Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_628.537237218930.0
CAGL0F06875g37237216470.0
YIR034C (LYS1)37337016130.0
Sklu_2380.737437016090.0
KLLA0E07964g37237215210.0
Kwal_14.88037337014910.0
ACR167C37237213850.0
Scas_593.11960145790.100
Kwal_23.5184928143770.16
Scas_457.295641655.5
CAGL0E05390g95639647.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_628.5
         (372 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_628.5                                                            733   0.0  
CAGL0F06875g complement(673222..674340) highly similar to sp|P38...   639   0.0  
YIR034C (LYS1) [2698] chr9 complement(419612..420733) Saccharopi...   625   0.0  
Sklu_2380.7 YIR034C, Contig c2380 16828-17952                         624   0.0  
KLLA0E07964g complement(718820..719938) similar to sp|P38998 Sac...   590   0.0  
Kwal_14.880                                                           578   0.0  
ACR167C [1214] [Homologous to ScYIR034C (LYS1) - SH] (649155..65...   538   0.0  
Scas_593.11                                                            35   0.100
Kwal_23.5184                                                           34   0.16 
Scas_457.2                                                             30   5.5  
CAGL0E05390g complement(524480..527350) highly similar to sp|P40...    29   7.4  

>Scas_628.5
          Length = 372

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/372 (96%), Positives = 359/372 (96%)

Query: 1   MTVTLHLRAETKPLEARAALTPTTVKQLIAKGFKIYVEDSPQSIFHIDEYKKAGAIIVPA 60
           MTVTLHLRAETKPLEARAALTPTTVKQLIAKGFKIYVEDSPQSIFHIDEYKKAGAIIVPA
Sbjct: 1   MTVTLHLRAETKPLEARAALTPTTVKQLIAKGFKIYVEDSPQSIFHIDEYKKAGAIIVPA 60

Query: 61  GSWISAPRDRIIIGLKEMPETDKFPLVHEHIQFAHCYKNQAGWKDVLTRFINGNGTLYDL 120
           GSWISAPRDRIIIGLKEMPETDKFPLVHEHIQFAHCYKNQAGWKDVLTRFINGNGTLYDL
Sbjct: 61  GSWISAPRDRIIIGLKEMPETDKFPLVHEHIQFAHCYKNQAGWKDVLTRFINGNGTLYDL 120

Query: 121 EFLEDDEGRRVXXXXXXXXXXXXXLGLRDWAFKQTHSDAEDLPAVSPYPNEKALIKDISI 180
           EFLEDDEGRRV             LGLRDWAFKQTHSDAEDLPAVSPYPNEKALIKDISI
Sbjct: 121 EFLEDDEGRRVAAFGFYAGFAGAALGLRDWAFKQTHSDAEDLPAVSPYPNEKALIKDISI 180

Query: 181 EYKNALKKGAKKPTVLIIGALGRCGSGAIDLLRKIGLPEENIIKWDMKETARGGPFPEIA 240
           EYKNALKKGAKKPTVLIIGALGRCGSGAIDLLRKIGLPEENIIKWDMKETARGGPFPEIA
Sbjct: 181 EYKNALKKGAKKPTVLIIGALGRCGSGAIDLLRKIGLPEENIIKWDMKETARGGPFPEIA 240

Query: 241 QADIFINCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300
           QADIFINCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKP
Sbjct: 241 QADIFINCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300

Query: 301 TVLVPTTAGPKLSVISIDHLPSLLPREASEFFARDLLPSLEQLPERYTAPVWVKAEKLFN 360
           TVLVPTTAGPKLSVISIDHLPSLLPREASEFFARDLLPSLEQLPERYTAPVWVKAEKLFN
Sbjct: 301 TVLVPTTAGPKLSVISIDHLPSLLPREASEFFARDLLPSLEQLPERYTAPVWVKAEKLFN 360

Query: 361 RHCARVHRSSKL 372
           RHCARVHRSSKL
Sbjct: 361 RHCARVHRSSKL 372

>CAGL0F06875g complement(673222..674340) highly similar to sp|P38998
           Saccharomyces cerevisiae YIR034c LYS1 saccharopine
           dehydrogenase, hypothetical start
          Length = 372

