Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_626.683983944580.0
Sklu_2397.884886924370.0
YML099C (ARG81)88089223360.0
KLLA0D10197g85686822300.0
Kwal_27.968884188221870.0
AAL175W88388420250.0
CAGL0H06875g7025798451e-101
YBR240C (THI2)450561436e-09
KLLA0F10373g348441408e-09
Scas_597.4475771364e-08
Kwal_14.1631443491302e-07
Sklu_1373.2608531275e-07
Sklu_2064.2922901222e-06
AFL033W382961193e-06
Kwal_56.24566755451179e-06
Scas_596.4701411152e-05
CAGL0C01199g922481142e-05
CAGL0E05434g816551142e-05
Kwal_26.6732676371123e-05
YDR421W (ARO80)950531123e-05
Scas_663.12944471106e-05
KLLA0F20680g787391106e-05
KLLA0A04169g775451106e-05
Scas_717.33904561106e-05
YDR207C (UME6)836331098e-05
AGL099C747381099e-05
YLR228C (ECM22)814591099e-05
CAGL0F05357g601411089e-05
Scas_674.12*909391099e-05
KLLA0C17050g955471099e-05
AGL091W866481099e-05
Sklu_2434.10983521099e-05
CAGL0F07865g844951081e-04
YDR213W (UPC2)913561081e-04
Scas_679.26775481081e-04
Kwal_26.7095838391071e-04
Kwal_23.3122788481062e-04
Scas_573.41478531062e-04
AGR061C612371052e-04
KLLA0A10329g639451052e-04
Kwal_55.20722827401052e-04
CAGL0B03421g1355521053e-04
YMR280C (CAT8)1433371053e-04
KLLA0D00484g1004431053e-04
AFR117C1152551053e-04
KLLA0F09559g658481043e-04
YLR256W (HAP1)1502561044e-04
KLLA0D01452g1445291035e-04
CAGL0A00451g11071201026e-04
CAGL0K05841g1372461026e-04
Kwal_23.3178611431016e-04
KLLA0F22880g1164541026e-04
KLLA0D11286g678461017e-04
YLR278C1341591027e-04
ADR405C807511017e-04
KLLA0C16489g728601017e-04
KLLA0F22990g1253521018e-04
ABL121C1285371000.001
ADR199C944391000.001
Scas_696.441164331000.001
KLLA0F19602g60342980.001
KLLA0F00572g59735980.001
Scas_721.9486947990.001
ABL099W80047980.001
KLLA0A03421g88079980.001
YAL051W (OAF1)106247980.002
AGL206C73539980.002
Kwal_26.680594441980.002
Kwal_23.652959838970.002
KLLA0D05038g67342970.002
CAGL0M12298g99443980.002
Kwal_27.10232120929970.002
Scas_556.6102241970.002
Kwal_23.290588155960.003
CAGL0J07150g102241970.003
ADR404C87534960.003
Kwal_14.2619116738960.003
KLLA0F14322g71752960.003
Kwal_34.1575162841960.003
CAGL0L04400g98746960.003
Kwal_23.642573537950.003
ACL058W81746950.003
Scas_550.5*83241950.004
Sklu_2296.691940950.004
Scas_590.2117230950.004
AFR096W85233950.004
KLLA0A01804g94562950.004
Sklu_2376.692231940.004
ADR403C97042940.005
Scas_711.3193229940.005
KLLA0D10153g65548930.006
YLR014C (PPR1)90438930.007
Kwal_55.2067425245900.007
Kwal_14.163645674920.007
Scas_521.289038920.008
CAGL0H01507g79435920.009
YOR172W (YRM1)78642910.010
Sklu_2191.271837910.011
Sklu_1622.277839910.012
Scas_699.793543910.012
KLLA0C04620g126938910.012
KLLA0F02387g72737900.012
Sklu_2321.390650910.012
YCR106W (RDS1)83240900.013
KLLA0D12650g65150900.013
AGL233C87236900.014
YOR363C (PIP2)99641900.015
KLLA0A03443g97542900.015
Scas_588.1183572890.017
Kwal_56.2305877545890.017
YIL130W96448890.019
YHR178W (STB5)74341890.020
AFR171W61238890.020
Scas_720.5889043880.023
KLLA0E19701g68144880.023
Scas_630.1470152880.023
Kwal_47.1723394839880.023
Kwal_47.1768185446880.024
ACR028C60148880.025
AER370W80148880.026
CAGL0G09757g142328880.026
Scas_662.890643870.030
AER183C87944870.031
Scas_661.2374141870.033
YLR266C (PDR8)70132870.033
KLLA0A06039g65736860.036
YOR162C (YRR1)81045870.037
YKL222C70538860.038
Scas_526.3110929870.039
KLLA0A09119g108267860.040
CAGL0I07755g105342860.040
Kwal_56.2467064336860.044
Sklu_2301.151738850.045
CAGL0K11902g83136860.045
YBL066C (SEF1)105736860.045
Scas_625.5114155860.049
YGL013C (PDR1)106882850.052
YBL005W (PDR3)976122850.052
KLLA0C10923g77541850.053
YDR034C (LYS14)79036850.053
CAGL0G08844g84736850.056
Sklu_1993.282344850.059
Kwal_27.10852104697850.060
KLLA0F04609g91636850.061
Scas_657.385633850.062
Sklu_1973.177735840.065
Scas_702.7111348850.067
ADR365W70155840.068
AAL057C80974840.068
Kwal_23.475481236840.074
Scas_659.1075741840.074
KLLA0F04213g76845840.075
CAGL0M03025g125429840.076
YDR303C (RSC3)88544840.081
AGL361C69641830.084
KLLA0C01023g63651830.085
Scas_709.5175939830.099
KLLA0F18084g86029830.100
Scas_715.3111536830.10
YPL248C (GAL4)88143820.11
Scas_449.163637820.12
KLLA0E20405g113889820.12
AGR280C110628820.13
YJL089W (SIP4)82933820.13
Sklu_2411.1168736820.13
YJL206C75848820.13
Kwal_26.810997038820.13
KLLA0C03201g65042820.14
AFL031W51738810.15
AGR369W105136810.15
YMR019W (STB4)94951810.16
CAGL0L03377g120933810.16
CAGL0D03850g83438810.16
Scas_542.890242810.17
Scas_669.863735800.18
KLLA0E02618g110955800.22
KLLA0D00396g36136790.23
YLL054C76929790.28
Scas_688.1776931790.28
KLLA0F25630g100755790.28
KLLA0E14036g67842790.28
YDR520C77242790.28
Kwal_47.1808974530790.29
YPR196W47029780.29
CAGL0F03025g92854790.30
AFL160C64849780.33
YKL038W (RGT1)117050790.34
ACL195C10944720.36
YHR056C (RSC30)88331780.37
CAGL0D02904g88733780.37
CAGL0L01903g128773780.39
Kwal_14.81956832770.43
CAGL0H00396g94032770.45
KLLA0F10835g75643770.49
CAGL0F07755g61138770.52
Sklu_2268.287535770.53
YGR288W (MAL13)47329760.55
Scas_685.2277742760.61
KLLA0A02585g37047750.63
CAGL0L04576g86521760.64
Kwal_47.1750692438760.65
KLLA0C19228g59129760.65
YOR337W (TEA1)75937760.66
KLLA0F02750g114847760.71
Scas_691.3290639760.76
YNR063W60734750.79
Kwal_55.2188488243750.79
Kwal_33.1311877949750.88
Kwal_26.744871450750.90
KLLA0D10593g92542750.93
KLLA0F10417g50759740.99
KLLA0E18194g86539741.1
KLLA0C14212g104036741.2
Scas_516.960157731.2
Sklu_2023.365828731.3
YBR297W (MAL33)46829731.3
CAGL0M10043g65870731.3
Kwal_23.351457931731.4
Kwal_33.1393479738721.7
KLLA0D12672g86529721.8
CAGL0K06985g59643721.9
Scas_638.14104372722.0
KLLA0D09977g63433722.0
Kwal_26.666457951712.2
KLLA0F13904g57928712.6
Kwal_23.437069229703.2
Scas_700.4040734693.4
Scas_680.2573829703.8
YBR239C52949694.5
Kwal_23.653755243684.7
Scas_645.2242777684.8
Scas_709.4237487684.9
Scas_702.7d97842685.3
Kwal_26.701465437676.7
Scas_710.1043730668.0
AER291C66336669.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_626.6
         (839 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_626.6                                                           1721   0.0  
Sklu_2397.8 YML099C, Contig c2397 9784-12330                          943   0.0  
YML099C (ARG81) [3872] chr13 complement(74398..77040) Component ...   904   0.0  
KLLA0D10197g complement(861726..864296) similar to sp|P05085 Sac...   863   0.0  
Kwal_27.9688                                                          847   0.0  
AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH] complement(...   784   0.0  
CAGL0H06875g complement(682518..684626) some similarities with s...   330   e-101
YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger...    60   6e-09
KLLA0F10373g 957948..958994 some similarities with sp|P38141 Sac...    59   8e-09
Scas_597.4                                                             57   4e-08
Kwal_14.1631                                                           55   2e-07
Sklu_1373.2 YDR207C, Contig c1373 1069-2895                            54   5e-07
Sklu_2064.2 , Contig c2064 873-3641                                    52   2e-06
AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH] complement(...    50   3e-06
Kwal_56.24566                                                          50   9e-06
Scas_596.4                                                             49   2e-05
CAGL0C01199g complement(121944..124712) similar to tr|Q12151 Sac...    49   2e-05
CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces c...    49   2e-05
Kwal_26.6732                                                           48   3e-05
YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive transcri...    48   3e-05
Scas_663.12                                                            47   6e-05
KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001 Saccha...    47   6e-05
KLLA0A04169g complement(376273..378600) similar to sgd|S0004218 ...    47   6e-05
Scas_717.33                                                            47   6e-05
YDR207C (UME6) [1046] chr4 complement(865005..867515) Global tra...    47   8e-05
AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH] (516587..51...    47   9e-05
YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol r...    47   9e-05
CAGL0F05357g 541830..543635 some similarities with sp|P39001 Sac...    46   9e-05
Scas_674.12*                                                           47   9e-05
KLLA0C17050g 1490472..1493339 some similarities with ca|CA3454|I...    47   9e-05
AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W ...    47   9e-05
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         47   9e-05
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    46   1e-04
YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory el...    46   1e-04
Scas_679.26                                                            46   1e-04
Kwal_26.7095                                                           46   1e-04
Kwal_23.3122                                                           45   2e-04
Scas_573.4                                                             45   2e-04
AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH] (831058..83...    45   2e-04
KLLA0A10329g 903873..905792 some similarities with ca|CA6113|IPF...    45   2e-04
Kwal_55.20722                                                          45   2e-04
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    45   3e-04
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    45   3e-04
KLLA0D00484g 44879..47893 no similarity, hypothetical start            45   3e-04
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    45   3e-04
KLLA0F09559g complement(876719..878695) some similarities with s...    45   3e-04
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    45   4e-04
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    44   5e-04
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    44   6e-04
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    44   6e-04
Kwal_23.3178                                                           44   6e-04
KLLA0F22880g 2123577..2127071 some similarities with ca|CA3639|I...    44   6e-04
KLLA0D11286g complement(964642..966678) no similarity, hypotheti...    44   7e-04
YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protei...    44   7e-04
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    44   7e-04
KLLA0C16489g 1444456..1446642 some similarities with ca|CA2184|I...    44   7e-04
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    44   8e-04
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    43   0.001
ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH] (1048530.....    43   0.001
Scas_696.44                                                            43   0.001
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    42   0.001
KLLA0F00572g complement(42710..44503) some similarities with ca|...    42   0.001
Scas_721.94                                                            43   0.001
ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH] complement(...    42   0.001
KLLA0A03421g 308414..311056 weakly similar to sp|P39720 Saccharo...    42   0.001
YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor req...    42   0.002
AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp, ...    42   0.002
Kwal_26.6805                                                           42   0.002
Kwal_23.6529                                                           42   0.002
KLLA0D05038g 433653..435674 weakly similar to sp|P40971 Saccharo...    42   0.002
CAGL0M12298g complement(1225753..1228737) similar to sp|P39720 S...    42   0.002
Kwal_27.10232                                                          42   0.002
Scas_556.6                                                             42   0.002
Kwal_23.2905                                                           42   0.003
CAGL0J07150g complement(686734..689802) similar to sp|P39720 Sac...    42   0.003
ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    42   0.003
Kwal_14.2619                                                           42   0.003
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    42   0.003
Kwal_34.15751                                                          42   0.003
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    42   0.003
Kwal_23.6425                                                           41   0.003
ACL058W [991] [Homologous to NOHBY] complement(261723..264176) [...    41   0.003
Scas_550.5*                                                            41   0.004
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       41   0.004
Scas_590.2                                                             41   0.004
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    41   0.004
KLLA0A01804g complement(159689..162526) similar to sgd|S0002829 ...    41   0.004
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              41   0.004
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    41   0.005
Scas_711.31                                                            41   0.005
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    40   0.006
YLR014C (PPR1) [3432] chr12 complement(172267..174981) Transcrip...    40   0.007
Kwal_55.20674                                                          39   0.007
Kwal_14.1636                                                           40   0.007
Scas_521.2                                                             40   0.008
CAGL0H01507g complement(147689..150073) similar to sp|Q06639 Sac...    40   0.009
YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with simila...    40   0.010
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         40   0.011
Sklu_1622.2 YDR034C, Contig c1622 1522-3858                            40   0.012
Scas_699.7                                                             40   0.012
KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05...    40   0.012
KLLA0F02387g complement(213669..215852) similar to sp|P47988 Sac...    39   0.012
Sklu_2321.3 YLR014C, Contig c2321 8747-11467                           40   0.012
YCR106W (RDS1) [627] chr3 (310954..313452) Protein with similari...    39   0.013
KLLA0D12650g complement(1073580..1075535) weakly similar to ca|C...    39   0.013
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    39   0.014
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    39   0.015
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    39   0.015
Scas_588.11                                                            39   0.017
Kwal_56.23058                                                          39   0.017
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    39   0.019
YHR178W (STB5) [2464] chr8 (459297..461528) Probable transcripti...    39   0.020
AFR171W [3363] [Homologous to NOHBY] complement(752592..754430) ...    39   0.020
Scas_720.58                                                            39   0.023
KLLA0E19701g complement(1739869..1741914) some similarities with...    39   0.023
Scas_630.14                                                            39   0.023
Kwal_47.17233                                                          39   0.023
Kwal_47.17681                                                          39   0.024
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    39   0.025
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    39   0.026
CAGL0G09757g 930351..934622 some similarities with sp|Q05854 Sac...    39   0.026
Scas_662.8                                                             38   0.030
AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH] (975879..9...    38   0.031
Scas_661.23                                                            38   0.033
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    38   0.033
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    38   0.036
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    38   0.037
YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein wi...    38   0.038
Scas_526.3                                                             38   0.039
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    38   0.040
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    38   0.040
Kwal_56.24670                                                          38   0.044
Sklu_2301.1 , Contig c2301 1246-2795 reverse complement                37   0.045
CAGL0K11902g complement(1148381..1150876) similar to sp|P40971 S...    38   0.045
YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with...    38   0.045
Scas_625.5                                                             38   0.049
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    37   0.052
YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger transcrip...    37   0.052
KLLA0C10923g complement(939148..941475) similar to sp|P07272 Sac...    37   0.053
YDR034C (LYS14) [885] chr4 complement(509732..512104) Transcript...    37   0.053
CAGL0G08844g complement(846590..849133) similar to sp|P40467 Sac...    37   0.056
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         37   0.059
Kwal_27.10852                                                          37   0.060
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    37   0.061
Scas_657.3                                                             37   0.062
Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement          37   0.065
Scas_702.7                                                             37   0.067
ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH] complement(...    37   0.068
AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C (R...    37   0.068
Kwal_23.4754                                                           37   0.074
Scas_659.10                                                            37   0.074
KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces c...    37   0.075
CAGL0M03025g complement(341849..345613) similar to sp|P39113 Sac...    37   0.076
YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Componen...    37   0.081
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    37   0.084
KLLA0C01023g 76863..78773 similar to sgd|S0002928 Saccharomyces ...    37   0.085
Scas_709.51                                                            37   0.099
KLLA0F18084g complement(1652031..1654613) no similarity, hypothe...    37   0.100
Scas_715.3                                                             37   0.10 
YPL248C (GAL4) [5202] chr16 complement(79711..82356) Transcripti...    36   0.11 
Scas_449.1                                                             36   0.12 
KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA K...    36   0.12 
AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)...    36   0.13 
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    36   0.13 
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement      36   0.13 
YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein ...    36   0.13 
Kwal_26.8109                                                           36   0.13 
KLLA0C03201g complement(286973..288925) similar to sp|P39529 Sac...    36   0.14 
AFL031W [3162] [Homologous to ScYBR239C - SH] complement(376161....    36   0.15 
AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH] complement(...    36   0.15 
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...    36   0.16 
CAGL0L03377g complement(382932..386561) some similarities with s...    36   0.16 
CAGL0D03850g 384689..387193 weakly similar to sp|Q06639 Saccharo...    36   0.16 
Scas_542.8                                                             36   0.17 
Scas_669.8                                                             35   0.18 
KLLA0E02618g 244696..248025 no similarity, hypothetical start          35   0.22 
KLLA0D00396g complement(36277..37362) some similarities with ca|...    35   0.23 
YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein ...    35   0.28 
Scas_688.17                                                            35   0.28 
KLLA0F25630g 2378464..2381487 some similarities with sp|P32862 S...    35   0.28 
KLLA0E14036g complement(1239566..1241602) some similarities with...    35   0.28 
YDR520C (YDR520C) [1333] chr4 complement(1481073..1483391) Prote...    35   0.28 
Kwal_47.18089                                                          35   0.29 
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    35   0.29 
CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces c...    35   0.30 
AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH] (130842..13...    35   0.33 
YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in...    35   0.34 
ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109 aa]    32   0.36 
YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component...    35   0.37 
CAGL0D02904g complement(302952..305615) similar to sp|P07272 Sac...    35   0.37 
CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces c...    35   0.39 
Kwal_14.819                                                            34   0.43 
CAGL0H00396g complement(37005..39827) similar to sp|P08638 Sacch...    34   0.45 
KLLA0F10835g 997512..999782 no similarity, hypothetical start          34   0.49 
CAGL0F07755g complement(755947..757782) similar to sp|P40969 Sac...    34   0.52 
Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement         34   0.53 
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    34   0.55 
Scas_685.22                                                            34   0.61 
KLLA0A02585g complement(226562..227674) some similarities with c...    33   0.63 
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    34   0.64 
Kwal_47.17506                                                          34   0.65 
KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces...    34   0.65 
YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activa...    34   0.66 
KLLA0F02750g complement(250368..253814) some similarities with s...    34   0.71 
Scas_691.32                                                            34   0.76 
YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with sim...    33   0.79 
Kwal_55.21884                                                          33   0.79 
Kwal_33.13118                                                          33   0.88 
Kwal_26.7448                                                           33   0.90 
KLLA0D10593g complement(900326..903103) similar to sp|P08638 Sac...    33   0.93 
KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces c...    33   0.99 
KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces...    33   1.1  
KLLA0C14212g complement(1229219..1232341) some similarities with...    33   1.2  
Scas_516.9                                                             33   1.2  
Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement         33   1.3  
YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation...    33   1.3  
CAGL0M10043g complement(999113..1001089) similar to tr|Q04093 Sa...    33   1.3  
Kwal_23.3514                                                           33   1.4  
Kwal_33.13934                                                          32   1.7  
KLLA0D12672g complement(1076011..1078608) gi|125903|sp|P08657|LA...    32   1.8  
CAGL0K06985g 681115..682905 similar to sp|P38140 Saccharomyces c...    32   1.9  
Scas_638.14                                                            32   2.0  
KLLA0D09977g complement(841852..843756) weakly similar to sp|P40...    32   2.0  
Kwal_26.6664                                                           32   2.2  
KLLA0F13904g complement(1287758..1289497) some similarities with...    32   2.6  
Kwal_23.4370                                                           32   3.2  
Scas_700.40                                                            31   3.4  
Scas_680.25                                                            32   3.8  
YBR239C (YBR239C) [418] chr2 complement(698311..699900) Protein ...    31   4.5  
Kwal_23.6537                                                           31   4.7  
Scas_645.22                                                            31   4.8  
Scas_709.42                                                            31   4.9  
Scas_702.7d                                                            31   5.3  
Kwal_26.7014                                                           30   6.7  
Scas_710.10                                                            30   8.0  
AER291C [2793] [Homologous to ScYHR178W (STB5) - SH] (1172383..1...    30   9.7  

