Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_625.72242249211e-127
CAGL0L01837g2242246981e-93
YKL041W (VPS24)2242256982e-93
Sklu_1576.22232246868e-92
Kwal_26.81562222246112e-80
ABR049C2232245888e-77
KLLA0F25366g2242255811e-75
YKL002W (DID4)2321481314e-09
Scas_668.262331221314e-09
KLLA0B13343g2361341315e-09
ABR002C2341221235e-08
CAGL0K02827g15375720.13
Kwal_26.792314853670.69
YGR070W (ROM1)115590617.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_625.7
         (224 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_625.7                                                            359   e-127
CAGL0L01837g 211118..211792 highly similar to sp|P36095 Saccharo...   273   1e-93
YKL041W (VPS24) [3217] chr11 (359787..360461) Protein involved i...   273   2e-93
Sklu_1576.2 YKL041W, Contig c1576 607-1278 reverse complement         268   8e-92
Kwal_26.8156                                                          239   2e-80
ABR049C [640] [Homologous to ScYKL041W (VPS24) - SH] (482245..48...   231   8e-77
KLLA0F25366g 2361279..2361953 similar to sp|P36095 Saccharomyces...   228   1e-75
YKL002W (DID4) [3255] chr11 (437421..437480,437549..438187) Clas...    55   4e-09
Scas_668.26                                                            55   4e-09
KLLA0B13343g join(complement(1171345..1171404), similar to sp|P3...    55   5e-09
ABR002C [593] [Homologous to ScYKL002W (DID4) - SH] (400237..400...    52   5e-08
CAGL0K02827g 254429..254890 highly similar to sp|P36108 Saccharo...    32   0.13 
Kwal_26.7923                                                           30   0.69 
YGR070W (ROM1) [2031] chr7 (627808..631275) GDP-GTP exchange fac...    28   7.8  

>Scas_625.7
          Length = 224

 Score =  359 bits (921), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 186/224 (83%), Positives = 186/224 (83%)

Query: 1   MDYIKKTIWGPDPKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQQLIKRAAKKNDIKT 60
           MDYIKKTIWGPDPKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQQLIKRAAKKNDIKT
Sbjct: 1   MDYIKKTIWGPDPKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQQLIKRAAKKNDIKT 60

Query: 61  VRIYARELYQINKQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVR 120
           VRIYARELYQINKQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVR
Sbjct: 61  VRIYARELYQINKQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVR 120

Query: 121 LPELQGTMIELEKELMKSGIISEMVDETXXXXXXXXXXXXXXXXXXNKIVEQYTNEKFEK 180
           LPELQGTMIELEKELMKSGIISEMVDET                  NKIVEQYTNEKFEK
Sbjct: 121 LPELQGTMIELEKELMKSGIISEMVDETMDSVMESEELDEEVDAEVNKIVEQYTNEKFEK 180

Query: 181 INNVPTTXXXXXXXXXXXXXXXXXXXXADKMLREMKERLNALQN 224
           INNVPTT                    ADKMLREMKERLNALQN
Sbjct: 181 INNVPTTELPAHEEEEKEIPEDQVDEEADKMLREMKERLNALQN 224

>CAGL0L01837g 211118..211792 highly similar to sp|P36095
           Saccharomyces cerevisiae YKL041w VPS24, start by
           similarity
          Length = 224

 Score =  273 bits (698), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 166/224 (74%)

Query: 1   MDYIKKTIWGPDPKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQQLIKRAAKKNDIKT 60
           MDY+K  IWGPD KEQQR IK++LRKN+R ++KSLR+L+ LQNKTQ LIK++AKKND++ 
Sbjct: 1   MDYVKTAIWGPDVKEQQRNIKSLLRKNSRQIDKSLRELSALQNKTQSLIKKSAKKNDVRN 60

Query: 61  VRIYARELYQINKQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVR 120
           VR+YA+ELY INKQY+RMY+SK QL SVS +IDEA R++T+S++MA STGLM EVNSLVR
Sbjct: 61  VRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVR 120

Query: 121 LPELQGTMIELEKELMKSGIISEMVDETXXXXXXXXXXXXXXXXXXNKIVEQYTNEKFEK 180
           LP+LQGTMIELEKELMKSGIISEM+DET                  NKIVEQYT+EK  K
Sbjct: 121 LPQLQGTMIELEKELMKSGIISEMIDETMESIGDTDELNDEVDEEVNKIVEQYTSEKLAK 180

Query: 181 INNVPTTXXXXXXXXXXXXXXXXXXXXADKMLREMKERLNALQN 224
           + NVPTT                    ADKML +M++RL ALQN
Sbjct: 181 VENVPTTELPKSEQEEQEVPEEEIEDEADKMLNDMRDRLRALQN 224