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/372 (83%), Positives = 329/372 (88%)

Query: 1   MTVTLHLRAETKPLEARAALTPTTVKQLIAKGFKIYVEDSPQSIFHIDEYKKAGAIIVPA 60
           M+VTLHLR ETKPLE RAALTPTTVK LI KGFKIYVE+SPQSIF IDEY++AGAIIVP 
Sbjct: 1   MSVTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSIFKIDEYRRAGAIIVPF 60

Query: 61  GSWISAPRDRIIIGLKEMPETDKFPLVHEHIQFAHCYKNQAGWKDVLTRFINGNGTLYDL 120
           GSWISAPRDRIIIGLKEMPE DKFPLVHEHIQFAHCYK+QAGWKDVL RFINGNGTLYDL
Sbjct: 61  GSWISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAGWKDVLRRFINGNGTLYDL 120

Query: 121 EFLEDDEGRRVXXXXXXXXXXXXXLGLRDWAFKQTHSDAEDLPAVSPYPNEKALIKDISI 180
           EFLEDD GRRV             LGL DWAFKQTH D+EDLPAVSPYPNEKALIKDI  
Sbjct: 121 EFLEDDNGRRVAAFGFYAGFAGAALGLADWAFKQTHKDSEDLPAVSPYPNEKALIKDIGK 180

Query: 181 EYKNALKKGAKKPTVLIIGALGRCGSGAIDLLRKIGLPEENIIKWDMKETARGGPFPEIA 240
            YKNALK GAKKP VLIIGALGRCGSGAID L+K+GLPEENIIKWD++ET+RGGPFPEIA
Sbjct: 181 AYKNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENIIKWDIQETSRGGPFPEIA 240

Query: 241 QADIFINCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300
            +DIFINCIYLSKPI PFINY+LLNK  R+LRTVVDVSADTTNPHNPIPIYNIATVFNKP
Sbjct: 241 ASDIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300

Query: 301 TVLVPTTAGPKLSVISIDHLPSLLPREASEFFARDLLPSLEQLPERYTAPVWVKAEKLFN 360
           TV V T++GPKLSVISIDHLPSLLPREASEFFA DLLPSLEQLP R+ +PVWV+AEKLFN
Sbjct: 301 TVKVNTSSGPKLSVISIDHLPSLLPREASEFFAHDLLPSLEQLPSRHVSPVWVRAEKLFN 360

Query: 361 RHCARVHRSSKL 372
           RH AR  R SKL
Sbjct: 361 RHSARAIRESKL 372

>YIR034C (LYS1) [2698] chr9 complement(419612..420733) Saccharopine
           dehydrogenase (NAD+, L-lysine forming), catalyzes the
           eighth and final step in lysine biosynthesis pathway
           [1122 bp, 373 aa]
          Length = 373

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/370 (80%), Positives = 331/370 (89%)

Query: 3   VTLHLRAETKPLEARAALTPTTVKQLIAKGFKIYVEDSPQSIFHIDEYKKAGAIIVPAGS 62
           VTLHLRAETKPLEARAALTPTTVK+LIAKGFKIYVEDSPQS F+I+EY++AGAIIVPAGS
Sbjct: 4   VTLHLRAETKPLEARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVPAGS 63

Query: 63  WISAPRDRIIIGLKEMPETDKFPLVHEHIQFAHCYKNQAGWKDVLTRFINGNGTLYDLEF 122
           W +APRDRIIIGLKEMPETD FPLVHEHIQFAHCYK+QAGW++VL RFI G+GTLYDLEF
Sbjct: 64  WKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYDLEF 123

Query: 123 LEDDEGRRVXXXXXXXXXXXXXLGLRDWAFKQTHSDAEDLPAVSPYPNEKALIKDISIEY 182
           LE+D+GRRV             LG+RDWAFKQTHSD EDLPAVSPYPNEKAL+KD++ +Y
Sbjct: 124 LENDQGRRVAAFGFYAGFAGAALGVRDWAFKQTHSDDEDLPAVSPYPNEKALVKDVTKDY 183