>Scas_626.6
          Length = 839

 Score = 1721 bits (4458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 827/839 (98%), Positives = 827/839 (98%)

Query: 1   MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKL 60
           MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKL
Sbjct: 1   MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKL 60

Query: 61  VKFDPYGVQLPPSPNGNSASNEEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHAPPTEK 120
           VKFDPYGVQLPPSPNGNSASNEEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHAPPTEK
Sbjct: 61  VKFDPYGVQLPPSPNGNSASNEEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHAPPTEK 120

Query: 121 IADGKTWIIKKFGVFRGTDKIDKQYAPRKKRRKPAPSTVSKRKTLKTGNKLSAKESAGKP 180
           IADGKTWIIKKFGVFRGTDKIDKQYAPRKKRRKPAPSTVSKRKTLKTGNKLSAKESAGKP
Sbjct: 121 IADGKTWIIKKFGVFRGTDKIDKQYAPRKKRRKPAPSTVSKRKTLKTGNKLSAKESAGKP 180

Query: 181 INIEDSPSKPMSNHQSPVNNIPSFVDFDLAMNNVPSYEWISSELRDDVLLSAFAIQGASI 240
           INIEDSPSKPMSNHQSPVNNIPSFVDFDLAMNNVPSYEWISSELRDDVLLSAFAIQGASI
Sbjct: 181 INIEDSPSKPMSNHQSPVNNIPSFVDFDLAMNNVPSYEWISSELRDDVLLSAFAIQGASI 240

Query: 241 NDVPDSTTSAKTSINQGTVSTGLFSNIPIDGTNSIGDDTQTSPNNDYTIQNALNLLFHNK 300
           NDVPDSTTSAKTSINQGTVSTGLFSNIPIDGTNSIGDDTQTSPNNDYTIQNALNLLFHNK
Sbjct: 241 NDVPDSTTSAKTSINQGTVSTGLFSNIPIDGTNSIGDDTQTSPNNDYTIQNALNLLFHNK 300

Query: 301 QTPTSPSTSKGMVKTLLDAPQSDSHMPRTIMEIINPSPLELEIFEALNKLNLSWNIPASG 360
           QTPTSPSTSKGMVKTLLDAPQSDSHMPRTIMEIINPSPLELEIFEALNKLNLSWNIPASG
Sbjct: 301 QTPTSPSTSKGMVKTLLDAPQSDSHMPRTIMEIINPSPLELEIFEALNKLNLSWNIPASG 360

Query: 361 VNVHGIGKFLLNYYLENVADLMTVVPLSRNPWKKLYFPRALQALGDLVGLGYTTXXXXXX 420
           VNVHGIGKFLLNYYLENVADLMTVVPLSRNPWKKLYFPRALQALGDLVGLGYTT      
Sbjct: 361 VNVHGIGKFLLNYYLENVADLMTVVPLSRNPWKKLYFPRALQALGDLVGLGYTTNSRNSL 420

Query: 421 XXXXXXVSCFNLKSKFEKNSKEYNYFLNLGIELRKQASNFLNICLNSTVTVEKYKDVLTA 480
                 VSCFNLKSKFEKNSKEYNYFLNLGIELRKQASNFLNICLNSTVTVEKYKDVLTA
Sbjct: 421 LNALLAVSCFNLKSKFEKNSKEYNYFLNLGIELRKQASNFLNICLNSTVTVEKYKDVLTA 480

Query: 481 ILSMNSIDVVWGTMEDCQRHLTICEDFVEKRMNSRPHISGKARTLHRIFSFLKLIQDSTA 540
           ILSMNSIDVVWGTMEDCQRHLTICEDFVEKRMNSRPHISGKARTLHRIFSFLKLIQDSTA
Sbjct: 481 ILSMNSIDVVWGTMEDCQRHLTICEDFVEKRMNSRPHISGKARTLHRIFSFLKLIQDSTA 540

Query: 541 LDKVRDKEIVIYGKKDKPDKNKVADPFVKDTSNNGGQFRESLNKLNGKIQIEYIRNDDSN 600
           LDKVRDKEIVIYGKKDKPDKNKVADPFVKDTSNNGGQFRESLNKLNGKIQIEYIRNDDSN
Sbjct: 541 LDKVRDKEIVIYGKKDKPDKNKVADPFVKDTSNNGGQFRESLNKLNGKIQIEYIRNDDSN 600

Query: 601 DNNEQSASSSPPMFANIASESYYKPGQKSESDYDILSTDALYGLPNSLILLFSDCVRIVR 660
           DNNEQSASSSPPMFANIASESYYKPGQKSESDYDILSTDALYGLPNSLILLFSDCVRIVR
Sbjct: 601 DNNEQSASSSPPMFANIASESYYKPGQKSESDYDILSTDALYGLPNSLILLFSDCVRIVR 660

Query: 661 HNEYYNIKYLAVPREFTEICLNFEKRLLKWKPEWAFYKENTDEFIDDTIEGVYHHTMSFY 720
           HNEYYNIKYLAVPREFTEICLNFEKRLLKWKPEWAFYKENTDEFIDDTIEGVYHHTMSFY
Sbjct: 661 HNEYYNIKYLAVPREFTEICLNFEKRLLKWKPEWAFYKENTDEFIDDTIEGVYHHTMSFY 720

Query: 721 YGLVIYYFSMAKHLNNQFLQSYVEKVLLHLNKLTDLIDHKSVKIVPLMWQGFIAGCSSNM 780
           YGLVIYYFSMAKHLNNQFLQSYVEKVLLHLNKLTDLIDHKSVKIVPLMWQGFIAGCSSNM
Sbjct: 721 YGLVIYYFSMAKHLNNQFLQSYVEKVLLHLNKLTDLIDHKSVKIVPLMWQGFIAGCSSNM 780

Query: 781 QDLQQEFRKWAAKLAESGMGSYWGARQVMFEVWRRRMNDEPNDNWYSVYKDWQMNLMLS 839
           QDLQQEFRKWAAKLAESGMGSYWGARQVMFEVWRRRMNDEPNDNWYSVYKDWQMNLMLS
Sbjct: 781 QDLQQEFRKWAAKLAESGMGSYWGARQVMFEVWRRRMNDEPNDNWYSVYKDWQMNLMLS 839

>Sklu_2397.8 YML099C, Contig c2397 9784-12330
          Length = 848

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/869 (55%), Positives = 590/869 (67%), Gaps = 54/869 (6%)

Query: 3   KSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVK 62
           K  K+  ++PRRAKTFTGCWTCRSRKVKCDL RP C RC++SG ECGGYDIKLRWSK +K
Sbjct: 2   KVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIK 61

Query: 63  FDPYGVQLPPSPNGNSASNEEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHAPPTEKIA 122
           FD YGVQLPPSPN   + ++EPQ+QRRNI FV+Y++EY F+EDMDDELS LH+PP E IA
Sbjct: 62  FDRYGVQLPPSPNSPDSGSDEPQFQRRNIAFVRYQDEYEFYEDMDDELSALHSPPLENIA 121

Query: 123 DGKTWIIKKFGVFRGTDKIDKQYAPRKKRRKPAPSTVSKRKTLKTGNKLSAKESAGKPIN 182
             KTWII KFGVFRGT+K+ K+Y PRKKR++     VS  +     +KLS+  S     +
Sbjct: 122 GDKTWIINKFGVFRGTEKVKKKYVPRKKRKR----NVSYNRGGSVSSKLSSTTSVKSKGS 177

Query: 183 IEDSPSKPMSNHQSPVNNIPSFVDFDLAMNNVPSYEWISSELRDDVLLSAFAIQGASIND 242
              S S P               DFD +  N   +EWIS+ELRDD LLSA A+QG   N 
Sbjct: 178 SSISNSTPTD-----------LFDFDFSSMNFTGHEWISNELRDDALLSASAVQGIPTNT 226

Query: 243 VP------DSTTSAKTSIN----------------------QGTVSTGLFSNIPIDGTNS 274
                    + +SA    N                      QGTV+ G  S  PI   + 
Sbjct: 227 FTFPAGGNHTESSATADFNDAKNASGQHHGQHQHRNQQSNIQGTVNGGFASIDPIAEVSQ 286

Query: 275 IGDD-TQTSPNNDYTIQNALNLLFHN---KQTPTSPSTSKGMVKTLLDAPQSDSHMPRTI 330
           +    +  + + D  +Q       H     Q    PS         + AP  +S MP ++
Sbjct: 287 VYRLLSHRNEDKDKDVQEQQKHDTHQTIASQEDEFPSLVPLNNLISIHAPGGESRMPESV 346

Query: 331 MEIINPSPLELEIFEALNKLNLSWNIPASGVNVHGIGKFLLNYYLENVADLMTVVPLSRN 390
           +EI+     +  IF   +  N+   +P +G++VHG+ +FLLNYYL+NVADLMTVV L  N
Sbjct: 347 LEIVPSVVPDPSIFNLQSDKNILLRLPTTGLHVHGLARFLLNYYLQNVADLMTVVALPTN 406

Query: 391 PWKKLYFPRALQALGDLVGLGYTTXXXXXXXXXXXXVSCFNLKSKFEKNSKEYNYFLNLG 450
           PWK +YFPRAL+ALGDL G+GYT+            VSCFNL+SKF KN+ +  ++L LG
Sbjct: 407 PWKTIYFPRALKALGDLAGIGYTSNSRNSLLNALLAVSCFNLQSKFPKNTPQMRFYLYLG 466

Query: 451 IELRKQASNFLNICLNSTVTVEKYKDVLTAILSMNSIDVVWGTMEDCQRHLTICEDFVEK 510
           IE R QASNFL  CLNS+   E+YKD+LTAILSMNSIDVVWGTM DCQ HLTICEDFVE+
Sbjct: 467 IEFRSQASNFLKKCLNSSAHQERYKDILTAILSMNSIDVVWGTMADCQYHLTICEDFVEE 526

Query: 511 RMNSRPHISGKARTLHRIFSFLKLIQDSTALDKVRDKEIVIYGKKDKPDKNKVADPFVKD 570
           RM +RP IS KA+ LHRIFSFLKLIQDSTALDKVR+ EIVI   +D   +        +D
Sbjct: 527 RMKTRPKISEKAKALHRIFSFLKLIQDSTALDKVREGEIVIKDDEDVTGEQLQESQTGQD 586

Query: 571 TSNNGGQFRESLNKLNGKIQIEYIRNDDSNDNNEQSASSSPPMFANIASESYYKPGQKSE 630
            +   G+F+ESLN+ +GKI+IE+++   S      S+S S P+F NI SE+YY P + S 
Sbjct: 587 LNIADGEFKESLNQKDGKIRIEFVKQPQS------SSSGSTPIFTNITSETYYYP-KMST 639

Query: 631 SDYDILSTDALYGLPNSLILLFSDCVRIVRHNEYYNIKYLAVPREFTEICLNFEKRLLKW 690
           +  DILSTDALYGLPNSLIL FSDCVR+VRH EYY +  L  PR++ ++C  FEKRLL W
Sbjct: 640 TTQDILSTDALYGLPNSLILCFSDCVRLVRHREYYKMNKLPAPRKYAKLCTEFEKRLLNW 699

Query: 691 KPEWAFYKENTDEFIDDTIEGVYHHTMSFYYGLVIYYFSMAKHLNNQFLQSYVEKVLLHL 750
           K EW FYK +T EF++DTIEGVYHHTMSFYY L+IYYF+MA+ LNNQ LQSYVEKVL HL
Sbjct: 700 KSEWDFYKPHTREFVNDTIEGVYHHTMSFYYSLIIYYFTMARDLNNQLLQSYVEKVLSHL 759

Query: 751 NKLTDLIDHKSVKIVPLMWQGFIAGCSSNMQDLQQEFRKWAAKLAESGMGSYWGARQVMF 810
           N+L+DLIDHK+VK+VPL+WQGFIAGCSS   +LQ  F+KWAAKLA SGMGSYWGARQ+MF
Sbjct: 760 NQLSDLIDHKNVKVVPLIWQGFIAGCSSVDSNLQLSFKKWAAKLASSGMGSYWGARQIMF 819

Query: 811 EVWRRRMNDEPNDNWYSVYKDWQMNLMLS 839
           EVWRRRMN E NDNW SVYKDW+MNLMLS
Sbjct: 820 EVWRRRMNGEENDNWCSVYKDWEMNLMLS 848

>YML099C (ARG81) [3872] chr13 complement(74398..77040) Component of
           the ARGR regulatory complex, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2643 bp, 880 aa]
          Length = 880

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/892 (53%), Positives = 595/892 (66%), Gaps = 65/892 (7%)

Query: 1   MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKL 60
           M  S+K   K+  RAKTFTGCWTCR RKVKCDLR P C RC+KS L CGGYDIKLRWSK 
Sbjct: 1   MGISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKP 60

Query: 61  VKFDPYGVQLP---PSPNGN-SASNEEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHAP 116
           ++FDPYGV +P   P+   N S S +EPQYQRRNIDFV+Y EEY++HEDMDDEL++LH P
Sbjct: 61  MQFDPYGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTP 120

Query: 117 PTEKIADGKTWIIKKFGVFRGTDKIDKQYAPRKKRRKPAPSTVSKRKTLKTGNKLSAKES 176
           P EKI+D KTWIIKKFGVF+GTDKIDKQYAPRKKR +   +   +     + + L +  +
Sbjct: 121 PIEKISDNKTWIIKKFGVFKGTDKIDKQYAPRKKRNRKRVAKSLESSASISLSSLPSSST 180

Query: 177 AGKPI-NIEDS------PSKPMSNHQSPVNNIPSFVDFDLAMNNVPSYEWISSELRDDVL 229
              PI +IED           + +    V   P+ +D+D    N+  YEWISSELRDD L
Sbjct: 181 ISFPIRHIEDKLRNKGHVKTGILSANDGVPPTPNLLDYDWNNLNITGYEWISSELRDDAL 240

Query: 230 LSAFAIQGASINDVPDSTTSAKTSINQGTVSTGLFSNIPIDGTNSIGDD--TQTSPN--- 284
           LSA  +QG  +        S +   N   VS     N    G     D+  + T PN   
Sbjct: 241 LSAVTLQGHHLGHTQPQEISLEE--NSNVVSGEEHVNAKEHGCAFEADNQGSSTLPNKAA 298

