTVD 257

>Scas_650.8
          Length = 326

 Score = 31.6 bits (70), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 83/218 (38%), Gaps = 44/218 (20%)

Query: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKEL------------------ 45
           KV ++TG + GIG   V  +        V+   RTS  +K+                   
Sbjct: 17  KVAVITGGNSGIGWYTVLHL--YMHGFTVYLCGRTSHKIKKAINEITIEAEARLGLLEKE 74

Query: 46  -----KSKHGEKFFYIVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVD 100
                K  H     YI  D+T+   V+K     +    ++D ++ NA +L    E+ K  
Sbjct: 75  VDDFGKDIHLGSLRYIHMDLTDLKCVEKAAQKLLKLEDKIDVLINNAAILAIPYELTK-- 132

Query: 101 EEAWKRLFDINFFSIVSLVQSTLPFMENTNRNYVFVSS-GASVKA--------------- 144
            + ++     N+ +   L    LP ++  +   + + S G  ++                
Sbjct: 133 -DGFEIQLQTNYIAHFLLTMRLLPAIKKCHGRIITLGSLGHRLEVTYWNLNKKWDYKPNM 191

Query: 145 YFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVV 182
            F W  Y+ +K A   +   ++ + P+V  +S+ PG+V
Sbjct: 192 IFTWFRYAVAKTASIQYTKMLSIKYPEVLCLSLHPGLV 229

>Scas_652.19d
          Length = 341

 Score = 31.2 bits (69), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 69/166 (41%), Gaps = 21/166 (12%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSN--AVVFGIARTSAPLKELKSKH--------- 49
           ++ K  ++TG + GIG  ++  +   N N  AVV    +  A  KE   K+         
Sbjct: 39  LTSKTALITGTNTGIGFEVMKLLYSKNCNIIAVVRSAEKGEAAKKEAIEKYPNSKGSISV 98

Query: 50  -GEKFFYIVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLF 108
            G   F  +  V   S+  KL+    DK   L+ ++ NAG++ PV       ++  + +F
Sbjct: 99  VGGNDFLDLTTVKPASEEIKLVLG--DK--PLNIIIHNAGLMAPVNT--GTSKQGLEAMF 152

Query: 109 DINFFSIVSLVQSTLPFM---ENTNRNYVFVSSGASVKAYFGWAAY 151
             N      L     P     ++  +  V+VSSGA   A F +  +
Sbjct: 153 STNVLGPQLLQHFLDPLFLKKDDDLKRIVWVSSGAHANACFDYGIH 198

>Scas_675.10
          Length = 312

 Score = 30.8 bits (68), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 35/206 (16%), Positives = 82/206 (39%), Gaps = 35/206 (16%)

Query: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTS-------------------AP 41
           ++ +++++TG S+G+GR   +K     +N+ +  ++R+                    +P
Sbjct: 5   LNDQIVLITGGSQGLGREFAHKYYHEGNNSKIIVVSRSEKKLIKAVDAISGKTVGTNLSP 64

Query: 42  LKELKSKHGEKFFYIVGDVTNKSDVKKLITAAIDKFGRLD----SVVANAGVLEPVAEVG 97
            +  K     K +Y   D+++   V    +   D+   L+     V   AG       + 
Sbjct: 65  EETGKLNKNAKLYYYPCDLSDHEAV----STMFDRLCELEMLPTQVYCCAG-----GSIP 115

Query: 98  KVDEEAWKRLFDINF---FSIVSLVQSTLPFMENTNRNYVFVSSGASVKAYFGWAAYSAS 154
           K+ ++      D+     +S    +   +  +E +N + +  SS  +   + G++ Y+  
Sbjct: 116 KLFKDLTGEELDMGIKMNYSTTLHIAHKVAQLELSNCHLILFSSVTAFFPFIGYSQYAPL 175

Query: 155 KAALNSFAMSVANEKPKVKTISVAPG 180
           K +L +    +  E  + +   V PG
Sbjct: 176 KVSLKALVGILRQEMLQNRISCVYPG 201

