Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_625.7d30230213670.0
CAGL0L01793g3593391843e-15
Scas_711.453352291728e-14
YKL042W (SPC42)3633521561e-11
KLLA0F04862g3162961551e-11
Kwal_26.8190324901418e-10
ABR054C314891259e-08
CAGL0L08162g135673672.1
KLLA0B09658g34278652.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_625.7d
         (302 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_625.7d                                                           531   0.0  
CAGL0L01793g 206723..207802 weakly similar to sp|P36094 Saccharo...    75   3e-15
Scas_711.45                                                            71   8e-14
YKL042W (SPC42) [3216] chr11 (358120..359211) Component of the s...    65   1e-11
KLLA0F04862g 476880..477830 some similarities with sp|P36094 Sac...    64   1e-11
Kwal_26.8190                                                           59   8e-10
ABR054C [645] [Homologous to ScYKL042W (SPC42) - SH] (494105..49...    53   9e-08
CAGL0L08162g 899222..903292 similar to sp|P25357 Saccharomyces c...    30   2.1  
KLLA0B09658g complement(837873..838901) similar to sgd|S0006331 ...    30   2.7  

>Scas_625.7d
          Length = 302

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/302 (89%), Positives = 271/302 (89%)

Query: 1   MEEKGEAHMFRDRRGNISPTPQRYGTEKYARYGLRKTDELLPEESRLSNDAINELIDMNR 60
           MEEKGEAHMFRDRRGNISPTPQRYGTEKYARYGLRKTDELLPEESRLSNDAINELIDMNR
Sbjct: 1   MEEKGEAHMFRDRRGNISPTPQRYGTEKYARYGLRKTDELLPEESRLSNDAINELIDMNR 60

Query: 61  QLKKTLRDREDELDRYGRLTESLQSKLIKYTXXXXXXXXXXXXXXXXXXXXXXXXXRLTN 120
           QLKKTLRDREDELDRYGRLTESLQSKLIKYT                         RLTN
Sbjct: 61  QLKKTLRDREDELDRYGRLTESLQSKLIKYTNLNNKLEREKIELELENEKLIDINERLTN 120

Query: 121 DLRTTSVAGDLKYSQKTRKGDDENTDDIFIPKRGHTFKDTTESNNTDLRKGSAEVLNKKL 180
           DLRTTSVAGDLKYSQKTRKGDDENTDDIFIPKRGHTFKDTTESNNTDLRKGSAEVLNKKL
Sbjct: 121 DLRTTSVAGDLKYSQKTRKGDDENTDDIFIPKRGHTFKDTTESNNTDLRKGSAEVLNKKL 180

Query: 181 DTLIEYLSEDKFGAKTGNSRQKERHDHWRLTXXXXXXIITRESLEIKNLEDQVEELRKKT 240
           DTLIEYLSEDKFGAKTGNSRQKERHDHWRLT      IITRESLEIKNLEDQVEELRKKT
Sbjct: 181 DTLIEYLSEDKFGAKTGNSRQKERHDHWRLTDDDDDDIITRESLEIKNLEDQVEELRKKT 240

Query: 241 LLKQENELRKISLSNELLELATKLSSDTTLGDDEVNGLKKHKRHNRDHIRCTGCHDDENE 300
           LLKQENELRKISLSNELLELATKLSSDTTLGDDEVNGLKKHKRHNRDHIRCTGCHDDENE
Sbjct: 241 LLKQENELRKISLSNELLELATKLSSDTTLGDDEVNGLKKHKRHNRDHIRCTGCHDDENE 300

Query: 301 KT 302
           KT
Sbjct: 301 KT 302

>CAGL0L01793g 206723..207802 weakly similar to sp|P36094
           Saccharomyces cerevisiae YKL042w SPC42, start by
           similarity
          Length = 359

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 86/339 (25%), Positives = 145/339 (42%), Gaps = 97/339 (28%)

Query: 16  NISPTPQRYGT-----------------EKYARYGLRKTD-------------------- 38
           NISPTP+RY +                 E Y + GL   D                    
Sbjct: 2   NISPTPKRYNSRGDRYYASQARGKVPEFEPYRKSGLNFNDGYSGINPPVYKNGLHSNLDD 61