Query: 285 --NDYTIQNALNLLFHNKQTPTSPSTSKGMV------------------KTLLDAPQSDS 324
             ND   Q  L LLF    + +     + ++                  K  L  P  +S
Sbjct: 299 SANDKLYQQNLKLLFQKNSSNSEEPDPQALIDDVFVNIEPRSLPASDLNKITLAPPNEES 358

Query: 325 HMPRTIMEIIN-PSPLELEIFEALNKLNLSWNIPASGVNVHGIGKFLLNYYLENVADLMT 383
            MP++++E+ +  S L  E+ +          IP + + VHG+ +FLLN+Y  NVAD MT
Sbjct: 359 RMPKSMLELTSYSSDLPPELVDI---------IPKTDLTVHGLARFLLNHYFNNVADKMT 409

Query: 384 VVPLSRNPWKKLYFPRALQALGDLVGLGYTTXXXXXXXXXXXXVSCFNLKSKFEKNSKEY 443
           VV L +NPWK LYFPRAL ALGDL GLG ++            VSCF+L+SK+ +N K  
Sbjct: 410 VVVLEKNPWKTLYFPRALMALGDLAGLGQSSNSRNALLNALLAVSCFHLQSKYPRNYKLQ 469

Query: 444 NYFLNLGIELRKQASNFLNICLNSTVTV-EKYKDVLTAILSMNSIDVVWGTMEDCQRHLT 502
            YFL LGIELR QASNFL +CLN+  ++ EKYKDVLTAILSMNSIDVVWGTM DCQ HL 
Sbjct: 470 KYFLGLGIELRNQASNFLRLCLNTKSSIPEKYKDVLTAILSMNSIDVVWGTMADCQDHLA 529

Query: 503 ICEDFVEKRMNSRPHISGKARTLHRIFSFLKLIQDSTALDKVRDKEIVIYGKKDKPDKNK 562
           +CEDFVE RM  RP+IS K +TLHRIFSFLKLIQDSTALDKVR KEIVI   ++  D  K
Sbjct: 530 LCEDFVESRMKLRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSEED-DNYK 588

Query: 563 VADPFVKDTSNNG--------GQFRESLNKLNGKIQIEYIRNDDSNDNNEQSASSS-PPM 613
             D     TS++         G FRE+LN+ +GKI IE+++   +N + + + SS+ PP+
Sbjct: 589 PLDTSNATTSSSEPRVDVVQEGLFREALNENDGKIHIEFVKEPITNVSADSTPSSTTPPI 648

Query: 614 FANIASESYYKPGQ----KSESDYDILSTDALYGLPNSLILLFSDCVRIVRHNEYYNIKY 669
           F NIA+ESYY         S++D +I+ TD+LYGLPNSLILLFSDCVRIVRHNEYYN+ Y
Sbjct: 649 FTNIATESYYNKSDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCVRIVRHNEYYNLTY 708

Query: 670 LAVPREFTEICLNFEKRLLKWKPEWAFYKENTD--EFIDDTIEGVYHHTMSFYYGLVIYY 727
           L VPR+F E+ LNFEKRLLKWK EW F++EN++   FI+ T E +YHHTMSFY+ L+IYY
Sbjct: 709 LPVPRKFNELSLNFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYHHTMSFYFSLIIYY 768

Query: 728 FSMAKHLNNQFLQSYVEKVLLHLNKLTDLIDHKSVKIVPLMWQGFIAGCSSNMQDLQQEF 787
           F+MA+ LN QFLQ+YV KVL HLN + +L+D K VKIVPL+WQGF+AGC+   ++ QQEF
Sbjct: 769 FTMARSLNCQFLQNYVAKVLDHLNAMEELVDQKKVKIVPLIWQGFMAGCACTDENRQQEF 828

Query: 788 RKWAAKLAESGMGSYWGARQVMFEVWRRRMNDEPNDNWYSVYKDWQMNLMLS 839
           R+WAAKLAESG+GSYWGARQVM EVWRRR  DEP DNWYSVYKDW+MNLMLS
Sbjct: 829 RRWAAKLAESGVGSYWGARQVMLEVWRRRKEDEPGDNWYSVYKDWEMNLMLS 880

>KLLA0D10197g complement(861726..864296) similar to sp|P05085
           Saccharomyces cerevisiae YML099c ARG81 transcription
           factor involved in arginine metabolism singleton, start
           by similarity
          Length = 856

 Score =  863 bits (2230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/868 (52%), Positives = 581/868 (66%), Gaps = 60/868 (6%)

Query: 14  RAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVKFDPYGVQLPPS 73
           R KTFTGCWTCRSRKVKCDLRRPGC RC+K GL CGGYD+KLRW++ ++FD  G  +  +
Sbjct: 7   RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMG-NVTAT 65

Query: 74  PNGNSASNEEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHAPPTEKIADGKTWIIKKFG 133
           P G     +EPQYQRRN+DFV+YKEEY+++EDMDDELS L +PP E I++ KTWIIKKFG
Sbjct: 66  PTG-IKDPDEPQYQRRNVDFVRYKEEYVYYEDMDDELSALSSPPLELISEDKTWIIKKFG 124

Query: 134 VFRGTDKIDKQYAPRKKRRKPA----PSTVSKRKTLKTGNKLSAKESAGKP----INIED 185
           VF+GTDK+ K+Y PRKKR+K          +++K     NK+   +S  K        ED
Sbjct: 125 VFKGTDKVKKRYVPRKKRKKNQVFINAIEKAQKKLANKKNKVKTADSDSKEGTNLCTPED 184

Query: 186 SPSKPMSNHQSPVNNIPSFVDFDLAMNNVPSYEWISSELRDDVLLSAFAIQGASI----- 240
             S   ++  +    + S  +FD+     P  EWIS+ELRDD LLSA A+QG +I     
Sbjct: 185 MESSSANDDHTSAQQLHSLFEFDMNSLLFPGNEWISNELRDDALLSASAVQGETIPFMGI 244

Query: 241 --NDVPDSTTSAKTSINQGTVSTGLFSNIPIDGTNSIGDDTQTSPN-NDYTIQNALNLLF 297
             N+ PD+  +  T  N G  +  +  N          +D +TS N N+  +     LLF
Sbjct: 245 RQNNTPDTPQTPLTVDNMGKKNGSVNGNC---------NDGRTSGNDNEDELARVYRLLF 295

Query: 298 HNKQT------PTSPSTSK--------GMV--KTLLDAPQSDSHMPRTIMEIINPSPLEL 341
           H + +      PT  S +K        G+V  +  ++     S MPR+ +E+I+    + 
Sbjct: 296 HRRGSSDQPPPPTITSETKSGHAKETIGIVPLRNFVELNVPGSTMPRSAIEVIHSQVPDP 355

Query: 342 EIFEALNKLNLSWNIPASGVNVHGIGKFLLNYYLENVADLMTVVPLSRNPWKKLYFPRAL 401
            IF      N   +IP +GV+VHG+ +FLLNYYL+NVADLMTVV L  N WK +YFPRAL
Sbjct: 356 SIFNRPGNTNPLLDIPTTGVHVHGLARFLLNYYLQNVADLMTVVVLPTNSWKTIYFPRAL 415

Query: 402 QALGDLVGLGYTTXXXXXXXXXXXXVSCFNLKSKFEKNSKEYNYFLNLGIELRKQASNFL 461
           +ALGDL G+GYT+            VSCFNL+SKF KNS E  +FL LGIE R QAS+FL
Sbjct: 416 KALGDLTGIGYTSNSRNSLLNALLAVSCFNLQSKFPKNSPEMKFFLTLGIEFRTQASSFL 475

Query: 462 NICLNSTVTVEKYKDVLTAILSMNSIDVVWGTMEDCQRHLTICEDFVEKRMNSRPHISGK 521
             CL++TV  E+YKD+LTAILSMNSIDVVWGTM DCQ HL ICEDFVE RM +RP IS K
Sbjct: 476 KRCLSNTVNQERYKDILTAILSMNSIDVVWGTMADCQVHLAICEDFVENRMKTRPKISAK 535

Query: 522 ARTLHRIFSFLKLIQDSTALDKVRDKEIVIYGKKDKPDKNKVADPFVKD-TSNNGGQFRE 580
           A+ LHRIFSFLKLIQDST+LDKVR KEIVI       D N   D  +    S + G+F+E
Sbjct: 536 AKALHRIFSFLKLIQDSTSLDKVRTKEIVIL------DNNSSIDSHISSGISLSNGEFKE 589

Query: 581 SLNKLNGKIQIEYIRNDDSN--------DNNEQSASSSPPMFANIASESYYKPGQKSESD 632
           SLN+ +GKI IE+  +  S           +  S+  + P+F+NIASESYY P + +++D
Sbjct: 590 SLNREDGKIVIEFFSSPSSGKPSPVAFPKGSHDSSGVTTPIFSNIASESYYYP-KSNDTD 648

Query: 633 YDILSTDALYGLPNSLILLFSDCVRIVRHNEYYNIKYLAVPREFTEICLNFEKRLLKWKP 692
            +ILSTDALYGLPNSLILLFSDCVR+ RH EYY    +  P+ F ++C  FE+R+L WK 
Sbjct: 649 NNILSTDALYGLPNSLILLFSDCVRLARHLEYYRQHNIVTPKAFKKLCTEFEQRILSWKS 708

Query: 693 EWAFYKENT-DEFIDDTIEGVYHHTMSFYYGLVIYYFSMAKHLNNQFLQSYVEKVLLHLN 751
           EW F    + D F++DTIEGVYHHTMSFY GL+IYYF++ K L  ++++ +V+ VL  L 
Sbjct: 709 EWDFKVPGSPDHFVNDTIEGVYHHTMSFYNGLIIYYFTVVKGLTYKYVKHHVQNVLNSLI 768

Query: 752 KLTDLIDHKSVKIVPLMWQGFIAGCSSNMQDLQQEFRKWAAKLAESGMGSYWGARQVMFE 811
           +LT+LI++K VKIVPL+WQGF+AGC+    +LQ EF++WAAKL +SGMGSYWGARQ+MFE
Sbjct: 769 QLTELIENKGVKIVPLIWQGFMAGCACIDSNLQLEFKEWAAKLCKSGMGSYWGARQIMFE 828

Query: 812 VWRRRMNDEPNDNWYSVYKDWQMNLMLS 839
           VWRRR+N E ND+W+SVYKDW+MNLMLS
Sbjct: 829 VWRRRLNGEQNDDWFSVYKDWEMNLMLS 856

>Kwal_27.9688
          Length = 841

 Score =  847 bits (2187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/882 (49%), Positives = 575/882 (65%), Gaps = 88/882 (9%)

Query: 2   RKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLV 61
           RKS+ T+ K  RR KTFTGCWTCRSRKVKCDL +P C RC+KSGLECGGYDIKLRWS  +
Sbjct: 4   RKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSI 63

Query: 62  KFDPYGVQLPPSPNGNSASN-EEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHAPPTEK 120
           KF+ +G       NG+ A+  EEPQ QRRN+ FV YK+EY F+EDMD+ELS LH+P  +K
Sbjct: 64  KFNKFG---QVDSNGSPANGTEEPQSQRRNVGFVTYKDEYEFYEDMDEELSALHSPSQDK 120

Query: 121 IADGKTWIIKKFGVFRGTDKIDKQYAPRKKRR----------KPAPSTVSKRKTLKTGNK 170
           I+D KTWIIKKFGVFRGT+ +  +Y PR+KRR          K  P+T  KR  +   ++
Sbjct: 121 ISDNKTWIIKKFGVFRGTENVKTKYTPRRKRRQAGRVSEDQIKKPPTTEIKRPHINADSE 180

Query: 171 LSAKESAGKPINIEDSPSKPMSNHQSPVNNIPSFVDFDLAMNNVPSYEWISSELRDDVLL 230
           +++ +S                        + +  DFD +  N   +EWI++ELRDD LL
Sbjct: 181 ITSSQS------------------------LANLFDFDFSSMNFNGHEWIANELRDDALL 216

Query: 231 SAFAIQGASINDV---PDSTTSAKTSINQGTVSTGLFSNIPIDGTNSIGDDT-----QTS 282
           SA AIQG +++++   P   TS   +  + +    L     +       D T     +  
Sbjct: 217 SASAIQGGTMDNLFQRPQGQTSFSANNRRQSSYNTLHLPRRLQPDQEESDQTNNQLQKAG 276

Query: 283 PNNDYTIQNALNLLFH--------NKQTPTSPSTSKGMVKT--------LLDAPQSDSHM 326
           P +   I     LLFH         +Q P  P   + + +T        L+++  ++  M
Sbjct: 277 PADVDDISRVYKLLFHRNEDRSKVTQQAPVVPIDDQHVPRTIVPLDNVILINSSGTEGRM 336

Query: 327 PRTIMEIINPSPLELEIFEALNKLNLSWNIPASGVNVHGIGKFLLNYYLENVADLMTVVP 386
           P+ ++E++N    +  IF      N+   +P +G+ VHG+ +FL+NYYL+NV DLMTVV 
Sbjct: 337 PKQVLEVVNSDVPDHTIFNLPTNDNILLRLPTTGLKVHGLTRFLMNYYLQNVVDLMTVVA 396

Query: 387 LSRNPWKKLYFPRALQALGDLVGLGYTTXXXXXXXXXXXXVSCFNLKSKFEKNSKEYNYF 446
           L  NPW+ +YFPRA QALGD+ G+GYT+            VSCFNL+SKF +NS E  ++
Sbjct: 397 LPTNPWRTIYFPRAAQALGDIAGVGYTSNSRNSLLNAILAVSCFNLQSKFPRNSPEMRFY 456

Query: 447 LNLGIELRKQASNFLNICLNSTVTVEKYKDVLTAILSMNSIDVVWGTMEDCQRHLTICED 506
           L LGIE R QAS+FL  CL S+   E+YKD+LTAILSMNSIDVVWGTM DCQ HLT+CE 
Sbjct: 457 LQLGIEFRGQASDFLKACLASSAKQERYKDILTAILSMNSIDVVWGTMADCQYHLTLCEG 516

Query: 507 FVEKRMNSRPHISGKARTLHRIFSFLKLIQDSTALDKVRDKEIVIYGKKDKPDKNKVADP 566
            VE+RM +RP +SGKAR LHRIFSFLKLIQDSTALDKV ++EIVI         +++ + 
Sbjct: 517 LVEERMKTRPKLSGKARALHRIFSFLKLIQDSTALDKVHEREIVI--------DHRIPES 568

Query: 567 FVK-DTSNNGGQFRESLNKLNGKIQIEYIRNDDSNDNNEQSASSSPPMFANIASESYYKP 625
            V+ D S+NGG+F+ESLNK++GKI+IEY++        +   S S P+F ++AS++YY P
Sbjct: 569 VVENDVSDNGGEFKESLNKVDGKIRIEYVK--------QNRKSGSTPIFDSVASQTYYYP 620

Query: 626 GQKSES-DY-------DILSTDALYGLPNSLILLFSDCVRIVRHNEYYNIKYLAVPREFT 677
           G +  S DY       D+LSTDALYGLPNS+ILLFSDCVR+ RH EYY       P  + 
Sbjct: 621 GNRMGSGDYTKSLEGNDVLSTDALYGLPNSIILLFSDCVRLARHREYYRKHDQDPPESYE 680

Query: 678 EICLNFEKRLLKWKPEWAFYKENTDEFIDDTIEGVYHHTMSFYYGLVIYYFSMAKHLNNQ 737
            +C  FEK+L  W  EW F+K N+ EF++DTIEGVY+HTMSFY  L+IYY +MA+   +Q
Sbjct: 681 ILCAEFEKKLSGWTSEWDFHKPNSTEFVNDTIEGVYYHTMSFYQSLIIYYNTMARGRRHQ 740

Query: 738 FLQSYVEKVLLHLNKLTDLIDHKSVKIVPLMWQGFIAGCSSNMQDLQQEFRKWAAKLAES 797
            +Q  V   L +LNKLT+LI+ K VKIVPL+WQGFIAGCS+   DLQ ++++WAA+LA S
Sbjct: 741 DIQENVRNALTYLNKLTELIN-KGVKIVPLIWQGFIAGCSAIDTDLQLQYKEWAARLANS 799

Query: 798 GMGSYWGARQVMFEVWRRRMNDEPNDNWYSVYKDWQMNLMLS 839
           GMGSYWGARQ+MFEVWRRR+N E  DNW++VY+DW+MNLMLS
Sbjct: 800 GMGSYWGARQIMFEVWRRRVNGENCDNWFNVYRDWEMNLMLS 841

>AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH]
           complement(32874..35525) [2652 bp, 883 aa]
          Length = 883

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/884 (48%), Positives = 557/884 (63%), Gaps = 72/884 (8%)

Query: 2   RKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLV 61
           ++ + T  +RPR AKTFTGCWTCR RKVKCDL +P C RC+KSGL+CGGYDIKLRWS  +
Sbjct: 26  KEGSGTAVRRPR-AKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPI 84

Query: 62  KFDPYGVQLPPSPNGNSASNEEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHAPPTEKI 121
           +FD +G Q+               +QRRNI FV+Y EEY ++EDMDDELS LH+PP E I
Sbjct: 85  RFDKFGNQMAGEDRDGDGEQPAQPFQRRNIMFVRYDEEYEYYEDMDDELSALHSPPLEMI 144

Query: 122 ADGKTWIIKKFGVFRGTDKIDKQYAPRKKRR-----KPAPSTVSKRK------------- 163
           AD KTWIIK+FGVF+GTD++ ++Y PRK+R+       A +   +RK             
Sbjct: 145 ADHKTWIIKRFGVFKGTDRVKRKYVPRKRRKVNPVFADAMAREHRRKLEEREKQARRKRK 204