>KLLA0F17050g complement(1564921..1565937) similar to sp|P32419
           Saccharomyces cerevisiae YDL078c MDH3 malate
           dehydrogenase, peroxisomal, start by similarity
          Length = 338

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 7/83 (8%)

Query: 100 DEEAWKRLFDINFFSIVSLVQSTLPFMENTNRNYVFVSSGA-SVKAYFGWAAYSASKAAL 158
           D++ ++RL D N +      +S +  ++      V    G+ S      WA Y+ +K  L
Sbjct: 192 DQKFYRRLRDSNVY------ESYVHRVQFGGDEVVKAKDGSGSATLSMAWAGYTFAKKLL 245

Query: 159 NSFAMSVANEKPKVKTISVAPGV 181
           NS  ++ A ++  + T    PG+
Sbjct: 246 NSLHLNTAGDQHPIPTFVYLPGL 268

>KLLA0B09812g complement(856799..857839) similar to sp|P38286
           Saccharomyces cerevisiae YBR159w singleton, start by
           similarity
          Length = 346

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 78/186 (41%), Gaps = 39/186 (20%)

Query: 7   IVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNKSDV 66
           +VTG S GIG+    ++     N ++  I+RT + L ELK +          +   K DV
Sbjct: 69  VVTGASDGIGKEYAKQLAKRGFNLIL--ISRTESKLVELKKEI---------ETECKIDV 117

Query: 67  KKLITAAID-------KFGRLDSVVANAGVLEPVAEVGK----------VDEEAWKRLFD 109
           K L   AID        +  +  V +   V   +  VGK           +E   + +  
Sbjct: 118 KIL---AIDVSSDSKENYTLIREVASGLPVTVLINNVGKSHSIPVPFDQTEESELRDIIT 174

Query: 110 INFFSIVSLVQSTLPFMENT-----NRNYVFV--SSGASVKAYFGWAAYSASKAALNSFA 162
           IN  + + + Q+ LP ++ +      R  +    S G  +   F  A YS SKA L S++
Sbjct: 175 INNTATLMITQTLLPQLKASVKTLKCRGLILTMGSFGGLLPTPF-LATYSGSKAFLQSWS 233

Query: 163 MSVANE 168
            ++A E
Sbjct: 234 NALAGE 239

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 110  INFFSIVSLVQSTLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNS 160
            INF +IV+L+     F+E  NRN++  +S   V +  GW  +  +   LN+
Sbjct: 1407 INFTAIVALINVKSQFVEMHNRNWLAFTS--VVLSCGGWLVWCCALPILNN 1455

>YMR090W (YMR090W) [4048] chr13 (449244..449927) Protein of
          unknown function, has moderate similarity to
          uncharacterized C. albicans Ymr90p [684 bp, 227 aa]
          Length = 227

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 7/88 (7%)

Query: 1  MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDV 60
          MSP  + V G S  +GR ++N++   +S +    I RT   +   K++ G      + D+
Sbjct: 1  MSPMKVAVVGASGKVGRLLINQLKANDSFSTPLAIVRTQDQVNYFKNEVG--VDASLTDI 58

Query: 61 TNKSDVKKLITAAIDKFGRLDSVVANAG 88
           N S     ++   D     D+VV +AG
Sbjct: 59 ENAS-----VSEITDAIKAYDAVVFSAG 81

>KLLA0F01749g complement(163821..164762) similar to sp|P38342
           Saccharomyces cerevisiae YBR265w TSC10 3-ketosphinganine
           reductase singleton, start by similarity
          Length = 313

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 85/201 (42%), Gaps = 30/201 (14%)

Query: 4   KVIIVTGVSRGIGRAIVNKII------GLNSNAVVFGIARTSAPLKELKSK---HGEKFF 54
           +VI+++G S+G+G +   + +      G N+N V+  ++R+ + L +   +    G    
Sbjct: 9   QVILISGGSQGLGESFAKRFVQDDDGPGSNTNKVII-VSRSQSKLVKACERIGVDGVSLD 67