Query: 183 KNALKKGAKKPTVLIIGALGRCGSGAIDLLRKIGLPEENIIKWDMKETARGGPFPEIAQA 242
           K AL  GA+KPTVLIIGALGRCGSGAIDLL K+G+P+ NI+KWD+KET+RGGPF EI QA
Sbjct: 184 KEALATGARKPTVLIIGALGRCGSGAIDLLHKVGIPDANILKWDIKETSRGGPFDEIPQA 243

Query: 243 DIFINCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKPTV 302
           DIFINCIYLSKPI PF N + LN   RRLRTVVDVSADTTNPHNPIPIY +ATVFNKPTV
Sbjct: 244 DIFINCIYLSKPIAPFTNMEKLNNPNRRLRTVVDVSADTTNPHNPIPIYTVATVFNKPTV 303

Query: 303 LVPTTAGPKLSVISIDHLPSLLPREASEFFARDLLPSLEQLPERYTAPVWVKAEKLFNRH 362
           LVPTTAGPKLSVISIDHLPSLLPREASEFF+ DLLPSLE LP+R TAPVWV+A+KLF+RH
Sbjct: 304 LVPTTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQRKTAPVWVRAKKLFDRH 363

Query: 363 CARVHRSSKL 372
           CARV RSS+L
Sbjct: 364 CARVKRSSRL 373

>Sklu_2380.7 YIR034C, Contig c2380 16828-17952
          Length = 374

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/370 (80%), Positives = 330/370 (89%)

Query: 3   VTLHLRAETKPLEARAALTPTTVKQLIAKGFKIYVEDSPQSIFHIDEYKKAGAIIVPAGS 62
           VTLHLRAETKP+EARAALTPTTVK+L++KGFKIYVE+S QS F I+EY++AGA IVP GS
Sbjct: 5   VTLHLRAETKPMEARAALTPTTVKKLLSKGFKIYVEESEQSTFDINEYREAGAEIVPTGS 64

Query: 63  WISAPRDRIIIGLKEMPETDKFPLVHEHIQFAHCYKNQAGWKDVLTRFINGNGTLYDLEF 122
           W++AP+DRIIIGLKEMPETD FPLVHEHIQFAHCYKNQAGW+DVL RF  GNGTLYDLEF
Sbjct: 65  WVNAPKDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWQDVLGRFKRGNGTLYDLEF 124

Query: 123 LEDDEGRRVXXXXXXXXXXXXXLGLRDWAFKQTHSDAEDLPAVSPYPNEKALIKDISIEY 182
           LE+D+GRRV             LGLRDW+FKQ HSD +DLPAVSPYPNEKALIKD+  +Y
Sbjct: 125 LENDQGRRVAAFGFYAGFAGAALGLRDWSFKQLHSDNQDLPAVSPYPNEKALIKDVVNDY 184

Query: 183 KNALKKGAKKPTVLIIGALGRCGSGAIDLLRKIGLPEENIIKWDMKETARGGPFPEIAQA 242
           + ALKKGAKKP VLIIGALGRCGSGA+DLL K G+ +ENI+KWD+KET+RGGPF EIAQA
Sbjct: 185 QAALKKGAKKPRVLIIGALGRCGSGAVDLLHKAGVSDENILKWDIKETSRGGPFEEIAQA 244

Query: 243 DIFINCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKPTV 302
           DIFINCIYLSKPI PFINY+LLNK  R+LRTVVDVSADTTNPHNP+PIY IATVF+ PTV
Sbjct: 245 DIFINCIYLSKPIAPFINYELLNKKNRKLRTVVDVSADTTNPHNPVPIYEIATVFSSPTV 304

Query: 303 LVPTTAGPKLSVISIDHLPSLLPREASEFFARDLLPSLEQLPERYTAPVWVKAEKLFNRH 362
           LVPTTAGPKLSVISIDHLPSLLPRE+SEFFA DLLPSLEQLPERYTAPVWVKA+KLF++H
Sbjct: 305 LVPTTAGPKLSVISIDHLPSLLPRESSEFFAHDLLPSLEQLPERYTAPVWVKAKKLFDKH 364