Query: 164 -----TLKTGNKLSAKESAGKPINIEDSPSKPMSNHQSPVNNIPSFVDFDLAMNNVPSYE 218
                +L +GN   A  +   P      P+   +   SPV+  P F DFD +   + S E
Sbjct: 205 GELQGSLGSGNATGAGFAKAGP------PAAESAGAMSPVSATPLF-DFDFSTPGLVSSE 257

Query: 219 WISSELRDDVLLSAFAIQ-------GASINDVPDSTTSAKTSINQGTVSTGLFSNIPIDG 271
           W++ EL+DD  LS+  ++       G S+    D  T A T+  +   S      +P+  
Sbjct: 258 WMAGELKDDTTLSSAMLRNTLSFPTGLSVAQHGDGIT-ADTAPPKSQSSIFPEQTLPLQS 316

Query: 272 TNSIGDDTQTSPNNDYTIQNALNLLFHNKQTPTSPSTS-KGMV---------KTLLDAPQ 321
                  T   P+ D  +     LL +N+ T  + ST  KG+             +  P+
Sbjct: 317 AG-----TMVPPSVD-EVSKVYRLLLNNQGTDCNSSTGYKGLSGVHTPYTVDNVAIHGPE 370

Query: 322 SDSHMPRTIMEI---INPSPLELEIFEALNKLNLSWNIPASGVNVHGIGKFLLNYYLENV 378
           S   MP + +E    I P P    + E  N L     +P  G+ +HG+ +FLL+YY +NV
Sbjct: 371 S--RMPASAIESVPSIVPDPTIFTLAEHTNSL---IRLPRMGMQIHGLTRFLLSYYQQNV 425

Query: 379 ADLMTVVPLSRNPWKKLYFPRALQALGDLVGLGYTTXXXXXXXXXXXXVSCFNLKSKFEK 438
           ADLM+VV L +NPWK +YFPRA++ALG+L  LGYT+            VSCF+L+SKF K
Sbjct: 426 ADLMSVVALPKNPWKTIYFPRAVKALGELGALGYTSHSRNALLNALLAVSCFHLQSKFPK 485

Query: 439 NSKEYNYFLNLGIELRKQASNFLNICLNSTVTVEKYKDVLTAILSMNSIDVVWGTMEDCQ 498
           NSKE  YF++LG++ R QAS FLN CL+ST   E YKDVLTAILSMNSIDVVWGTM DCQ
Sbjct: 486 NSKEMKYFVSLGMDFRNQASGFLNACLSSTSRQEHYKDVLTAILSMNSIDVVWGTMSDCQ 545

Query: 499 RHLTICEDFVEKRMNSRPHISGKARTLHRIFSFLKLIQDSTALDKVRDKEIVI--YGKKD 556
            HLTICE+F+E RM SRP +S KAR LHRIFSFLKLIQDSTALDKV++KEI++   G K+
Sbjct: 546 YHLTICEEFIESRMKSRPLLSEKARCLHRIFSFLKLIQDSTALDKVQEKEIIMKDAGDKE 605

Query: 557 KPDKNKVADPFVKDTSNNGGQFRESLNKLNGKIQIEYIRNDDSNDNNEQSASSSPPMFAN 616
                    P   D+S+  G++ E LNK NG++ IE+I  D    +   S     P+F  
Sbjct: 606 FQKNGSSTPPLSTDSSSFTGRYVEQLNKDNGRVCIEFIEKDGQYFDTRGSV----PLFNT 661

Query: 617 IASESYYKPGQKSESDYDILSTDALYGLPNSLILLFSDCVRIVRHNEYYNIKYLAVPREF 676
           I ++SY  P + +E+  D LS D LYGLPNSLILLFSDCV +VRH  Y+     A P  F
Sbjct: 662 IVTKSY--PHEINETRIDTLSMDVLYGLPNSLILLFSDCVSLVRHRFYFKRHNTAQPTSF 719

Query: 677 TEICLNFEKRLLKWKPEWAFYKENTD-EFIDDTIEGVYHHTMSFYYGLVIYYFSMAKHLN 735
              C+  E+RLL WKPEW F+K+++  EFI+DT+EGVYHHTMSFYYGL+IYYF+MA+ L 
Sbjct: 720 GLFCVKIEQRLLSWKPEWIFWKDDSKAEFINDTVEGVYHHTMSFYYGLLIYYFTMARSLE 779

Query: 736 NQFLQSYVEKVLLHLNKLTDLIDHKSVKIVPLMWQGFIAGCSSNMQDLQQEFRKWAAKLA 795
           +  LQ+YV+KVL HL +L ++I+HK VKIVPLMWQGF+AGCS     +Q EF+KW A+L 
Sbjct: 780 DHTLQNYVQKVLSHLRELGNIIEHKDVKIVPLMWQGFMAGCSCTDSSMQLEFKKWTAQLV 839

Query: 796 ESGMGSYWGARQVMFEVWRRRMNDEPNDNWYSVYKDWQMNLMLS 839
             G+GSYWGARQ+M EVWRRRM D   DNWYSVY DW+MNLML+
Sbjct: 840 NFGIGSYWGARQIMLEVWRRRMTDGKCDNWYSVYCDWEMNLMLA 883

>CAGL0H06875g complement(682518..684626) some similarities with
           sp|05085 Saccharomyces cerevisiae YML099c ARG81,
           hypothetical start
          Length = 702

 Score =  330 bits (845), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 205/579 (35%), Positives = 304/579 (52%), Gaps = 92/579 (15%)

Query: 300 KQTPTSPSTSKGMVKTLLD-APQSDSHMPRTIM-------EIINPSPLELE----IFEAL 347
           K+   +PS +   + T +  +P S   +P T+          ++P P+EL     I +  
Sbjct: 177 KKPRLAPSVATSTMTTPISLSPTSPMMIPDTLGLTFDGNPAFMSPLPMELLQPDFIHDHS 236

Query: 348 NKLNLSWNIPASGVNVHGIGKFLLNYYLENVADLMTVVPL---SRNPWKKLYFPRALQAL 404
           + ++LS     S   VH   +FLL +YLE V DLMT+ P+   ++NPW K+YFPRA+ AL
Sbjct: 237 HLVSLS---TESCSIVHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFPRAIAAL 293

Query: 405 GDLVGL-GYTTXXXXXXXXXXXXVSCFNLKSKFEKNSKEYNYFLNLGIELRKQASNFLNI 463
           G+L+                   VSCFNLK   + +    +++LNL +ELR +AS+FLN+
Sbjct: 294 GELIAFPNSQNYARISLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRASHFLNL 353

Query: 464 CLNSTVTVEKYKDVL-----------------TAILSMNSIDVVWGTMEDCQRHLTICED 506
            L      E+Y+D+L                  AIL+MNSID+VWGTM DC  +L ICE 
Sbjct: 354 ALEQEEEYEEYRDILEDDDIAEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNYLRICEQ 413

Query: 507 FVEKRMNSRPHISGKARTLHRIFSFLKLIQDSTALDKVRDKEIVIYGKKDKPDKNKVADP 566
            + K    R  +S K ++L+ I++FLKL+Q+STA++ +  +  + +   D          
Sbjct: 414 LISKN-KKRVVVSKKIKSLYTIYAFLKLMQNSTAMETITSEPSLDFHNPDI--------- 463

Query: 567 FVKDTSNNGGQFRESLNKLNGKIQIEYIRNDDSNDNNEQSASSSPPMFANIASESYYKPG 626
                                 I  +Y+R    ND               I ++ Y    
Sbjct: 464 ----------------------IPYKYLRETYEND------------IKTIFTDHY---- 485

Query: 627 QKSESDYDILSTDALYGLPNSLILLFSDCVRIVRHNEYYNIKY--LAVPREFTEICLNFE 684
               +  + L  DAL  LPNSL+LLF DCV + R+  Y+  K   + +P EF      FE
Sbjct: 486 --GSTKMNTLGADALNALPNSLVLLFYDCVSLTRYYFYHKKKSEGIELPTEFFMKTREFE 543

Query: 685 KRLLKWKPEWAFYKENTDEFIDDTIEGVYHHTMSFYYGLVIYYFSMAKHLNNQFLQSYVE 744
            +L  WK EW F+      F+  TIEG+YHHTMSFYYGL +YY++  K+ + + L   V 
Sbjct: 544 DKLSNWKSEWDFFDSTGRNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNVEVW 603

Query: 745 KVLLHLNKLTDLIDHKS----VKIVPLMWQGFIAGCSSNMQDLQQEFRKWAAKLAESGMG 800
           KV+ HL ++  L D  +    +K++PL+WQGFIAGC  +  ++Q EF+ W   ++ +G G
Sbjct: 604 KVIYHLQQIEFLKDSSAGKEGIKLIPLIWQGFIAGCLCSDPEVQSEFKTWFDTVSLTGAG 663

Query: 801 SYWGARQVMFEVWRRRMNDEPNDNWYSVYKDWQMNLMLS 839
           SY GA Q+MFEVWRRR N+E  D+W SV +DW+MN+ML+
Sbjct: 664 SYRGAIQIMFEVWRRRDNNELGDDWLSVSRDWEMNIMLT 702

 Score =  157 bits (398), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 89/199 (44%), Positives = 126/199 (63%), Gaps = 8/199 (4%)

Query: 10  KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVKFDPYGVQ 69
           K  R  KT++GCWTCR+RKVKCDL RP C+RC +S ++CGGY IKLRWS L+ FD YGV 
Sbjct: 4   KSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGVP 63

Query: 70  LPPSPNGNSASNEEPQYQ---RRNIDFVKYKEEYIFHEDMDDELSILHAPPTEKIADGKT 126
           +P + +  +   ++ +     RRN++ V+Y+EEY +HEDMD+ELS LHAPP +KIA+ KT
Sbjct: 64  MPSNESITTTEGDDVETSTNLRRNVERVRYEEEYEYHEDMDEELSELHAPPEDKIANNKT 123

Query: 127 WIIKKFGVFRGTDKIDKQYAPRKKRRKPAPSTVSKRKTLKTGNKLSAKESAGKPINIED- 185
           WIIKKFGVFR    I+++     KR K     V K+   +  +  S      +P+  +  
Sbjct: 124 WIIKKFGVFRA---IEREAIIAAKRGKTDKRPVQKKIANELNSNNSNNHINNEPLMKKPR 180

Query: 186 -SPSKPMSNHQSPVNNIPS 203
            +PS   S   +P++  P+
Sbjct: 181 LAPSVATSTMTTPISLSPT 199

>YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger
          regulatory protein for thiamine pyrophosphokinase
          (THI80) expression [1353 bp, 450 aa]
          Length = 450

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 2  RKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRW 57
          +K A +    P + +TFTGCW CR +K +CD  RP C  C K G  C  YDI+L W
Sbjct: 11 KKVASSSKVPPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNC-SYDIRLMW 65

>KLLA0F10373g 957948..958994 some similarities with sp|P38141
          Saccharomyces cerevisiae YBR240c THI2 regulator of the
          thiamine biosynthetic genes singleton, hypothetical
          start
          Length = 348

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 1/44 (2%)

Query: 14 RAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRW 57
          + + FTGCW CR +K KCD R+P C  C K G+EC  YD++L W
Sbjct: 3  KDRNFTGCWACRFKKRKCDERKPICSLCLKHGVEC-CYDVRLSW 45

>Scas_597.4
          Length = 475

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 4/77 (5%)

Query: 14 RAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVKFDPYGVQLPPS 73
          +A+TFTGCW CR +K +CD  +P C  C + G  C  YDI+L W   +  + + V    S
Sbjct: 17 KARTFTGCWACRLKKRRCDELKPTCSLCVRHGDTC-SYDIRLMW---LDVNMFKVDTSMS 72

Query: 74 PNGNSASNEEPQYQRRN 90
                +  E Q +R N
Sbjct: 73 GGAEYVTFNESQQRRCN 89

>Kwal_14.1631
          Length = 443

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 9  TKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRW 57
          T    +A++FTGCW CR +K +CD  +P C  C K G +C  YDI+L W
Sbjct: 3  TASKTKARSFTGCWACRFKKRRCDEAKPVCSLCLKHGDQC-SYDIRLVW 50

>Sklu_1373.2 YDR207C, Contig c1373 1069-2895
          Length = 608

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 6/53 (11%)

Query: 6   KTQTKRPRR-----AKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDI 53
           K QT+RPRR     +++ TGCW CR RK KC   +P C  C +  LEC  YDI
Sbjct: 521 KEQTERPRRKNTTGSRSRTGCWICRLRKKKCTEEKPHCNNCTRLNLEC-FYDI 572

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 16/90 (17%)

Query: 10 KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVKFDPYGVQ 69
          K  +R +    C  CR RK+KCD +RP C++C + GL C                 Y ++
Sbjct: 14 KVQKRNRLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTC----------------VYDIE 57

Query: 70 LPPSPNGNSASNEEPQYQRRNIDFVKYKEE 99
            P+P  +S  +E  +  +R +++ K K +
Sbjct: 58 RQPAPRKSSKVSETIELLQRELEYWKLKAQ 87

>AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH]
           complement(373485..374633) [1149 bp, 382 aa]
          Length = 382

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 47/96 (48%), Gaps = 13/96 (13%)

Query: 6   KTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSK----LV 61
           +   ++PR  + FTGCW CR +K +CD   P C  C K G  C  YD++L W +    LV
Sbjct: 10  RAGARKPR-IRCFTGCWACRFKKRRCDEGVPFCALCVKHGDAC-SYDVRLVWLEENMLLV 67

Query: 62  -----KFDPYGVQLPPSPNGNSASNEE--PQYQRRN 90
                +     V+ P +  G S S  +   QY+RR 
Sbjct: 68  SRTDGQMRSCAVRAPAARRGLSKSEFQTLAQYRRRQ 103

>Kwal_56.24566
          Length = 755

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 27/45 (60%)

Query: 4  SAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          SA     RP+R ++  GC+TCR R+ KCD  RP C  C K  L+C
Sbjct: 15 SATALMLRPKRNRSRAGCFTCRLRRKKCDEARPKCGTCSKHMLKC 59

>Scas_596.4
          Length = 701

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 8   QTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           +TK+ RR+++  GCW CR RK KC   +P C  C +  L+C
Sbjct: 557 ETKKARRSRS--GCWICRLRKKKCTEEKPACFNCQRLNLDC 595

>CAGL0C01199g complement(121944..124712) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, hypothetical
          start
          Length = 922

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 2  RKSAKTQT-KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          ++ +KT T KR    K+ TGC  C+ R+VKCD  +PGC +C    L C
Sbjct: 28 KRVSKTSTGKRKFHKKSKTGCDNCKRRRVKCDEGKPGCKKCSNLNLVC 75

>CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces
           cerevisiae YOR337w TEA1 TY1 enhancer activator,
           hypothetical start
          Length = 816

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 2   RKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLR 56
           R+S+   T RP + +    C  CR R+ KCDL+ P C  CDK GLEC   +  LR
Sbjct: 59  RESSANVTSRPTKKRL--ACSNCRRRRKKCDLQYP-CFTCDKLGLECNINEEDLR 110

>Kwal_26.6732
          Length = 676

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%)

Query: 12 PRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          P + ++ TGC TCR R+ KCD R+P C  C+ + L+C
Sbjct: 3  PPKKRSVTGCLTCRKRRKKCDERKPVCTGCESNFLQC 39

>YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive
          transcription regulator of ARO9 and ARO10, member of
          the Zn2Cys6 transcription factor family [2853 bp, 950
          aa]
          Length = 950

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 6/53 (11%)

Query: 2  RKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDL------RRPGCVRCDKSGLEC 48
          R S     + P+R +T+  C +CRSRKVKCDL        P C RC +   +C
Sbjct: 6  RPSGNAAFELPKRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKC 58

>Scas_663.12
          Length = 944

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 7  TQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDI 53
          +Q  + +R +    C  CR  KVKCD  +P C RC K  LEC  YD+
Sbjct: 26 SQVTKKKRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC-VYDV 71

>KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001
           Saccharomyces cerevisiae YDR207c UME6 negative
           transcriptional regulator singleton, hypothetical start
          Length = 787

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 15  AKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDI 53
           A++ TGCW CR RK KC   +P C  C +  LEC  YDI
Sbjct: 713 ARSRTGCWICRLRKKKCTEEKPQCQNCVRLHLEC-FYDI 750

>KLLA0A04169g complement(376273..378600) similar to sgd|S0004218
          Saccharomyces cerevisiae YLR228c ECM22, start by
          similarity
          Length = 775

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 5  AKTQT-KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          +KT T KR    K+  GC  C+ R+VKCD  RP C+ C K  L+C
Sbjct: 40 SKTATGKRKFHKKSKNGCDHCKRRRVKCDETRPHCLNCKKMSLDC 84

>Scas_717.33
          Length = 904

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 10/56 (17%)

Query: 3  KSAKTQTKRPRR----AKTFTGCWTCRSRKVKCDL------RRPGCVRCDKSGLEC 48
          ++  T +KR  R     ++F  C +CR RKVKCDL       +P CVRC + G  C
Sbjct: 12 EAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67

>YDR207C (UME6) [1046] chr4 complement(865005..867515) Global
           transcriptional regulator containing a zinc binuclear
           cluster domain involved in pathway specific repression
           or induction [2511 bp, 836 aa]
          Length = 836

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 16  KTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           ++ TGCW CR RK KC   RP C  C++  L+C
Sbjct: 766 RSRTGCWICRLRKKKCTEERPHCFNCERLKLDC 798

>AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH]
           (516587..518830) [2244 bp, 747 aa]
          Length = 747