Query: 55  YIVGDVTNKSDVKKLI----TAAIDKFGRL-----------DSVVANAGVLEPVAEVGKV 99
             V D TN+++ K +     T++ DK   +             V   AG   P   +   
Sbjct: 68  RYVND-TNRNETKLIYHSCDTSSYDKVALMFKLLVKSELVPSQVYMCAGGSIPKLFLDLT 126

Query: 100 DEEAWKRLFDINFFSIVSLVQSTLPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALN 159
            EE  +     N+ + V+L   +L   ++   + +F SS  +   + G+A Y+  K ++ 
Sbjct: 127 PEEL-QNGITTNYSTAVNLAHVSL---KHDVPHLLFFSSEVAFFPFIGYAQYAPLKQSIR 182

Query: 160 SFAMSVANEKPKVKTISVAPG 180
           S    +  E    +   V PG
Sbjct: 183 SLVAILRQEHSSTRITCVYPG 203

>Sklu_2404.13 YKL055C, Contig c2404 24100-25005
          Length = 301

 Score = 28.5 bits (62), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 147 GWAAYSASKAALNSFAMSVANE--KPKVKTISVAPGVV-DTQMQVDIREKYGNEM 198
           G + YSASKAA+  ++M ++ E  +  V+   V+P +V DT M   + E   N +
Sbjct: 212 GTSIYSASKAAIAQYSMVLSQELARSGVRVNCVSPKLVADTDMIRTLSEDIVNRL 266

>CAGL0K09152g 909456..910439 highly similar to tr|Q08651
           Saccharomyces cerevisiae YOR246c, hypothetical start
          Length = 327

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 84/216 (38%), Gaps = 40/216 (18%)

Query: 4   KVIIVTGVSRGIGRAIVNK---------IIGLNSNAVVFG--------IARTSAPLKELK 46
           +V +VTG + GIG   V           + G NS+ V           + R +  LK L 
Sbjct: 18  RVAVVTGGNSGIGWFTVLHLYMHGFRVYVCGRNSHKVSRAMDDIIEEAVRRHNLYLKGLH 77

Query: 47  SKHGEKFF----YIVGDVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEE 102
            +   ++     Y+  D+T+   V +     +     LD +V NAGV+    E+ K   +
Sbjct: 78  DQKPTRYLGSLQYLHTDLTDLKCVDRAAAKILRMENHLDVLVNNAGVMAVPYEITK---D 134

Query: 103 AWKRLFDINFFSIVSLVQSTLPFMENTNRNYVFVSSGASVKAY----------------F 146
            ++     N+ +   L    LP +  ++   V +SS      +                F
Sbjct: 135 GFEIQMQTNYIAHFLLTMRLLPLLRCSHGRVVTLSSLGHHIIFKYSKLDETWNYFPNFVF 194

Query: 147 GWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVV 182
            W  Y+ +K A   +   +A + P +  +SV PG+V
Sbjct: 195 TWFRYAMTKVASIQYTKMLAIKNPDILFVSVHPGLV 230

>CAGL0M11616g complement(1141541..1156183) similar to sp|Q12019
            Saccharomyces cerevisiae YLR106c, hypothetical start
          Length = 4880

 Score = 28.9 bits (63), Expect = 5.2,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 3/73 (4%)

Query: 151  YSASKAALNSFAMSVANEKPKVKTISVAPGVVDTQMQVDIREKYGNEMTTESLKRFIDLH 210
            +SA    +N+  +  A +  K   +  +PGV  T +   +    GN +T  +L    DL 
Sbjct: 1723 FSAPTTTVNTMKVIRAMQVHKPILLEGSPGVGKTSLITALANATGNNLTRINLSEQTDL- 1781

Query: 211  KNGELLDSDVPGE 223
               +L  SD PGE
Sbjct: 1782 --VDLFGSDAPGE 1792

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,859,568
Number of extensions: 328573
Number of successful extensions: 1309
Number of sequences better than 10.0: 102
Number of HSP's gapped: 1206
Number of HSP's successfully gapped: 112
Length of query: 252
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 153
Effective length of database: 13,168,927
Effective search space: 2014845831
Effective search space used: 2014845831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)