Query: 363 CARVHRSSKL 372
           CAR+ R SKL
Sbjct: 365 CARLDRQSKL 374

>KLLA0E07964g complement(718820..719938) similar to sp|P38998
           Saccharomyces cerevisiae YIR034c LYS1 saccharopine
           dehydrogenase singleton, start by similarity
          Length = 372

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/372 (75%), Positives = 316/372 (84%)

Query: 1   MTVTLHLRAETKPLEARAALTPTTVKQLIAKGFKIYVEDSPQSIFHIDEYKKAGAIIVPA 60
           M+VTLHLRAETKPLEAR ALTPTT K+L+ KGFKI+VE+S QS F I+EYKK GA IVP 
Sbjct: 1   MSVTLHLRAETKPLEARTALTPTTTKKLLDKGFKIFVEESSQSAFDIEEYKKVGATIVPE 60

Query: 61  GSWISAPRDRIIIGLKEMPETDKFPLVHEHIQFAHCYKNQAGWKDVLTRFINGNGTLYDL 120
           GSW +APRDRIIIGLKEMPETD FPLVHEHIQFAHCYKNQAGW+DVL+RF  GNG LYDL
Sbjct: 61  GSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWEDVLSRFKRGNGVLYDL 120

Query: 121 EFLEDDEGRRVXXXXXXXXXXXXXLGLRDWAFKQTHSDAEDLPAVSPYPNEKALIKDISI 180
           EFLE+D+GRRV             +G+RDWAFKQTHSD+E+L A+ PY NE+A+IKD+  
Sbjct: 121 EFLENDQGRRVAAFGFYAGFAGAAVGIRDWAFKQTHSDSENLGAIEPYENEEAMIKDVRR 180

Query: 181 EYKNALKKGAKKPTVLIIGALGRCGSGAIDLLRKIGLPEENIIKWDMKETARGGPFPEIA 240
           +Y+ ALK+GA+KP VLIIGALGRCGSGA DLLRK GLPEENIIKWDMKETARGGPF EIA
Sbjct: 181 DYQLALKRGARKPKVLIIGALGRCGSGAADLLRKCGLPEENIIKWDMKETARGGPFQEIA 240

Query: 241 QADIFINCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300
            AD+FINCIYLSKPIPPFIN +LLNK TRRLRTVVDVSADTTNPHNP+PIY I T F+ P
Sbjct: 241 DADVFINCIYLSKPIPPFINNELLNKPTRRLRTVVDVSADTTNPHNPVPIYTINTTFDAP 300

Query: 301 TVLVPTTAGPKLSVISIDHLPSLLPREASEFFARDLLPSLEQLPERYTAPVWVKAEKLFN 360
           TV VPTT GPKLSV SIDHLPSLLP+EASE F+RDLLPSLEQLP+R TA VWVKA  L+ 
Sbjct: 301 TVQVPTTVGPKLSVCSIDHLPSLLPKEASESFSRDLLPSLEQLPQRATASVWVKARNLYE 360

Query: 361 RHCARVHRSSKL 372
           +  A+V R+SKL
Sbjct: 361 KFAAKVGRTSKL 372

>Kwal_14.880
          Length = 373

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/370 (76%), Positives = 321/370 (86%)

Query: 3   VTLHLRAETKPLEARAALTPTTVKQLIAKGFKIYVEDSPQSIFHIDEYKKAGAIIVPAGS 62
           V LHLRAETK  EARAALTPTTV++LIAKGFKIYVE+S QS F I+EYKKAGA IVP GS
Sbjct: 4   VILHLRAETKDQEARAALTPTTVQKLIAKGFKIYVEESEQSTFSIEEYKKAGAEIVPKGS 63

Query: 63  WISAPRDRIIIGLKEMPETDKFPLVHEHIQFAHCYKNQAGWKDVLTRFINGNGTLYDLEF 122
           W++AP+DRIIIGLKE+PE D FPLVHEHIQFAHCYKNQAGW+DVL RF  G+GTLYDLEF
Sbjct: 64  WVNAPKDRIIIGLKELPEEDTFPLVHEHIQFAHCYKNQAGWQDVLGRFKRGHGTLYDLEF 123