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 16  KTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDI 53
           ++ TGCW CR RK KC   RP C  C +  LEC  YDI
Sbjct: 675 RSRTGCWICRLRKKKCSEERPQCSNCLRLNLEC-VYDI 711

>YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol
          regulatory element binding protein involved in the
          regulation of sterol biosynthetic gene expression and
          may be involved in regulating sterol uptake [2445 bp,
          814 aa]
          Length = 814

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 2  RKSAKTQT-KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSK 59
          +K +KT T KR    K+ TGC  C+ R+VKCD  +P C +C    L+C    I+ R  K
Sbjct: 24 KKVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEGKPFCKKCTNMKLDCVYSPIQPRRRK 82

>CAGL0F05357g 541830..543635 some similarities with sp|P39001
           Saccharomyces cerevisiae YDR207c UME6, hypothetical
           start
          Length = 601

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%)

Query: 8   QTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           + KR    ++ TGCW CR RK KC   +P C  C +  L+C
Sbjct: 517 ERKRKPATRSRTGCWICRLRKKKCSEEKPACFNCQRLNLDC 557

>Scas_674.12*
          Length = 909

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 10 KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          K  R+A+    C  CRS+KVKCD  RP C RC K+   C
Sbjct: 4  KNYRKARPSFVCLVCRSKKVKCDKARPSCGRCRKTNKLC 42

>KLLA0C17050g 1490472..1493339 some similarities with
          ca|CA3454|IPF10533.exon1 Candida albicans unknown
          function, exon 1, hypothetical start
          Length = 955

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 2  RKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          RK  K Q KR R+      C  C  RK+KCD  +P C  C K+G EC
Sbjct: 30 RKIYKIQHKRQRQ---ILSCVACHKRKIKCDRAKPVCESCGKNGWEC 73

>AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W
           (UPC2) - SH] complement(535317..537917) [2601 bp, 866
           aa]
          Length = 866

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 2   RKSAKTQT-KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           +K +KT T KR    K+  GC  C+ R+VKCD  +PGC +C K  L C
Sbjct: 69  KKVSKTATGKRKFHNKSKNGCDNCKRRRVKCDEGKPGCQKCLKMRLSC 116

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 3  KSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIK 54
          K  +  +   +R +    C  CR  K KCD  +P C RC K+G+EC  YDI+
Sbjct: 10 KQEEQNSHSSKRNRISFVCKACRKSKTKCDREKPSCTRCIKNGIEC-VYDIE 60

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
           Saccharomyces cerevisiae YDR213w UPC2, start by
           similarity
          Length = 844

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 10/95 (10%)

Query: 2   RKSAKTQT-KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDI---KLRW 57
           +K + T T KR    K+  GC  C+ R+VKCD  +P C +C K  LEC    +   K R 
Sbjct: 34  KKVSTTSTGKRKFHNKSKNGCDHCKRRRVKCDEGKPMCDKCVKMKLECVYTPVQPPKRRT 93

Query: 58  SKLVKFDPYGVQLPPSPNGNSASNEEPQYQRRNID 92
              VK+      +    NG     E+PQ + ++++
Sbjct: 94  RTRVKY------ITRDANGEIIETEKPQVEGKDVN 122

>YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory
          element binding protein involved in the regulation of
          sterol biosynthetic gene expression and the uptake and
          intracellular esterification of sterols [2742 bp, 913
          aa]
          Length = 913

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 2  RKSAKTQT-KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLR 56
          +K + T T KR    K+  GC  C+ R+VKCD  +P C +C    LEC    I LR
Sbjct: 31 KKVSTTSTGKRKFHNKSKNGCDNCKRRRVKCDEGKPACRKCTNMKLECQYTPIHLR 86

>Scas_679.26
          Length = 775

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 2  RKSAKTQT-KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          +K +KT T KR    K+  GC  C+ R+VKCD  +P C +C    LEC
Sbjct: 38 KKVSKTSTGKRKFHNKSKNGCDNCKRRRVKCDELKPTCQKCINMNLEC 85

>Kwal_26.7095
          Length = 838

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 10 KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          K+ R  ++F  C  C+ RK+KCD  RP C RC K  LEC
Sbjct: 20 KKSRMRQSFV-CRNCKKRKIKCDKARPSCGRCSKLELEC 57

>Kwal_23.3122
          Length = 788

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 2  RKSAKTQT-KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          +K +KT T KR    K+  GC  C+ R+VKCD  +P C +C    LEC
Sbjct: 30 KKVSKTSTGKRKFHKKSKNGCDNCKRRRVKCDEDKPSCQKCLNMKLEC 77

>Scas_573.4
          Length = 1478

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 7  TQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSK 59
          T+ KR +R +    C  CR RKVKCD  RP C +C K+G+    + ++  W++
Sbjct: 30 TKVKR-KRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYMEQSWAE 81

>AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH]
          (831058..832896) [1839 bp, 612 aa]
          Length = 612

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLR 56
           C TCR R+ KCDL+ P CV C K G+EC   D  LR
Sbjct: 13 ACQTCRKRRRKCDLQVP-CVNCQKFGVECLPVDQDLR 48

>KLLA0A10329g 903873..905792 some similarities with
          ca|CA6113|IPF100.3 Candida albicans zinc finger
          protein, 3-prime end (by homology), hypothetical start
          Length = 639

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRW 57
          + A+++ GC  C+S K KCD  +P C  C K G +C  Y   L+W
Sbjct: 9  KVARSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQC-DYSRTLKW 52

>Kwal_55.20722
          Length = 827

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%)

Query: 10 KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECG 49
          K PR  +    C  CR+RK+KCD  RP C RC ++ L C 
Sbjct: 4  KSPRVNRPRLVCLECRNRKLKCDKARPKCTRCKQNLLTCS 43

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
          Saccharomyces cerevisiae YLR256w HAP1 transcription
          factor, hypothetical start
          Length = 1355

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 11 RPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVK 62
          + +R +    C  CR RKVKCD  RP C +C K+G+    + ++  W++  K
Sbjct: 13 KKKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQNWAQDAK 64

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
           Transcription factor required for derepression of
           gluconeogenic enzymes, contains an N-terminal
           Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
           bp, 1433 aa]
          Length = 1433

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 20  GCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLR 56
            C  CRS+K +CD +RP C +C   G EC   D  LR
Sbjct: 69  ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLR 105

>KLLA0D00484g 44879..47893 no similarity, hypothetical start
          Length = 1004

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 6  KTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          K  TK+ +   +  GC  C+    KCD R+P C RC+K  ++C
Sbjct: 56 KLSTKKRKSTYSRKGCLQCKKAHTKCDERKPKCSRCEKRSIDC 98

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
          (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 4  SAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWS 58
          S+ T + + +R +    C  CR RKVKCD  RP C +C K+G+    + ++  W+
Sbjct: 2  SSPTASSKRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQTWA 56

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 3   KSAKTQTKRPR-RAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGL-EC 48
           K+A T   + R R K    C  CR RK+KCD +RP C  C   GL EC
Sbjct: 71  KNASTSNGKVRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSEC 118

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
           with heme-dependent DNA-binding activity, responsible
           for heme-dependent activation of many genes [4509 bp,
           1502 aa]
          Length = 1502

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 4   SAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSK 59
           S  ++ KR +R +    C  CR RKVKCD  RP C +C K+G+    + ++  W++
Sbjct: 48  SDSSKIKR-KRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAE 102

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
           lactis Cat8p, start by similarity
          Length = 1445

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 20  GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
            C  CR++K++CD +RP C +C   G EC
Sbjct: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
           cerevisiae YGL013c PDR1 transcription factor,
           hypothetical start
          Length = 1107

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (45%), Gaps = 11/120 (9%)

Query: 5   AKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVKFD 64
            K Q    RR K    C +CR RK+KC+  +P C  C   G EC   D K   +K +K +
Sbjct: 15  VKAQKPSTRRTKVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTDAK--STKNLKSN 71

Query: 65  PYGVQLPPSPNGNSASNEEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHAPPTEKIADG 124
             G      P G  + N+E    R + D  K +++Y+    ++  + +    P+E I +G
Sbjct: 72  DAG---KSKPTGRVSKNKET--TRVDKDIRKLEQQYV---PINANIHVGPRFPSENILNG 123

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor,
           hypothetical start
          Length = 1372

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 14  RAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSK 59
           R +    C  CR RKVKCD  RP C +C K+G+    + ++  W++
Sbjct: 64  RNRVPLSCTICRRRKVKCDKSRPNCTQCVKTGVAHLCHYMEQAWAE 109

>Kwal_23.3178
          Length = 611

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 5/43 (11%)

Query: 11  RPRR-----AKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           +PRR     +++ TGCW CR RK KC   +P C  C +  L+C
Sbjct: 530 KPRRKNNSGSRSRTGCWICRLRKKKCTEEKPSCHNCLRLNLQC 572

>KLLA0F22880g 2123577..2127071 some similarities with
          ca|CA3639|IPF9251 Candida albicans unknown function,
          hypothetical start
          Length = 1164

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSG--LECGGYDIKLRWSKLVKFDPYGVQLP 71
           C  CR RKV+CD  +P C+ C K G  +EC  Y+++ R  K V      V  P
Sbjct: 8  SCLVCRRRKVRCDRAKPVCLVCVKHGSNMEC-NYEVQKREVKFVSMKTPDVSNP 60

>KLLA0D11286g complement(964642..966678) no similarity,
          hypothetical start
          Length = 678

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 25/46 (54%)

Query: 3  KSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          KSAK   ++  R +T   C  C S K KCD ++P C RC K  L C
Sbjct: 8  KSAKEIKEQIVRKRTPKSCIRCYSIKRKCDHKKPSCTRCFKKSLPC 53

>YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protein
          with similarity to transcription factors, contains an
          N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
          domain [4026 bp, 1341 aa]
          Length = 1341

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 3/59 (5%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLEC---GGYDIKLRWSKLVKFDPYGVQLPPSPN 75
           C  CR RK +CD + P C  C K+G++C     Y      S      P    +PP+P+
Sbjct: 40 SCLLCRRRKQRCDHKLPSCTACLKAGIKCVQPSKYSSSTSNSNTNNNTPTAGTVPPTPH 98

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 4  SAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIK 54
          S K    + RR K    C +CR  K KCD  +P C RC K+G  C  YD++
Sbjct: 22 SGKVTKTKGRRNKLSFVCQSCRRSKTKCDKVKPSCTRCVKNGSVC-VYDVE 71

>KLLA0C16489g 1444456..1446642 some similarities with
           ca|CA2184|IPF6874.3 Candida albicans unknown function,
           3-prime end, hypothetical start
          Length = 728

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 19  TGCWTCRSRKVKCDLRRPGCVRCDKSGLEC-------GGYDIKLRWSKLVKFDPYGVQLP 71
           +GC+TCR +++KCD + P C RC ++ L C       G    K+R +     DPY    P
Sbjct: 41  SGCFTCRLKRMKCDEQHPICGRCKRNLLTCIWPKEGNGKLTKKMRQAMKDNVDPYAEMNP 100

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor singleton,
          hypothetical start
          Length = 1253

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 8  QTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSK 59
          Q KR +R +    C  CR RKVKCD  RP C +C K+G+    + ++  W++
Sbjct: 13 QQKR-KRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGVGHLCHYMEQTWAE 63

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
           (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 12  PRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           P   +    C  CRS+K +CD +RP C +C   G EC
Sbjct: 69  PTNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105

>ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH]
          (1048530..1051364) [2835 bp, 944 aa]
          Length = 944

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 16 KTFTGCWTCRSRKVKCDL------RRPGCVRCDKSGLEC 48
          + +  C  CR+RKV+CDL      R P CVRC +   EC
Sbjct: 27 RIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKEC 65

>Scas_696.44
          Length = 1164

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 20  GCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
            C  CRS+K +CD +RP C +C   G EC   D
Sbjct: 80  ACDRCRSKKTRCDGKRPQCSQCAIVGFECKISD 112

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
          Saccharomyces cerevisiae YLR098c CHA4 transcription
          factor, start by similarity
          Length = 603

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 7  TQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          T T   R+ K    C  CR ++ KCD+ RP C  C K G+EC
Sbjct: 3  TITDGKRKRKAHLACQNCRIKRRKCDMERP-CSNCLKYGIEC 43

>KLLA0F00572g complement(42710..44503) some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 597

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 14 RAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          + ++ TGC  CR RK KCD  +P C  C ++ LEC
Sbjct: 4  KKRSSTGCLICRRRKKKCDEVKPTCTACKRNFLEC 38

>Scas_721.94
          Length = 869

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 2  RKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          + SA +  KR    K+  GC  C+ R+VKCD  +P C RC    + C
Sbjct: 36 KVSATSTGKRKFHNKSKQGCTHCKRRRVKCDELKPACRRCLNWNVPC 82

>ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH]
           complement(212832..215234) [2403 bp, 800 aa]
          Length = 800

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 2   RKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           + SA    KR +R  +  GC  C+ R++KCD  +P C +C +   EC
Sbjct: 178 KASAVGDPKRTKRKYSRNGCTECKRRRMKCDEGKPICWQCSRLNREC 224

>KLLA0A03421g 308414..311056 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 880

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 13/79 (16%)

Query: 1  MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKL 60
          M  + +   K  +R K    C  CR  K KCD ++P C RC +    C  YD+       
Sbjct: 1  METNQEANLKAKKRYKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC-IYDL------- 52

Query: 61 VKFDPYGVQLPPSPNGNSA 79
           ++ P    LP  PN ++A
Sbjct: 53 -EYQP----LPRKPNKDAA 66

>YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor
          required for induction of SPS19 and POX1 on
          oleate-containing medium, plays a role in peroxisome
          proliferation [3189 bp, 1062 aa]
          Length = 1062

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 7  TQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDI 53
          ++T   +R +    C  C   K KCD  +P C RC K GL+C  YD+
Sbjct: 52 SETHNRKRNRILFVCQACWKSKTKCDREKPECGRCVKHGLKC-VYDV 97

>AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp,
          735 aa]
          Length = 735

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLEC------GGYD 52
          GC TCR+R+ KCD  RP C+ C ++ L C      G YD
Sbjct: 49 GCLTCRARRKKCDETRPKCIGCQRNLLLCHWADDDGNYD 87

>Kwal_26.6805
          Length = 944

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDI 53
          RR +    C +CR  K KCD  +P C RC K G+ C  YD+
Sbjct: 21 RRNRLSFVCQSCRKGKTKCDRAKPSCSRCLKHGIRC-VYDV 60

>Kwal_23.6529
          Length = 598

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRW 57
          GC  C+  K+KCD ++P C +C K G +   Y + L+W
Sbjct: 13 GCINCKKSKIKCDEKKPMCGQCAKKGRDDCAYALVLQW 50

>KLLA0D05038g 433653..435674 weakly similar to sp|P40971
          Saccharomyces cerevisiae YDR034c LYS14 transcriptional
          activator of lysine pathway genes singleton, start by
          similarity
          Length = 673

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 7  TQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          T+  + +R  +  GC  C+ +KVKCD  +P C +C    LEC
Sbjct: 14 TEPAKKKRKYSKNGCLECKRKKVKCDETKPMCWQCTHLSLEC 55

>CAGL0M12298g complement(1225753..1228737) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 994

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 11 RPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDI 53
          R R   +F  C  CR  K +CD  +P C RC K  LEC  YD+
Sbjct: 18 RKRNRISFV-CQACRRSKTRCDKEKPICTRCKKLKLEC-VYDM 58

>Kwal_27.10232
          Length = 1209

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 20  GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
            C  CRS+K +CD +RP C +C   G EC
Sbjct: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101

>Scas_556.6
          Length = 1022

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDI 53
          +R +    C  CR  K KCD  +P C RC K  L C  YD+
Sbjct: 38 KRNRISFVCQECRKAKTKCDKEKPACTRCVKQNLAC-VYDV 77

>Kwal_23.2905
          Length = 881

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 8/55 (14%)

Query: 6  KTQTKRPRR--------AKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
          K Q+ R RR        +++   C  CR RKVKCD + P C RC  +   C   D
Sbjct: 26 KEQSNRKRRPTSAIMGISRSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSID 80

>CAGL0J07150g complement(686734..689802) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 1022

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDI 53
          +R +    C  CR  K KCD  +P C RC K G+ C  YD+
Sbjct: 15 KRNRLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRC-VYDL 54

>ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1432323..1434950) [2628 bp, 875 aa]
          Length = 875

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 21 CWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIK 54
          C  CR  K KCD  +P C RC + GL C GYDI+
Sbjct: 24 CIPCRKCKTKCDKLKPTCSRCAELGLYC-GYDIE 56

>Kwal_14.2619
          Length = 1167

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 24/38 (63%), Gaps = 3/38 (7%)

Query: 19 TGCWTCRSRKVKCDLRRPGCVRCD--KSGLECGGYDIK 54
          T C TCR RKVKCD  +P C+ C   KS  EC  Y++K
Sbjct: 10 TSCLTCRRRKVKCDRSKPVCLACIKYKSISEC-SYEVK 46

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
          Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 5/52 (9%)

Query: 1  MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
          +  +A T+ KR  +A     C  CR +K+KCD  +P C  C K G  C   D
Sbjct: 48 LMPTASTKVKRFSQA-----CDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSD 94

>Kwal_34.15751
          Length = 628

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 8  QTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          QT + ++ +    C  CR RK+KC+ ++P C RC K  L+C
Sbjct: 2  QTPKSKKNRISHVCDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
          Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 7  TQTKRPR-RAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGY 51
          +  KRP+ R K    C  CR RK+KCD ++P C  C +  L    Y
Sbjct: 22 SDCKRPKKRFKPLKSCAFCRKRKLKCDKQKPRCSSCARRNLPVCVY 67