Query: 39  -ELLPEESRLSNDAINELIDMNRQLKKTLRDREDELDRYGRLTESLQSKLIKYTXXXXXX 97
            +L+PEE +L    IN+LI  N++L+ T+  + +E++R   +    ++KL KY+      
Sbjct: 62  DKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNIIIGQFRAKLTKYSVMNR-- 119

Query: 98  XXXXXXXXXXXXXXXXXXXRLTNDLRTTSVAGDLKYSQKTRKGDD-------ENTDD-IF 149
                              +L ++LR +  + +     +    +D       EN +D I 
Sbjct: 120 -------------------KLEDELRGSERSSNALNKDRNDDRNDSILENSFENAEDYIQ 160

Query: 150 IPKRGHTFKDTTESNNTDLRKGSAEVLNKKLDTLIEYL--------------SEDKFGAK 195
           IPK  +  K   +      +      LN +L  L++ L              S D     
Sbjct: 161 IPKLRYNSKGKQD------KSPQTNDLNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPV 214

Query: 196 TGNSRQKERHDHWRLTXX-----XXXXIITRESLEIKNLEDQVEELRKKTLLKQENELRK 250
             ++   ER++   ++           I+ +ES E+K+LE+Q+E ++KK L+K+ENELRK
Sbjct: 215 CSSATPPERNNKPIMSSPKIRDPSEEDILCQESAELKSLENQIELVKKKLLIKRENELRK 274

Query: 251 ISLSNELLELATKLSSDTT---LGDDEVNGL--KKHKRH 284
           +SL NEL+EL  +LS+D +    G  + N +   KH++H
Sbjct: 275 LSLENELIELMDQLSTDASPYRYGKSKGNFISTSKHEKH 313

>Scas_711.45
          Length = 335

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 108/229 (47%), Gaps = 30/229 (13%)

Query: 38  DELLPEESRLSNDAINELIDMNRQLKKTLRDREDELDRYGRLTESLQSKLIKYTXXXXXX 97
           D LLP++++ SN   +EL+  NR LK+ L  ++ E+++   L+ SL+ KLIKYT      
Sbjct: 58  DALLPDDAKRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLTANS 117

Query: 98  XXXXXXXXXXXXXXXXXXXRLTNDLRTTSVAGDLKYSQKTRKGDDENTDDIFIPKRGHTF 157
                              RL           D  +++K ++ D +             F
Sbjct: 118 NDEIEILKRRIEDLEKENKRLRR--------RDELFNEKIKEEDSDK----------KVF 159

Query: 158 KDTTESNNT--DLRKGSAEVLNKKLDTLIEYLSEDKFGAKTGNSRQKERHDHWRLTXXXX 215
            +TTE +     + K +A +L  K +      +  K   K  NS+               
Sbjct: 160 TETTEDDELLEKIEKLTAMILKHKQEQRNSGTTPAKTSWKEQNSK----------AYPTE 209

Query: 216 XXIITRESLEIKNLEDQVEELRKKTLLKQENELRKISLSNELLELATKL 264
             ++T+ESLE+K+LEDQVE++R K  LK+ENE RKISL+ ELL+L + L
Sbjct: 210 ETLLTQESLELKSLEDQVEKIRHKLALKRENEQRKISLNKELLKLKSSL 258

>YKL042W (SPC42) [3216] chr11 (358120..359211) Component of the
           spindle pole body [1092 bp, 363 aa]
          Length = 363

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 86/352 (24%), Positives = 152/352 (43%), Gaps = 77/352 (21%)

Query: 16  NISPTPQRYGTEK-----------------------YARYGLR-KTDELLPEESRLSNDA 51
           N SPTP+RY ++                        Y   G R   D+L+PEE + + + 
Sbjct: 2   NGSPTPKRYSSKSSRLYDDYYNIPYQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTEF 61

Query: 52  INELIDMNRQLKKTLRDREDELDRYGRLTESLQSKLIKYTXXXXXXXXXXXXXXXXXXXX 111
           IN+ +  N++L   LR++++E+    ++ E+L+SKL KY                     
Sbjct: 62  INKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISDL 121