Query: 123 LEDDEGRRVXXXXXXXXXXXXXLGLRDWAFKQTHSDAEDLPAVSPYPNEKALIKDISIEY 182
           LE+D+GRRV             LGL+DWAFKQTHSD+EDLP V+P+PNE  L+KD+  +Y
Sbjct: 124 LENDQGRRVAAFGFYAGFAGAALGLKDWAFKQTHSDSEDLPGVTPFPNEHELVKDVVGDY 183

Query: 183 KNALKKGAKKPTVLIIGALGRCGSGAIDLLRKIGLPEENIIKWDMKETARGGPFPEIAQA 242
           K ALKKGAKKPTVLIIGALGRCGSGA+D+LRK G+PE+NIIKWDMKETARGGPF EIAQA
Sbjct: 184 KAALKKGAKKPTVLIIGALGRCGSGAVDMLRKAGIPEKNIIKWDMKETARGGPFQEIAQA 243

Query: 243 DIFINCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKPTV 302
           DIFINCIYLSKPI PFIN  LLN  +RRLR++VDVSADTTN HNP+P+Y IATVF+KPTV
Sbjct: 244 DIFINCIYLSKPIAPFINSTLLNSKSRRLRSIVDVSADTTNVHNPVPVYTIATVFSKPTV 303

Query: 303 LVPTTAGPKLSVISIDHLPSLLPREASEFFARDLLPSLEQLPERYTAPVWVKAEKLFNRH 362
           LVPTTAGPKLSVISIDHLPSLLPRE+SEFFA DLLPSLEQLP R  APVW +A+ L+++H
Sbjct: 304 LVPTTAGPKLSVISIDHLPSLLPRESSEFFAHDLLPSLEQLPYRDQAPVWARAKALYHKH 363

Query: 363 CARVHRSSKL 372
           CAR+ R SK+
Sbjct: 364 CARLDRQSKI 373

>ACR167C [1214] [Homologous to ScYIR034C (LYS1) - SH]
           (649155..650273) [1119 bp, 372 aa]
          Length = 372

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/372 (68%), Positives = 309/372 (83%)

Query: 1   MTVTLHLRAETKPLEARAALTPTTVKQLIAKGFKIYVEDSPQSIFHIDEYKKAGAIIVPA 60
           M+  LHLRAETKP+EARAALTPTTV+ L++ GFKIYVE+S QS+F   EY  AGA +V  
Sbjct: 1   MSAILHLRAETKPMEARAALTPTTVRTLVSHGFKIYVEESAQSVFEAAEYAAAGAEVVAT 60

Query: 61  GSWISAPRDRIIIGLKEMPETDKFPLVHEHIQFAHCYKNQAGWKDVLTRFINGNGTLYDL 120
           GSW  APR+RII+GLKE+PE D FPL H HIQFAHCYKNQ+GW++VL RF +G G LYDL
Sbjct: 61  GSWRGAPRERIIVGLKELPEEDTFPLEHTHIQFAHCYKNQSGWREVLGRFQSGGGLLYDL 120

Query: 121 EFLEDDEGRRVXXXXXXXXXXXXXLGLRDWAFKQTHSDAEDLPAVSPYPNEKALIKDISI 180
           EFL+DD GRRV             LGLRDWA+KQTH+DAEDLPAV+PY NE+AL+ +++ 
Sbjct: 121 EFLQDDRGRRVAAFGYYAGFAGAALGLRDWAWKQTHTDAEDLPAVAPYENEQALVSEVAA 180

Query: 181 EYKNALKKGAKKPTVLIIGALGRCGSGAIDLLRKIGLPEENIIKWDMKETARGGPFPEIA 240
             + A KKGA+KP VL+IGALGRCGSGA++LLR+ GL +++II+WD+ ETARGGPFPEIA
Sbjct: 181 ACEEAYKKGARKPRVLVIGALGRCGSGAVELLRQCGLHDKHIIRWDIAETARGGPFPEIA 240

Query: 241 QADIFINCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300
            ADIFINCIYLS+PI PFIN +LL++  R+LRT+VDVSADTTNPHNP+P+YN+ATVF+ P
Sbjct: 241 AADIFINCIYLSQPIAPFINMELLDRPDRKLRTIVDVSADTTNPHNPVPVYNVATVFSSP 300