>Kwal_23.6425
          Length = 735

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGL-EC 48
          +R K+   C  CR RK+KCD  RP C  C   GL EC
Sbjct: 28 KRRKSIKQCLFCRKRKLKCDKNRPVCGTCASRGLTEC 64

>ACL058W [991] [Homologous to NOHBY] complement(261723..264176)
          [2454 bp, 817 aa]
          Length = 817

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 6  KTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGY 51
          K Q KR RR      C  C  RKVKC+  RP C  C+K+   C  +
Sbjct: 26 KVQHKRQRRV---LNCMPCHKRKVKCNRARPVCDHCEKNRYACAYF 68

>Scas_550.5*
          Length = 832

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 8  QTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          Q K  R  +    C  CR++K++C+  RP C RC + G  C
Sbjct: 2  QKKSIRGQRPTHVCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
          R+ ++   C  CR +K+KCD  +P C  C K G  C   D
Sbjct: 21 RQERSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSD 60

>Scas_590.2
          Length = 1172

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 19 TGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          T C  CR RK KCD + P C  C K+ ++C
Sbjct: 39 TACLLCRRRKQKCDHQLPSCTACLKAAVKC 68

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
          complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
           C  CR +K+KCD  RP C  C K G +C   D
Sbjct: 28 ACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSD 60

>KLLA0A01804g complement(159689..162526) similar to sgd|S0002829
          Saccharomyces cerevisiae YDR421w positive transcription
          regulator of ARO9 and ARO10, start by similarity
          Length = 945

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 13/62 (20%)

Query: 5  AKTQTKRPRRAKTFTGCWTCRSRKVKCDL------RRPGCVRCDKSGLEC-------GGY 51
          ++T  K+    + +  C  C+ RKVKCDL        P CVRC +   EC       GG+
Sbjct: 8  SQTAPKKQTFKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTETKRGGF 67

Query: 52 DI 53
           +
Sbjct: 68 RV 69

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 11 RPRRAKTFTGCWTCRSRKVKCDLRRPGCVRC 41
          + +R +T   C  C+ RK+KCD +RP C  C
Sbjct: 18 KKKRQRTTVVCTNCKKRKIKCDRKRPACSNC 48

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIK 54
          +R +    C  CR  K KCD  +P C RC K+ ++C  YDI+
Sbjct: 24 KRNRISFVCQACRKSKTKCDREKPRCSRCAKNNVKC-VYDIE 64

>Scas_711.31
          Length = 932

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           C  CR +K+KCD R P C  C K+G+ C
Sbjct: 44 ACDRCRLKKIKCDDRTPDCTPCMKAGIPC 72

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
          Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 14 RAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLV 61
          R K    C  C+ RK KCD + P C  C K G EC  Y++ L+ S+LV
Sbjct: 5  RNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYEC-IYNVNLQ-SQLV 50

>YLR014C (PPR1) [3432] chr12 complement(172267..174981)
          Transcription factor regulating pyrimidine pathway,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2715 bp, 904 aa]
          Length = 904

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 15 AKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
          +K+ T C  CR +K+KCD   P C RC K  + C   D
Sbjct: 28 SKSRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLD 65

>Kwal_55.20674
          Length = 252

 Score = 39.3 bits (90), Expect = 0.007,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 4  SAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          S  T+  + R    FT C +CR RK KC   +P C RC +  + C
Sbjct: 5  SRATKMGKDRSGAMFT-CKSCRQRKRKCSREKPQCQRCARLSIPC 48

>Kwal_14.1636
          Length = 456

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 30/74 (40%), Gaps = 2/74 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVKFDPYGVQLPP 72
          RR KT   C  C    V C   RP C RC K GLE    D   +  K +   P   QLP 
Sbjct: 4  RRQKTSVACINCSKSHVTCQAERP-CTRCVKKGLEASCVDAPRKRRKYLADVP-DEQLPA 61

Query: 73 SPNGNSASNEEPQY 86
          +    S   E+  +
Sbjct: 62 AIKRGSTHEEQQHF 75

>Scas_521.2
          Length = 890

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 15 AKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
          +K+ + C  CRS+K+KCD + P C RC    + C   D
Sbjct: 35 SKSKSACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVD 72

>CAGL0H01507g complement(147689..150073) similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3, start by
          similarity
          Length = 794

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 19/35 (54%)

Query: 11 RPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSG 45
          R R+ K    C  CR RKV CD  RP C  C ++G
Sbjct: 4  RGRKMKKPPACAQCRRRKVGCDRVRPVCGNCARAG 38

>YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2361 bp, 786 aa]
          Length = 786

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 4  SAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSG 45
          S +T  K  +R K    C  CR RK++CD ++P C  C   G
Sbjct: 14 SEETVKKAQKRRKPIKSCAFCRKRKLRCDQQKPMCSTCKTRG 55

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGL-EC 48
          +R K    C  CR RK+KCD ++P C  C    L EC
Sbjct: 11 KRRKVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPEC 47

>Sklu_1622.2 YDR034C, Contig c1622 1522-3858
          Length = 778

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%)

Query: 10  KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           K  +R  +  GC  C+ R++KCD  +P C +C +   EC
Sbjct: 153 KISKRKYSRNGCTECKKRRMKCDEGKPSCWQCTRLNREC 191

>Scas_699.7
          Length = 935

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVK 62
           C  CR +K+KC   +P C +C K+  EC  Y  K R S L +
Sbjct: 12 ACDLCRVKKLKCSKEKPKCAKCLKNNWEC-CYSPKTRRSPLTR 53

>KLLA0C04620g complement(422705..426514) weakly similar to
          sp|Q05854 Saccharomyces cerevisiae YLR278c, start by
          similarity
          Length = 1269

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 5/38 (13%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLEC-----GGYD 52
           C  C+ RK KCD + P C  C K+G++C      GYD
Sbjct: 40 ACLLCQRRKQKCDHKIPSCTACLKAGVKCIQPAKYGYD 77

>KLLA0F02387g complement(213669..215852) similar to sp|P47988
          Saccharomyces cerevisiae YOR337w TEA1 TY1 enhancer
          activator, start by similarity
          Length = 727

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLR 56
           C  CR R+ KCDL  P C RC + GL C    + LR
Sbjct: 40 ACANCRRRRKKCDLEYP-CGRCQELGLGCNINKVDLR 75

>Sklu_2321.3 YLR014C, Contig c2321 8747-11467
          Length = 906

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 5/50 (10%)

Query: 8  QTKRPRRA-----KTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
          Q KRP  +     ++   C  CR +KVKCD + P C +C  +   C   D
Sbjct: 25 QKKRPSSSILGISRSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLD 74

>YCR106W (RDS1) [627] chr3 (310954..313452) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region, involved in resistance to cycloheximide [2499
          bp, 832 aa]
          Length = 832

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 3/40 (7%)

Query: 9  TKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           K+PR       C  C+  K KCD  RP C RC ++ L+C
Sbjct: 6  VKKPRLRLV---CLQCKKIKRKCDKLRPACSRCQQNSLQC 42

>KLLA0D12650g complement(1073580..1075535) weakly similar to
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 651

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 3  KSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
          KS+ T     R ++   GC TCR R  KCD ++P C  C ++ L C   D
Sbjct: 17 KSSATTLVEKRSSR---GCLTCRDRHKKCDEKKPLCSGCKENFLRCVWRD 63

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
          (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 14 RAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGL-EC 48
          R K    C  CR R+VKC+  RP C  C   GL EC
Sbjct: 12 RRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGLPEC 47

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
          Transcription factor required for induction of
          peroxisomal proteins in response to oleic acid [2991
          bp, 996 aa]
          Length = 996

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDI 53
          +R +    C  CR  K KCD  +P C RC K  L C  YD+
Sbjct: 17 KRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYDV 56

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 975

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIK 54
          +R +    C  CR  K KCD  +P C RC K  L+C  YD++
Sbjct: 27 KRQRISFVCQACRKNKTKCDREKPRCGRCVKYHLKC-VYDVE 67

>Scas_588.11
          Length = 835

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 11 RPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGL-ECGGYDIKLRWSKLVKFDPYGVQ 69
          R R+ +    C  CR RK+ CD  +P C  C K+   +C   DI  R+       P  + 
Sbjct: 4  RGRKMRKPPACVQCRKRKIGCDRVKPICGNCRKTNKGDCFFPDIPGRYVPAHSKGPSKLL 63

Query: 70 LPPSPNGNSASN 81
            P+P+  S  N
Sbjct: 64 STPTPSQYSRDN 75

>Kwal_56.23058
          Length = 775

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%)

Query: 4   SAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           S+    K  +R  +  GC  C+ R++KCD  +P C +C +   EC
Sbjct: 132 SSGADGKTVKRKYSRNGCTECKRRRMKCDEGKPTCWQCARLNREC 176

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region, putative transcription
          factor [2895 bp, 964 aa]
          Length = 964

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 1  MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          M + A+   +  +R +    C  CR +KVKCD ++P C+ C     EC
Sbjct: 1  MPEQAQQGEQSVKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

>YHR178W (STB5) [2464] chr8 (459297..461528) Probable
          transcriptional activator of multidrug resistance genes
          such as PDR5 and SNQ2 [2232 bp, 743 aa]
          Length = 743

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 19/41 (46%)

Query: 8  QTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          Q  R +R      C  CR  K KC  + P C  CDK+G  C
Sbjct: 9  QGGRSQRTTELYSCARCRKLKKKCGKQIPTCANCDKNGAHC 49

>AFR171W [3363] [Homologous to NOHBY] complement(752592..754430)
          [1839 bp, 612 aa]
          Length = 612

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 12 PRRAK-TFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           RR+K +  GC  C+ RKVKCD  +P C +C   G  C
Sbjct: 12 ARRSKYSKNGCSECKRRKVKCDETKPACWQCSHLGKRC 49

>Scas_720.58
          Length = 890

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVK 62
           C  CR +K+KC    P C +C K+G++C  Y  K++ S L +
Sbjct: 19 ACDNCRLKKLKCSKETPKCSKCLKNGMKC-LYSPKVKRSPLTR 60

>KLLA0E19701g complement(1739869..1741914) some similarities with
          sp|P26370 Saccharomyces cerevisiae YDL170w UGA3
          transcriptional activator for GABA catabolic genes
          singleton, hypothetical start
          Length = 681

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 5  AKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          ++ + KR R +K   GC TC+ RK +C   RP C  C +  L+C
Sbjct: 6  SEGEPKRRRHSKK--GCLTCKVRKKRCSEDRPICKDCARLSLDC 47

>Scas_630.14
          Length = 701

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 1  MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
          + K+AK++    +R +    C  CR RK KCD  +P C  C   G++   YD
Sbjct: 6  ITKAAKSKDGIRKRNRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYD 57

>Kwal_47.17233
          Length = 948

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 18/39 (46%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGY 51
          RR +    C  C  RK+KC    P C +C K   EC  +
Sbjct: 27 RRQRKILSCVPCHKRKIKCTRETPSCSKCLKKNWECSYF 65

>Kwal_47.17681
          Length = 854

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 3/46 (6%)

Query: 11 RPRRAKTFTGCWTCRSRKVKCD--LRRPGCVRCDKSGLECGGYDIK 54
          R R+ +T   C  C  RKV+CD  +R P C  C   GL C   D+K
Sbjct: 9  RVRKPRTNRACEVCHDRKVRCDANIRVP-CTSCQTFGLVCRLRDVK 53

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp,
          601 aa]
          Length = 601

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 24/48 (50%)

Query: 1  MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          M ++     K+ +   +  GC  C+    KCD  +P C++C K  +EC
Sbjct: 1  MLQNTGVVMKKRKSPYSRKGCLQCKKSHTKCDETKPACLKCVKRNVEC 48

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
          complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 24/48 (50%), Gaps = 4/48 (8%)

Query: 1  MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          M +SA    KR R  +    C  CR +KVKCD R P C+ C     EC
Sbjct: 1  MSESAGLGLKRRRVTR---ACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

>CAGL0G09757g 930351..934622 some similarities with sp|Q05854
          Saccharomyces cerevisiae YLR278c, hypothetical start
          Length = 1423

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 21 CWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          C  CR RK +CD + P C  C K+ ++C
Sbjct: 41 CLLCRRRKQRCDHKLPSCTACLKAAVKC 68

>Scas_662.8
          Length = 906

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 6  KTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          +T+ +  +R +    C  CR +KVKCD ++P C+ C     EC
Sbjct: 22 QTEHQIVKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

>AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH]
           (975879..978518) [2640 bp, 879 aa]
          Length = 879

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 5   AKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           A T+TK   R +    C  CR++K++C+   P CV C+K  L C
Sbjct: 65  AMTETKTVMRKRVSKACDICRAKKIRCNGEEP-CVNCEKFNLGC 107

>Scas_661.23
          Length = 741

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%)

Query: 8   QTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           +T   +R  +  GC  C+ R++KCD  +P C +C +   EC
Sbjct: 119 KTNIVKRKYSRNGCAECKRRRMKCDETKPICWQCARLSREC 159

>YLR266C (PDR8) [3660] chr12 complement(675621..677726)
          Zn[2]-Cys[6] zinc finger transcription factor, likely
          involved in pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 10 KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRC 41
          K+ +R K    C  CR RK+KC   RP C +C
Sbjct: 20 KKGKRRKVIKSCAFCRKRKLKCSQARPMCQQC 51

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
          Saccharomyces cerevisiae YKR064w singleton, start by
          similarity
          Length = 657

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 18/36 (50%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          +R +    C  CR RK KCD  +P C  C K G  C
Sbjct: 13 KRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETC 48

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
          Transcription factor involved in drug-induced
          transcriptional regulation, including activation of
          multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 21/45 (46%)

Query: 7  TQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGY 51
          T T   +R K    C  CR RK++CD ++P C  C    L    Y
Sbjct: 40 TSTSGKKRNKLIKSCGFCRRRKLRCDQQKPMCSTCISRNLTTCQY 84

>YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2118 bp, 705 aa]
          Length = 705

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 19/38 (50%)

Query: 4  SAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRC 41
          S K +  R  R K    C  CR RK+KCD  RP C  C
Sbjct: 7  SQKKKLDRQSRRKPAKSCHFCRVRKLKCDRVRPFCGSC 44

>Scas_526.3
          Length = 1109

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           C  CR RK +CD + P C  C K+ ++C
Sbjct: 40 SCLLCRRRKQRCDHKMPSCTACLKAAVKC 68

>KLLA0A09119g complement(797533..800781) weakly similar to
          sp|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor, start by similarity
          Length = 1082

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 29/67 (43%), Gaps = 13/67 (19%)

Query: 2  RKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLV 61
          R S    T +PRR K    C +CR +K+KC    P C  C+  G EC           + 
Sbjct: 37 RDSNGNGTGKPRR-KVSRACDSCRKKKIKCSGTLP-CKSCETYGCEC-----------VY 83

Query: 62 KFDPYGV 68
             PYGV
Sbjct: 84 SHAPYGV 90

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 5/42 (11%)

Query: 10  KRPRRAKTFTGCWTCRSRKVKCDLRRP---GCVRCDKSGLEC 48
           K  RRA     C  CR RK KCD   P    C  C K+G++C
Sbjct: 169 KEKRRAAK--ACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>Kwal_56.24670
          Length = 643

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          +R    TGC  C+ RK +C   +P C  C++ G  C
Sbjct: 19 KRTHRKTGCIPCKIRKKRCSEHKPTCTDCERLGFTC 54

>Sklu_2301.1 , Contig c2301 1246-2795 reverse complement
          Length = 517

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%)

Query: 15 AKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
          +++   C  CR++K KCD   P C RC   G  C   D
Sbjct: 34 SRSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVD 71

>CAGL0K11902g complement(1148381..1150876) similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes, hypothetical start
          Length = 831

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 13  RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           +R  +  GC  C+ R++KCD  +P C +C +   +C
Sbjct: 196 KRKYSRNGCAECKRRRMKCDESKPKCWQCTRLNRDC 231

>YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [3174 bp, 1057 aa]
          Length = 1057

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 16 KTFTGCWTCRSRKVKCDLRR---PGCVRCDKSGLEC 48
          +  T C  CR  K+KCD  +     C RC+K GL C
Sbjct: 52 RPVTSCTHCRQHKIKCDASQNFPHPCSRCEKIGLHC 87

>Scas_625.5
          Length = 1141

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 4   SAKTQTKRPRRAKTFTGCWTCRSRKVKCDL--RRPGCVRCDKSGLECGGYDIKLR 56
           +A   + + +R K    C  CR +K+KCD    +  C  C ++G +C    + L+
Sbjct: 58  AASNSSSQKKRTKASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPLK 112

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
           transcription factor, in conjunction with Pdr3p
           regulates the expression of a network of genes involved
           in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 11/82 (13%)

Query: 11  RPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC------GGYDIK-LRWSKLVKF 63
           R  R+K    C  CR RK+KC+ + P C  C+    EC      GG  IK L  + L   
Sbjct: 36  RKPRSKVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFSTRQGGARIKNLHKTSL--- 91

Query: 64  DPYGVQLPPSPNGNSASNEEPQ 85
           +   VQ+    + +S S   PQ
Sbjct: 92  EGTTVQVKEETDSSSTSFSNPQ 113

>YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger
           transcription factor, in conjunction with Pdr1p
           regulates the expression of a network of genes involved
           in multiple drug resistance [2931 bp, 976 aa]
          Length = 976