Query: 112 XXXXXRLTNDLRTTSVAGDLKYSQ-KTRKGDD----ENTDDIFIPKRGHTFKDTT----- 161
                +L++     S   ++++ + K    DD    EN D I +PK  H   D T     
Sbjct: 122 EK---KLSD---ANSTFKEMRFPKVKDPMVDDDPVSENYDQINVPK--HRAPDATGNPRT 173

Query: 162 --ESNNTDLRKGSAEVLNKKLDTLIEYL--SEDKFGAKTG----------------NSRQ 201
             + +NT  +    + + + L  L  Y+  SED    +                  N ++
Sbjct: 174 TNKVSNTSDQDSRLKAIERTLSVLTNYVMRSEDGNNDRMSPLPSPLNTILPINNRLNFQE 233

Query: 202 KERHDHWRLTXXXXXXIITRESLEIKNLEDQVEELRKKTLLKQENELRKISLSNELLELA 261
            +R++           I+  ES E+K +E+++EEL++K L++++++LRK+SL+N+L EL 
Sbjct: 234 PKRYNPTVKVNPSDDDIMMYESAELKRVEEEIEELKRKILVRKKHDLRKLSLNNQLQELQ 293

Query: 262 TKLSSDTTLGDDEVNGLKKHK----RHNRDHIR--------CTGCHDDENEK 301
           + +  D  +  D V+   KH     RH+    R        C  C +D  EK
Sbjct: 294 SMMDGDDNIKLDNVS---KHNHATHRHSSQSSRDYSPSSDACLECSNDLYEK 342

>KLLA0F04862g 476880..477830 some similarities with sp|P36094
           Saccharomyces cerevisiae YKL042w SPC42 spindle pole body
           component singleton, hypothetical start
          Length = 316

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 126/296 (42%), Gaps = 57/296 (19%)

Query: 20  TPQRYGTEKYARYGLRKTDE-LLPEESRLSNDAINELIDMNRQLKKTLRDREDELDRYGR 78
           TP+R+       +G    +E ++PEE + ++  INELI  N+ L K + ++++E+DR   
Sbjct: 7   TPRRFV------FGNNDANERIVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDRLNV 60

Query: 79  LTESLQSKLIKYTXXXXXXXXXXXXXXXXXXXXXXXXXRLTNDLRTTSVAG-----DLKY 133
           L  S ++KLIKYT                         R   +  + S +      D +Y
Sbjct: 61  LIGSFRAKLIKYTELNKKMQRDQQEQQHNRHQSFESKPRYKAEFTSESSSPVSNERDSEY 120

Query: 134 SQ--KTRKGDDENTDDIFIPKRGHTFKDTTESNNTDLRKGSAEVLNKKLDTLIEYLSEDK 191
            Q  K  + D+   DDI+                            +KL+ L   +++  
Sbjct: 121 LQIKKNNRHDENKIDDIY----------------------------QKLELLTNLVNDAI 152

Query: 192 FGAKTGNSRQKERHDHWRLTXXXXXXIITRESLEIKNLEDQVEELRKKTLLKQENELRKI 251
                G  R+     ++         II  ES E K L+DQ++ L++K L+K+ENELRK+
Sbjct: 153 HKQNNGEQREP---SNFNSRIVSDDDIIISESQEFKQLQDQIDLLKRKLLIKKENELRKL 209

Query: 252 SLSNELLELATKLSSDTT------------LGDDEVNGLKKHKRHNRDHIRCTGCH 295
           SL+ EL +L  +LS +++            L     +G ++    ++  + C  CH
Sbjct: 210 SLNKELADLMDELSMNSSPSANQNIDPYSELSSRPKSGQQRRTNEDQQSLHCEHCH 265

>Kwal_26.8190
          Length = 324

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 50/90 (55%), Gaps = 14/90 (15%)

Query: 16 NISPTPQRYGTEKY--------------ARYGLRKTDELLPEESRLSNDAINELIDMNRQ 61
          NISPTP+RY +  Y                  +  +D ++PEE R+++  IN+LI  N++
Sbjct: 2  NISPTPRRYNSRGYDYPRETDEAFHPFNQEPPMIPSDRIVPEEYRVNSQMINKLIKQNKE 61