Query: 301 TVLVPTTAGPKLSVISIDHLPSLLPREASEFFARDLLPSLEQLPERYTAPVWVKAEKLFN 360
           TV+VPT+ GPKLSVISIDHLPSLLPREASE FA DLLPSL QLPER TAPVW++A++LF 
Sbjct: 301 TVVVPTSQGPKLSVISIDHLPSLLPREASEAFASDLLPSLLQLPERDTAPVWLRAKELFQ 360

Query: 361 RHCARVHRSSKL 372
           +HC R+ + ++L
Sbjct: 361 QHCERLSKEARL 372

>Scas_593.11
          Length = 960

 Score = 35.0 bits (79), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 64/145 (44%), Gaps = 14/145 (9%)

Query: 187 KKGAKKPTVLIIG-ALGRCGSGAIDLLRKIGLPEENIIKWDMK-ETARGGPFPEIAQADI 244
           K G KK +V+++     +   GA+D L  +G+ +E++ K  +  +  +   F    Q  I
Sbjct: 326 KDGWKKVSVILVSDGRAKVNQGALDYLAALGVYQEDMAKASVNGDPVKAHVFELTTQVSI 385

Query: 245 FINCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKPTVLV 304
             +  Y+SK I P      L ++ ++            N H  +  +N      +PTV+ 
Sbjct: 386 NSDLDYVSKDIVPVQLVFCLKEENKK----------KINSHRWL--FNAFCPVLQPTVVC 433

Query: 305 PTTAGPKLSVISIDHLPSLLPREAS 329
               G +L+  +I HL  +  R+++
Sbjct: 434 LVDVGTRLNHTAIYHLWKVFDRDSN 458

>Kwal_23.5184
          Length = 928

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 60/143 (41%), Gaps = 14/143 (9%)

Query: 189 GAKKPTVLIIG-ALGRCGSGAIDLLRKIGLPEENIIKWDMK-ETARGGPFPEIAQADIFI 246
           G KK  V+I+         G++D L  +G+ +E++ K  +  E  +   F    Q  I  
Sbjct: 296 GWKKIQVIIVSDGRNNINKGSLDYLSALGVYQEDMAKSTVNGEAVKSHIFELTTQVSIDG 355

Query: 247 NCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKPTVLVPT 306
           N  Y+SK I P      L ++ ++            N H  +  +N       PTV+V  
Sbjct: 356 NLDYVSKEIVPVQVVFCLKEENQK----------KINSHRWL--FNAFCPILDPTVIVLV 403

Query: 307 TAGPKLSVISIDHLPSLLPREAS 329
             G +L+  +I HL     R+++
Sbjct: 404 DVGTRLNDTAIYHLWKAFDRDSN 426

>Scas_457.2
          Length = 956

 Score = 29.6 bits (65), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 7/41 (17%)

Query: 206 SGAIDLLRKIGLPEENIIK-------WDMKETARGGPFPEI 239
           S A DL RK+G+PE++I+        W+M +    GP  EI
Sbjct: 154 SEAQDLWRKVGVPEDHILPGNAKDNFWEMGDQGPCGPCSEI 194

>CAGL0E05390g complement(524480..527350) highly similar to sp|P40825
           Saccharomyces cerevisiae YOR335c ALA1 alanyl-tRNA
           synthetase, start by similarity
          Length = 956

 Score = 29.3 bits (64), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 7/39 (17%)

Query: 208 AIDLLRKIGLPEENIIK-------WDMKETARGGPFPEI 239
           A+DL +K+G+PE++I+        W+M +    GP  EI
Sbjct: 156 ALDLWKKVGVPEDHILPGNAKDNFWEMGDQGPCGPCSEI 194

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,515,226
Number of extensions: 553200
Number of successful extensions: 1245
Number of sequences better than 10.0: 13
Number of HSP's gapped: 1258
Number of HSP's successfully gapped: 13
Length of query: 372
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 269
Effective length of database: 13,030,455
Effective search space: 3505192395
Effective search space used: 3505192395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)