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 51/122 (41%), Gaps = 20/122 (16%)

Query: 8   QTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVKFD--- 64
           + K+  R+K  T C  CR RK+KC  + P C  C      C    + L+     K D   
Sbjct: 2   KVKKSTRSKVSTACVNCRKRKIKCTGKYP-CTNCISYDCTC----VFLKKHLPQKEDSSQ 56

Query: 65  --PYGVQLPPSPNGNSASNEEPQYQRRNIDFVKYKEEYIFHEDMDDEL------SILHAP 116
             P     PPS + N  ++ + Q+    I   K   +Y F + M+D +      S  HAP
Sbjct: 57  SLPTTAVAPPSSHANVEASADVQHLDTAI---KLDNQYYF-KLMNDLIQTPVSPSATHAP 112

Query: 117 PT 118
            T
Sbjct: 113 DT 114

>KLLA0C10923g complement(939148..941475) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 775

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%)

Query: 16 KTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLR 56
          ++   C  CR RK+KCD + P C +C ++   C   D   R
Sbjct: 15 RSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTR 55

>YDR034C (LYS14) [885] chr4 complement(509732..512104)
           Transcriptional activator of lysine pathway genes with
           2-aminoadipate semialdehyde as coinducer [2373 bp, 790
           aa]
          Length = 790

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 13  RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           +R  +  GC  C+ R++KCD  +P C +C +   +C
Sbjct: 151 KRKYSRNGCSECKRRRMKCDETKPTCWQCARLNRQC 186

>CAGL0G08844g complement(846590..849133) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, hypothetical start
          Length = 847

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          +R K    C  CR +KVKCD  +P C+ C     EC
Sbjct: 12 KRRKVTRACDDCRKKKVKCDGNQP-CIHCTVYSYEC 46

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 4/44 (9%)

Query: 5  AKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          ++ Q+KR R  +    C  CR +KVKCD ++P C+ C     EC
Sbjct: 2  SEPQSKRRRVTR---ACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

>Kwal_27.10852
          Length = 1046

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 39/97 (40%), Gaps = 25/97 (25%)

Query: 12  PRRAKTFTGCWTCRSRKVKCDLRR--PG-CVRCDKSGLECGGYDIKLRWSKLVKFDPYGV 68
           P   +  T C  CR  K+KC+     P  C RC++ GL C   D   R  K       G 
Sbjct: 91  PTGHRPVTSCTHCRQHKIKCNANDNFPAPCSRCERMGLHC-EIDPGFRPKK-------GS 142

Query: 69  QLPPSPNGNSASNEEPQYQRRNIDFVKYKEEYIFHED 105
           QL              Q  R ++D +K K EY+ H +
Sbjct: 143 QL--------------QSLRNDVDELKLKIEYLTHNE 165

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          +R +    C  CR +KVKCD ++P C+ C     EC
Sbjct: 6  KRRRVTRACDECRKKKVKCDGKQP-CIHCTVYNYEC 40

>Scas_657.3
          Length = 856

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 17/33 (51%)

Query: 19 TGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGY 51
          T C  CR RK+KCD +RP C  C    L    Y
Sbjct: 43 TSCAFCRQRKLKCDQKRPICSTCIGRKLTTCVY 75

>Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement
          Length = 777

 Score = 37.0 bits (84), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 11 RPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSG 45
          R R+ K    C  CR RK+ CD  +P C  C ++G
Sbjct: 6  RGRKMKKPPACVQCRKRKIGCDRAKPICGNCLRNG 40

>Scas_702.7
          Length = 1113

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 7  TQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIK 54
           + KRPR+ K    C  CR RK+KC    P C  C     EC   D+K
Sbjct: 24 VKIKRPRK-KVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIFDDLK 69

>ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH]
          complement(1355410..1357515) [2106 bp, 701 aa]
          Length = 701

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 9  TKRPRRAKTFTG-------CWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLR 56
          T+ P   +++TG       C  CR R+ KCDL  P C  C +  LEC   D  LR
Sbjct: 28 TEEPAERESYTGVSKKRLACTNCRRRRKKCDLNYP-CSSCLRLKLECNVNDEDLR 81

>AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C
          (RSC30) - SH] (246899..249328) [2430 bp, 809 aa]
          Length = 809

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 11 RPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSG-LECGGYDIKLRWSKLVKFDPYGVQ 69
          R R+ K    C  CR RK+ CD  +P C  C ++G  +C   DI   +++       G  
Sbjct: 6  RGRKMKKPPACVQCRKRKIGCDRAKPLCGNCVRNGKSDCFYPDIPGVYAQ----SGGGGA 61

Query: 70 LPPSPNGNSASNEE 83
           PP  +   AS E+
Sbjct: 62 TPPGKSAELASVEQ 75

>Kwal_23.4754
          Length = 812

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          +R +    C  CR +KVKCD ++P C+ C     EC
Sbjct: 7  KRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

>Scas_659.10
          Length = 757

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 20/41 (48%)

Query: 1  MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRC 41
          M  S+       RR K    C  CR RK+KCD  +P C +C
Sbjct: 1  MGSSSTQNIGFKRRRKPIKSCAFCRGRKLKCDKNKPICNQC 41

>KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces
           cerevisiae YDR034c LYS14 transcriptional activator of
           lysine pathway genes singleton, start by similarity
          Length = 768

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 23/45 (51%)

Query: 4   SAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           S     K  +R  +  GC  C+ R++KCD  +P C +C +   +C
Sbjct: 138 STDADGKIVKRKYSRNGCLECKKRRMKCDEGKPTCWQCARLNRKC 182

>CAGL0M03025g complement(341849..345613) similar to sp|P39113
          Saccharomyces cerevisiae YMR280c CAT8 transcription
          factor involved in gluconeogenesis, hypothetical start
          Length = 1254

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           C  CR +K KCD + P C +C   G EC
Sbjct: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFEC 87

>YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Component
          of the abundant RSC chromatin remodeling complex [2658
          bp, 885 aa]
          Length = 885

 Score = 37.0 bits (84), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 11 RPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSG-LECGGYDI 53
          R R+ K    C  CR RK+ CD  +P C  C K   ++C   D+
Sbjct: 4  RGRKMKKPPACVQCRKRKIGCDRVKPICGNCMKHNKMDCFYPDV 47

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
          aa]
          Length = 696

 Score = 36.6 bits (83), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 8  QTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          ++K+P+   +  GC  C+   +KCD  +P C  C K  + C
Sbjct: 48 KSKKPKVQYSRKGCSQCKKSHIKCDKVQPLCTTCAKKNILC 88

>KLLA0C01023g 76863..78773 similar to sgd|S0002928 Saccharomyces
          cerevisiae YDR520c, hypothetical start
          Length = 636

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 2/51 (3%)

Query: 1  MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLR--RPGCVRCDKSGLECG 49
          M    K  T RPR+ +    C  CR  K +CD       C RC    L+C 
Sbjct: 1  MATEEKQTTIRPRKKRKTYSCELCRKFKTRCDFEPSEGKCYRCRMLNLDCS 51

>Scas_709.51
          Length = 759

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 10 KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          ++ +R +    C  C+ RKVKCD  +P C+ C K  ++C
Sbjct: 23 RKKQRIRVQRACNICKRRKVKCDGNKP-CLNCIKKEIDC 60

>KLLA0F18084g complement(1652031..1654613) no similarity,
          hypothetical start
          Length = 860

 Score = 36.6 bits (83), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           C  CR  + KCD  +P C RC K  ++C
Sbjct: 4  SCQNCRKTRRKCDRGKPTCARCIKYKIDC 32

>Scas_715.3
          Length = 1115

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 16  KTFTGCWTCRSRKVKCDLRR--PG-CVRCDKSGLEC 48
           +  T C  CR +K+KCD  +  P  C RC K  L+C
Sbjct: 101 RPVTSCSHCRQQKIKCDASQNFPAPCSRCQKMALQC 136

>YPL248C (GAL4) [5202] chr16 complement(79711..82356)
          Transcription factor involved in expression of
          galactose-induced genes, phosphorylation correlates
          with activity [2646 bp, 881 aa]
          Length = 881

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVK 62
           C  CR +K+KC   +P C +C K+  EC  Y  K + S L +
Sbjct: 10 ACDICRLKKLKCSKEKPKCAKCLKNNWEC-RYSPKTKRSPLTR 51

>Scas_449.1
          Length = 636

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query: 12 PRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          P+R +    C  CR R+ KCDL  P C  C + GL C
Sbjct: 30 PKRKRL--ACSNCRRRRKKCDLNFP-CANCIRLGLNC 63

>KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA
           Kluyveromyces lactis SUPPRESSOR PROTEIN SEF1, start by
           similarity
          Length = 1138

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 38/89 (42%), Gaps = 25/89 (28%)

Query: 16  KTFTGCWTCRSRKVKCDL--RRPG-CVRCDKSGLECGGYDIKLRWSKLVKFDPYGVQLPP 72
           +  T C  CR  K+KC+   + P  C RC++ GL C   D + R  K       G QL  
Sbjct: 132 RPVTSCTHCRQHKIKCNASEKFPAPCSRCERMGLHC-EIDPQFRPKK-------GSQL-- 181

Query: 73  SPNGNSASNEEPQYQRRNIDFVKYKEEYI 101
                       Q  R ++D +K K EY+
Sbjct: 182 ------------QSLRNDVDELKVKIEYL 198

>AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)
          [3321 bp, 1106 aa]
          Length = 1106

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 21 CWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          C  C+ RK +CD + P C  C K+G+ C
Sbjct: 41 CLLCQRRKQRCDHKIPSCTACLKAGVRC 68

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
          activator of gluconeogenic genes through CSRE elements,
          activated by Snf1p kinase, contains a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 16/33 (48%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
           C  CR +K+KCD  +P C  C K    C   D
Sbjct: 45 ACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSD 77

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          +R +    C  C+ RK+KCD  +P C  C K+ ++C
Sbjct: 20 QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC 54

>YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein
          with weak similarity to Put3p and other transcription
          factors, has a Zn[2]-Cys[6] fungal-type binuclear
          cluster domain in the N-terminal region [2277 bp, 758
          aa]
          Length = 758

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 1/48 (2%)

Query: 1  MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          + + A T   +P + +    C  CR RKV+C    P C  C  +  EC
Sbjct: 27 LSRDAGTNELKPTKGRAHRACIACRKRKVRCSGNIP-CRLCQTNSYEC 73

>Kwal_26.8109
          Length = 970

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%)

Query: 13 RRAKTFTGCWTCRSRKVKCDL--RRPGCVRCDKSGLEC 48
          RR+KT   C  CR +K +CD     P C  C +    C
Sbjct: 31 RRSKTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTC 68

>KLLA0C03201g complement(286973..288925) similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, start by similarity
          Length = 650

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 7  TQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          T    P R K    C +C+ RKV+CD + P C  C  + ++C
Sbjct: 22 TNQLEPVRHKVKHACSSCKERKVRCDGQSP-CASCINARVKC 62

>AFL031W [3162] [Homologous to ScYBR239C - SH]
          complement(376161..377714) [1554 bp, 517 aa]
          Length = 517

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 10 KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLE 47
          K  +R KT   C  C    V C+ +RP C RC K GLE
Sbjct: 8  KAAKRKKTNVACVNCSRSHVTCESQRP-CTRCVKKGLE 44

>AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH]
           complement(1412347..1415502) [3156 bp, 1051 aa]
          Length = 1051

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 16  KTFTGCWTCRSRKVKCDLRR---PGCVRCDKSGLEC 48
           +  T C  CR  K+KC+        C RC++ GL+C
Sbjct: 87  RPVTSCTHCRQHKIKCNASENFPSSCSRCERMGLQC 122

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 4   SAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIK 54
           +A ++     R +    C  C+ RKVKCD   P C+ C K   EC  YD K
Sbjct: 70  TAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC-RYDFK 118

>CAGL0L03377g complement(382932..386561) some similarities with
          sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
          interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
           C  CRS+K+KCD  +P C  C K G  C   D
Sbjct: 28 ACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSD 59

>CAGL0D03850g 384689..387193 weakly similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3 or sp|P38781
          Saccharomyces cerevisiae YHR056c, hypothetical start
          Length = 834

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 18/38 (47%)

Query: 8  QTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSG 45
          Q    ++ K    C  CR RK+ CD  +P C  C K G
Sbjct: 3  QAVLTKKVKKPPACQQCRRRKIGCDRGKPICGNCLKQG 40

>Scas_542.8
          Length = 902

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 2/42 (4%)

Query: 7  TQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          T+    RR K+   C  CR R +KC    P C RC K  L+C
Sbjct: 16 TEPSSKRRPKSL-ACILCRKRHIKCSGGNP-CARCIKHDLKC 55

>Scas_669.8
          Length = 637

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLE 47
           R KT   C  C+ RKVKCD   P C  C + GLE
Sbjct: 8  ERRKTPYACNVCKKRKVKCDKLIP-CTSCIQKGLE 41

>KLLA0E02618g 244696..248025 no similarity, hypothetical start
          Length = 1109

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 10/55 (18%)

Query: 2  RKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRR-------PG-CVRCDKSGLEC 48
          R S    +++ + AK    C  CR RK+KCD          PG C  C +S LEC
Sbjct: 10 RDSRHPDSRKRKVAKR--ACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLEC 62

>KLLA0D00396g complement(36277..37362) some similarities with
          ca|CA2346|CaSEF1 Candida albicans Putative
          transcription factor1, hypothetical start
          Length = 361

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 16 KTFTGCWTCRSRKVKCDL--RRPG-CVRCDKSGLEC 48
          K    C  CR  KVKCD    RPG C  C K GL C
Sbjct: 3  KPLRSCTRCRKNKVKCDSANTRPGPCTACSKRGLVC 38

>YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2310 bp, 769 aa]
          Length = 769

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 21 CWTCRSRKVKCDLRRPGCVRCDKSGLECG 49
          C  C+ RK+KCD   P C +C  S   C 
Sbjct: 15 CLRCKQRKIKCDKLWPTCSKCKASSSICS 43

>Scas_688.17
          Length = 769

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 15/31 (48%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDK 43
          R+ K    C  CR RK+ CD   P C  C K
Sbjct: 9  RKPKKNPACIQCRKRKIGCDRGHPKCGNCIK 39

>KLLA0F25630g 2378464..2381487 some similarities with sp|P32862
           Saccharomyces cerevisiae YKL038w RGT1 regulator of
           glucose-induced genes, hypothetical start
          Length = 1007

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 7/55 (12%)

Query: 9   TKRPRRAKTFTGCWTCRSRKVKCDLRR-------PGCVRCDKSGLECGGYDIKLR 56
           T+  RR+K    C  CR +K+KCD            C  C K G +C    I L+
Sbjct: 105 TESRRRSKVSRACDQCRKKKIKCDFIEGHDINPDQSCTGCRKIGEKCSFERIPLK 159

>KLLA0E14036g complement(1239566..1241602) some similarities with
          ca|CA4758|CaPPR1 Candida albicans transcription factor
          regulating pyrimidine pathway (by homology),
          hypothetical start
          Length = 678

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 20/42 (47%)

Query: 11 RPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
          + RR      C  C+ R+ +CD   P C  C  +G++C   D
Sbjct: 57 KKRRKNQGVACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVD 98

>YDR520C (YDR520C) [1333] chr4 complement(1481073..1483391) Protein
           containing a fungal Zn(2)-Cys(6) binuclear cluster
           domain, which act as transcriptional regulators [2319
           bp, 772 aa]
          Length = 772

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 2/42 (4%)

Query: 10  KRPRRAKTFTGCWTCRSRKVKCDLR--RPGCVRCDKSGLECG 49
           K+PR+ +    C TCR  K +CD       C RC+   L+C 
Sbjct: 61  KKPRKKRKTFSCDTCRRVKTRCDFEPFIGKCYRCNVLQLDCS 102

>Kwal_47.18089
          Length = 745

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGL-EC 48
           C  CR RK+KCD +RP C  C    L EC
Sbjct: 28 SCTFCRHRKLKCDHKRPMCGSCAARKLPEC 57

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive
          regulator of the maltose pathway MAL genes, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           C  CR R+VKCD  RP C RC +  L C
Sbjct: 7  SCDCCRVRRVKCDRNRP-CDRCRQRNLRC 34

>CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces
          cerevisiae YDR421w positive transcription regulator of
          ARO9 and ARO10, hypothetical start
          Length = 928

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 6/54 (11%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLR------RPGCVRCDKSGLECGGYDIKLRWSKL 60
          +   TF  C  C+ +K+KCDL        P C  C +S   C     K++  KL
Sbjct: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKL 83

>AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH]
          (130842..132788) [1947 bp, 648 aa]
          Length = 648

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 14 RAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVK 62
          R      C +CR RK+KC    P C +C +    C  Y  K+R S L +
Sbjct: 2  RPPVIQACDSCRRRKMKCSKTFPKCAKCREDNRVC-LYSPKIRRSPLTR 49

>YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in
          regulation of glucose transporters, acts as a
          transcriptional repressor that is converted to an
          activator upon glucose-induced phosphorylation [3513
          bp, 1170 aa]
          Length = 1170

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 1  MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLR--RPGCVRCDKSGLEC 48
          M  +A       +R K    C  CR +K+KCD +  +  C  C ++G  C
Sbjct: 27 MDSAAAASHAIKKRTKASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRC 76

>ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109
          aa]
          Length = 109

 Score = 32.3 bits (72), Expect = 0.36,   Method: Composition-based stats.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 8/44 (18%)