Query: 62 LKKTLRDREDELDRYGRLTESLQSKLIKYT 91
          L   L  ++DE+DR   L  SL+ KLIKYT
Sbjct: 62 LTLQLDRKQDEIDRLNVLVGSLRGKLIKYT 91

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/47 (59%), Positives = 41/47 (87%)

Query: 218 IITRESLEIKNLEDQVEELRKKTLLKQENELRKISLSNELLELATKL 264
           I+T+ES E+K+LEDQ++ L++K L+K+ENELRK+SL+ ELL+L  KL
Sbjct: 195 ILTQESAELKSLEDQIDLLKRKLLIKRENELRKLSLNKELLDLMDKL 241

>ABR054C [645] [Homologous to ScYKL042W (SPC42) - SH]
           (494105..495049) [945 bp, 314 aa]
          Length = 314

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 7/89 (7%)

Query: 218 IITRESLEIKNLEDQVEELRKKTLLKQENELRKISLSNELLELATKL-------SSDTTL 270
           I+  ES E+K LE+QV++L++K L+K ENELRK+SL+ +L +L  KL       +S   L
Sbjct: 186 IMISESSELKRLEEQVDQLKRKVLIKSENELRKLSLNQQLADLMHKLGVSSSSPASSALL 245

Query: 271 GDDEVNGLKKHKRHNRDHIRCTGCHDDEN 299
            D + +           H  C  CH  E+
Sbjct: 246 FDRQPSPTSAASSAPLAHAHCEQCHHAED 274

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 17/93 (18%)

Query: 16 NISPTPQRYGTEKYARYGL-----------------RKTDELLPEESRLSNDAINELIDM 58
          NISPTP+RY +  +    +                 +  D ++P+E +++++ I+ LI  
Sbjct: 2  NISPTPKRYQSSNHMPRAVNHNYHSAVPAYHEHAAGQNADRIVPDEYKINSNMISSLIKQ 61

Query: 59 NRQLKKTLRDREDELDRYGRLTESLQSKLIKYT 91
          N+ L   L +++ EL++   L  SL+ KLIKYT
Sbjct: 62 NKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYT 94

>CAGL0L08162g 899222..903292 similar to sp|P25357 Saccharomyces
           cerevisiae YCR033w, start by similarity
          Length = 1356

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 12/73 (16%)

Query: 29  YARYGLRKTDELLPEES---RLSNDAINELIDMNR----QLKK----TLRDREDELDRYG 77
           +  Y   K + L+ E++    L+N  I EL+ +NR     +KK    TL+D +D+  +  
Sbjct: 567 FKAYPFWKRNLLVHEQAIRGELAN-TIGELVQLNRYKELMMKKMCFQTLQDWKDKCGQMS 625

Query: 78  RLTESLQSKLIKY 90
           +++ESL+SK I+Y
Sbjct: 626 KISESLRSKEIEY 638

>KLLA0B09658g complement(837873..838901) similar to sgd|S0006331
           Saccharomyces cerevisiae YPR127w, hypothetical start
          Length = 342

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 13/78 (16%)

Query: 121 DLRTTSVAGDLKYSQKTRKGDDENTDDIFIPKRGHTFKDTTESNNTDL----RKGSAEVL 176
           DL+T S AGD     K+     ENT  +F     + + D  E    DL    + G +   
Sbjct: 93  DLQTLSPAGD----AKSVSASIENTLKVF-----NGYVDIYEPARLDLELIKKTGESVFP 143

Query: 177 NKKLDTLIEYLSEDKFGA 194
            +  DT++EY+ + K G 
Sbjct: 144 RETFDTIVEYVKKGKIGG 161

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.130    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,798,525
Number of extensions: 422717
Number of successful extensions: 1798
Number of sequences better than 10.0: 79
Number of HSP's gapped: 1787
Number of HSP's successfully gapped: 94
Length of query: 302
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 201
Effective length of database: 13,099,691
Effective search space: 2633037891
Effective search space used: 2633037891
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 61 (28.1 bits)