Query: 8  QTKRPRRAKTFTGCWTCRSRKVKCD--LRRPG-CVRCDKSGLEC 48
          + K+P R+     C  CR  K+KCD   RRP  C  C K G+ C
Sbjct: 23 KMKKPLRS-----CVRCRKNKIKCDSATRRPKPCSSCLKKGVGC 61

>YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component
          of the abundant RSC chromatin remodeling complex [2652
          bp, 883 aa]
          Length = 883

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDK 43
          R+ +    C  CR RK+ CD  +P C  C K
Sbjct: 7  RKVRKPPACTQCRKRKIGCDRAKPICGNCVK 37

>CAGL0D02904g complement(302952..305615) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 887

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYD 52
           C  CR +KVKCD   P C  C ++ + C   D
Sbjct: 24 ACKLCRRKKVKCDQGYPSCKGCLRNNVPCVSVD 56

>CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces
          cerevisiae YKL038w RGT1, hypothetical start
          Length = 1287

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 30/73 (41%), Gaps = 15/73 (20%)

Query: 13 RRAKTFTGCWTCRSRKVKCD--LRRPGCVRCDKSGLECGGYDIKLRWSKLVKFDPYGVQL 70
          +R      C  CR +K+KCD    R  C  C ++G  C             KF+   ++ 
Sbjct: 8  KRTNVSRACDQCRRKKIKCDRNQERNICTSCQRNGERC-------------KFERVPLKR 54

Query: 71 PPSPNGNSASNEE 83
           PS   + AS+ E
Sbjct: 55 GPSKGAHKASDPE 67

>Kwal_14.819
          Length = 568

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 16/32 (50%)

Query: 17 TFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          +   C  CR RKV+C  + P C  C K   EC
Sbjct: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43

>CAGL0H00396g complement(37005..39827) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 940

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 3/32 (9%)

Query: 20 GCWTCRSRKVKCDLRRPG---CVRCDKSGLEC 48
           C  CR +K KCD        C RC K G+ C
Sbjct: 57 ACVECRQQKSKCDAHDKAPEPCTRCQKKGVPC 88

>KLLA0F10835g 997512..999782 no similarity, hypothetical start
          Length = 756

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 5/43 (11%)

Query: 6  KTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          K +T+  R+     GC  C+   +KCD  +P C +C K  + C
Sbjct: 14 KRKTRYSRK-----GCLQCKRSHLKCDEGQPKCGKCVKRNISC 51

>CAGL0F07755g complement(755947..757782) similar to sp|P40969
          Saccharomyces cerevisiae YMR168c CEP3 kinetochore
          protein complex, start by similarity
          Length = 611

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 10 KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLE 47
          +RP   K+   C  C  RKVKCD   P C  C K G E
Sbjct: 3  QRPLPTKSNRPCSVCSKRKVKCDRLVP-CGHCRKRGTE 39

>Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement
          Length = 875

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLE 47
          RR +    C  C+ RK KCD ++P C  C + G E
Sbjct: 5  RRNRPTVVCSNCKRRKSKCDKQKPACSNCVRLGDE 39

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
          regulatory protein, contains a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           C  CR R+VKCD +RP C  C ++ L+C
Sbjct: 12 ACDCCRIRRVKCDGKRP-CSSCLQNSLDC 39

>Scas_685.22
          Length = 777

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 2/42 (4%)

Query: 10 KRPRRAKTFTGCWTCRSRKVKCDLRRP--GCVRCDKSGLECG 49
          KRPR+ +    C  CR  K +CD       C RC    L+C 
Sbjct: 52 KRPRKKRKTFSCDVCRKFKTRCDFEVTVGKCHRCHVLQLDCS 93

>KLLA0A02585g complement(226562..227674) some similarities with
          ca|CA5890|CaFCR1 Candida albicans Zinc cluster
          transcription factor, hypothetical start
          Length = 370

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 23/47 (48%), Gaps = 4/47 (8%)

Query: 2  RKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          R SA+  T + R +K    C  CR  K KCD  RP C RC K    C
Sbjct: 6  RSSAELPTIKRRVSK---ACDACRKSKTKCDGERP-CSRCLKENKLC 48

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
          cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 13/21 (61%)

Query: 21 CWTCRSRKVKCDLRRPGCVRC 41
          C  CR RK+KCD  RP C  C
Sbjct: 40 CAFCRRRKLKCDNARPMCSTC 60

>Kwal_47.17506
          Length = 924

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 11 RPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          + +R+K    C  CR RK+KC   +P C+ C     EC
Sbjct: 9  KKKRSKVSRACNNCRRRKIKCTGAQP-CLNCQTYRCEC 45

>KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces
          cerevisiae YNR063w singleton, hypothetical start
          Length = 591

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           C  C+ RK KCD ++P C RC K  ++C
Sbjct: 2  ACLECKKRKQKCDGQKP-CRRCTKLNVKC 29

>YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activator
           of the Gal4p-type family of DNA-binding proteins [2280
           bp, 759 aa]
          Length = 759

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 20  GCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLR 56
            C  CR+R+ KCDL  P C  C +  L C   D  LR
Sbjct: 69  ACTNCRNRRKKCDLGFP-CGNCSRLELVCNVNDEDLR 104

>KLLA0F02750g complement(250368..253814) some similarities with
          sgd|S0005449 Saccharomyces cerevisiae YOL089c HAL9
          transcriptional activator of ENA1, hypothetical start
          Length = 1148

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 3/47 (6%)

Query: 5  AKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRP---GCVRCDKSGLEC 48
          A+  T +P + +    C  CR RK+KCD   P    C  C K  + C
Sbjct: 18 AEGVTTKPAKKRVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPC 64

>Scas_691.32
          Length = 906

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 4/39 (10%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPG---CVRCDKSGLEC 48
          +R + F  C  CR +K KCD        C +C K G+ C
Sbjct: 39 KRKRKF-ACVECRQQKSKCDAYEKAPDPCTKCQKKGVPC 76

>YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1824 bp, 607 aa]
          Length = 607

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 8  QTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRC 41
          ++K  R+      C  CR RK+KCD  +P C RC
Sbjct: 3  RSKDARKRSISLACTVCRKRKLKCDGNKP-CGRC 35

>Kwal_55.21884
          Length = 882

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 5/43 (11%)

Query: 9  TKRPRRAKTFTGCWTCRSRKVKCDLRRPG---CVRCDKSGLEC 48
          ++R RR K    C  CR +K KCD        C RC K  + C
Sbjct: 21 SRRGRRKKL--ACVECRQQKSKCDAHEKAPEPCTRCAKKNVAC 61

>Kwal_33.13118
          Length = 779

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 3  KSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLR--RPGCVRCDKSGLECG 49
          +S +  +++PR+ +    C  CR  K +CD       C RC    L+C 
Sbjct: 39 ESDRESSRKPRKKRKTYSCEVCRKFKTRCDFEPLVGRCHRCSVLKLQCS 87

>Kwal_26.7448
          Length = 714

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 4/50 (8%)

Query: 6   KTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRC----DKSGLECGGY 51
           K +  R R   +  GC  C+ R++KCD   P C  C    +K   +C  Y
Sbjct: 80  KKRITRRRHRNSRLGCDECKRRRIKCDETLPECNNCKNRHNKGPSQCCSY 129

>KLLA0D10593g complement(900326..903103) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 925

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 5/42 (11%)

Query: 10 KRPRRAKTFTGCWTCRSRKVKCDL--RRPG-CVRCDKSGLEC 48
          K P++ K    C  CR +K KCD   R P  C RC K G+ C
Sbjct: 40 KMPQKKKL--ACVECRQQKSKCDAHERAPEPCSRCLKKGVPC 79

>KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces
          cerevisiae YBR239c, start by similarity
          Length = 507

 Score = 33.1 bits (74), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 25/59 (42%), Gaps = 2/59 (3%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVKFDPYGVQLP 71
          R  K    C  C    V CD  RP C RC + GLE    D   +  K ++  P   QLP
Sbjct: 5  RNKKVSVACVHCAKSHVTCDDNRP-CTRCIRKGLEESCIDAPRKKVKYLRDVPED-QLP 61

>KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces
          cerevisiae YKL015w PUT3 positive activator of the
          proline utilisation pathway, start by similarity
          Length = 865

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 10 KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          K+ +  ++   C  CR R +KC    P C +C K+G+ C
Sbjct: 35 KKKKVKRSSLACTRCRRRHIKCPGGNP-CSKCLKAGVAC 72

>KLLA0C14212g complement(1229219..1232341) some similarities with
           sp|P25611 Saccharomyces cerevisiae YCR106w, hypothetical
           start
          Length = 1040

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 1/36 (2%)

Query: 13  RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           +R +    C+ CR RK +CD   P C +C     EC
Sbjct: 67  KRNRVSYVCYACRRRKTRCDRGNP-CSKCVALSTEC 101

>Scas_516.9
          Length = 601

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 6/57 (10%)

Query: 675 EFTEICLNFEKRLLKWKPEWAFYKENTDEFIDDTIEGVYHHTMSFYYGLVIYYFSMA 731
           E+ E C+   K+L + +P W          ID  I    +HT+     LV Y FSM 
Sbjct: 319 EYLEECITILKKLFEKRPIW------IKRHIDGIIPKKIYHTLKIALALVSYRFSMG 369

>Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement
          Length = 658

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 14/28 (50%)

Query: 21 CWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          C  CR  K KC    P C  C ++G EC
Sbjct: 24 CSRCRRLKKKCSKELPACRNCSRAGEEC 51

>YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation
          regulatory protein, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1407 bp, 468 aa]
          Length = 468

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           C  CR R+VKCD ++P C RC +   +C
Sbjct: 7  ACDYCRVRRVKCDGKKP-CSRCIEHNFDC 34

>CAGL0M10043g complement(999113..1001089) similar to tr|Q04093
           Saccharomyces cerevisiae YDR444w, hypothetical start
          Length = 658

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 292 ALNLLFHNKQTPTSPSTSKGMVKTLLDAPQSDSHMPRTIMEIINPSPLELEIFEALNKLN 351
           AL L   +     +P TS   +  L  A Q +SH+P+ I+EII P P   ++F+      
Sbjct: 334 ALGLTGRDLNLKYTPLTSNEGLSALTLA-QENSHLPKNILEII-PQPPAQQVFQLFMNRT 391

Query: 352 LSWNIPASGV 361
           L  NI   G+
Sbjct: 392 LYANIVHDGI 401

>Kwal_23.3514
          Length = 579

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 15 AKTFTGCWTCRSRKVKCDLRRPGCVRCDKSG 45
          +KT T C  C  RKVKCD   P C  C K G
Sbjct: 6  SKTRTPCVVCTKRKVKCDRNIP-CSNCVKRG 35

>Kwal_33.13934
          Length = 797

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 8  QTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSG 45
          +TK+ RR      C  C+ RK KCD  +P C  C + G
Sbjct: 12 RTKKRRRPTVV--CTNCKRRKSKCDRLKPICGNCSRLG 47

>KLLA0D12672g complement(1076011..1078608)
           gi|125903|sp|P08657|LAC9_KLULA Kluyveromyces lactis
           Lactose regulatory protein LAC9, start by similarity
          Length = 865

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 14/29 (48%)

Query: 20  GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
            C  CR +K KC    P C  C K  L+C
Sbjct: 94  ACDACRKKKWKCSKTVPTCTNCLKYNLDC 122

>CAGL0K06985g 681115..682905 similar to sp|P38140 Saccharomyces
          cerevisiae YBR239c, hypothetical start
          Length = 596

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%)

Query: 4  SAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGL 46
          S  + T + +R  T   C  C      C+ +RP C RC K G+
Sbjct: 51 SQTSHTVKKKRKNTNVACVNCSRNHSSCEQKRP-CSRCIKKGI 92

>Scas_638.14
          Length = 1043

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 7   TQTKRPRRA--KTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVKFD 64
           ++ KR R+   K    C  CR RK+KC  ++P C  C+     C     K + SK  + +
Sbjct: 32  SKDKRVRKPTNKVSKACDNCRKRKIKCTGKQP-CATCEAYQCPCIYSTQKRKTSK--RNN 88

Query: 65  PYGVQLPPSPNG 76
              ++ P  PNG
Sbjct: 89  TAKMEQPEIPNG 100

>KLLA0D09977g complement(841852..843756) weakly similar to
          sp|P40969 Saccharomyces cerevisiae YMR168c CEP3
          kinetochore protein complex, 71 KD subunit singleton,
          start by similarity
          Length = 634

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 21 CWTCRSRKVKCDLRRPGCVRC-DKSGLECGGYD 52
          C  C++RKVKCD   P C  C +++  E   YD
Sbjct: 15 CTFCQARKVKCDRSLPACQNCIERNVTELCEYD 47

>Kwal_26.6664
          Length = 579

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 4/51 (7%)

Query: 6  KTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLR 56
          K Q  R R  K    C  C + K KC+  +P C RC +  L+C  Y  +LR
Sbjct: 3  KKQITRNRPVK---ACIKCYNGKRKCNKAKPVCGRCARLHLQC-LYSAELR 49

>KLLA0F13904g complement(1287758..1289497) some similarities with
          sp|P42950 Saccharomyces cerevisiae YJL103c,
          hypothetical start
          Length = 579

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%)

Query: 19 TGCWTCRSRKVKCDLRRPGCVRCDKSGL 46
          T C  C  + ++CDL RP C  C K G+
Sbjct: 18 TACVFCHEKHLQCDLGRP-CQNCSKRGI 44

>Kwal_23.4370
          Length = 692

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 14/29 (48%)

Query: 20  GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
            C  CR  K +C    P CV C K+G  C
Sbjct: 72  SCSRCRKLKKRCSKESPVCVSCAKAGESC 100

>Scas_700.40
          Length = 407

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 2/34 (5%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGL 46
          +R KT   C  CR   V CD +RP C RC K G+
Sbjct: 15 KRKKT-KSCLFCRRSHVNCDGKRP-CSRCLKRGI 46

>Scas_680.25
          Length = 738

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 14/29 (48%)

Query: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
           C  CR  K KC  + P C  C+K+   C
Sbjct: 15 SCSRCRRLKKKCPRQTPSCANCEKAHATC 43

>YBR239C (YBR239C) [418] chr2 complement(698311..699900) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1590 bp, 529 aa]
          Length = 529

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 1/49 (2%)

Query: 17 TFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVKFDP 65
          T   C  C    V C+ +RP C+RC   GL     D   + SK +   P
Sbjct: 36 TNVACVNCSRLHVSCEAKRP-CLRCISKGLTATCVDAPRKKSKYLAGIP 83

>Kwal_23.6537
          Length = 552

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 1/43 (2%)

Query: 11 RPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDI 53
          R +R +    C  CR RK KCD   P C  C   G  C   D+
Sbjct: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDV 51

>Scas_645.22
          Length = 427

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 2/77 (2%)

Query: 696 FYKENTDEFIDDTIEGVYHHTMSFYYGLVIYYFSMAKHLNNQFLQSYVEKVLLHLNKLTD 755
           FY EN+ + +DD I       + F  GL+     M K+L   F +   +   + +N +++
Sbjct: 176 FYVENSSKELDDVIAHKVAQNLGFQDGLIEDAAKMVKNLYKIFQEK--DATQIEINPISE 233

Query: 756 LIDHKSVKIVPLMWQGF 772
           +++H+    V  M   F
Sbjct: 234 IVNHEGKPAVACMDAKF 250

>Scas_709.42
          Length = 374

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 37/87 (42%), Gaps = 2/87 (2%)

Query: 472 EKYKDVLTAILSMNSIDVVWGTMEDCQRHLTICEDFVEKRMNSRPHISGKARTLHRIFSF 531
           E   D+ T  L   SID   GTM  C +     +   +    +R  +    +++  I  F
Sbjct: 59  ETLDDISTNSLKFLSIDYYLGTM--CSKKQATAKQVGDPSSKNRMKVKFLEKSVQIIMQF 116

Query: 532 LKLIQDSTALDKVRDKEIVIYGKKDKP 558
           L ++QD   LD +  ++I  +    KP
Sbjct: 117 LTMLQDYEILDTMLARKIDSFADAFKP 143

>Scas_702.7d
          Length = 978

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 7  TQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          T   + ++ ++   C  CR RK+KC   +P C  C+  G  C
Sbjct: 4  TSNGKIKKLRSSRACSNCRRRKIKCSGIQP-CPNCEIYGCLC 44

>Kwal_26.7014
          Length = 654

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 12 PRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          P  ++    C  CR R+ KC++  P C  C K  ++C
Sbjct: 26 PLLSRKRLACSNCRRRRKKCNMEYP-CASCVKLKVDC 61

>Scas_710.10
          Length = 437

 Score = 30.0 bits (66), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 3   KSAKTQTKRPRRAKTFTGCWTCRSRKVKCD 32
           K++ T    P R +  + C  CR RK+KCD
Sbjct: 122 KTSSTSKAPPIRKRNSSSCDYCRQRKIKCD 151

>AER291C [2793] [Homologous to ScYHR178W (STB5) - SH]
          (1172383..1174374) [1992 bp, 663 aa]
          Length = 663

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48
          +R +T++ C  CR  K KC    P C  C+ +  EC
Sbjct: 16 QRYETYS-CSRCRRLKKKCSKELPRCFSCEAASKEC 50

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,926,846
Number of extensions: 1435293
Number of successful extensions: 5776
Number of sequences better than 10.0: 294
Number of HSP's gapped: 5935
Number of HSP's successfully gapped: 297
Length of query: 839
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 729
Effective length of database: 12,788,129
Effective search space: 9322546041
Effective search space used: 9322546041
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)