>YKL041W (VPS24) [3217] chr11 (359787..360461) Protein involved in
           sorting of proteins in the pre-vacuolar endosome,
           component of ESCRT-III complex with Did4p, Vps20p, and
           Snf7p [675 bp, 224 aa]
          Length = 224

 Score =  273 bits (698), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 141/225 (62%), Positives = 169/225 (75%), Gaps = 2/225 (0%)

Query: 1   MDYIKKTIWGPDPKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQQLIKRAAKKNDIKT 60
           MDYIKK IWGPDPKEQQRRI++VLRKN R +EKSLR+LT LQNKTQQLIK++AKKND++T
Sbjct: 1   MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRT 60

Query: 61  VRIYARELYQINKQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVR 120
           VR+YA+ELYQINKQY RMY+S+ QL SV  +IDEA+R+ T+S++MA+S GLMREVNSLVR
Sbjct: 61  VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR 120

Query: 121 LPELQGTMIELEKELMKSGIISEMVDETXXXX-XXXXXXXXXXXXXXNKIVEQYTNEKFE 179
           LP+L+ TMIELEKELMKSGIISEMVD+T                   NKIVEQYTNEKF+
Sbjct: 121 LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFK 180

Query: 180 KINNVPTTXXXXXXXXXXXXXXXXXXXXADKMLREMKERLNALQN 224
            ++ VPT                     AD+M+ EM+ERL ALQN
Sbjct: 181 NVDQVPTV-ELAANEEEQEIPDEKVDEEADRMVNEMRERLRALQN 224

>Sklu_1576.2 YKL041W, Contig c1576 607-1278 reverse complement
          Length = 223

 Score =  268 bits (686), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 134/224 (59%), Positives = 165/224 (73%), Gaps = 1/224 (0%)

Query: 1   MDYIKKTIWGPDPKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQQLIKRAAKKNDIKT 60
           MDY+KK +WGPDPKEQ R+IK+++RKN R ++KSLR+LT LQNKTQQLIKRAAKKNDIK+
Sbjct: 1   MDYLKKVMWGPDPKEQHRKIKSIVRKNGRNIDKSLRELTVLQNKTQQLIKRAAKKNDIKS 60

Query: 61  VRIYARELYQINKQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVR 120
           VRIYA+E+YQ+NKQY RMY+SK QL SV  +IDEA R+K +S+ MA S GLMREVNSLV+
Sbjct: 61  VRIYAKEIYQVNKQYIRMYTSKAQLESVGMKIDEAFRMKNLSENMAASAGLMREVNSLVK 120

Query: 121 LPELQGTMIELEKELMKSGIISEMVDETXXXXXXXXXXXXXXXXXXNKIVEQYTNEKFEK 180
           LP+LQ +M+ELEKE+MKSG+ISEM+D+T                  NKIV QYT++KFE 
Sbjct: 121 LPQLQSSMMELEKEIMKSGVISEMIDDTLEVADEDEEMESEIDEEVNKIVSQYTSDKFEI 180

Query: 181 INNVPTTXXXXXXXXXXXXXXXXXXXXADKMLREMKERLNALQN 224
           ++NVPTT                    AD ML EM+ERL ALQN
Sbjct: 181 VDNVPTT-ELPSKQEQELVPEEQIEDEADNMLNEMRERLKALQN 223

>Kwal_26.8156
          Length = 222

 Score =  239 bits (611), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 123/224 (54%), Positives = 155/224 (69%), Gaps = 2/224 (0%)

Query: 1   MDYIKKTIWGPDPKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQQLIKRAAKKNDIKT 60
           MDY+KK IWGPDPKEQ R+I+ ++R+N R+L+KSLR+L  LQ KTQ LIKRAAK+ND ++
Sbjct: 1   MDYLKKAIWGPDPKEQHRKIRGLVRRNGRSLDKSLRELAALQTKTQGLIKRAAKQNDTRS 60

Query: 61  VRIYARELYQINKQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVR 120
           VRIYARELYQI+KQY RMY SK QL SV  +IDEA R++ + + +A S GLMREVNSLVR
Sbjct: 61  VRIYARELYQIDKQYKRMYISKAQLQSVGMKIDEAFRMQDLQENIALSAGLMREVNSLVR 120

Query: 121 LPELQGTMIELEKELMKSGIISEMVDETXXXXXXXXXXXXXXXXXXNKIVEQYTNEKFEK 180
           LP LQ TM+ LEKEL+K+G+I EM+D++                  NKIV QYT+ K +K
Sbjct: 121 LPYLQSTMMLLEKELVKNGLIGEMLDDSMELATEDEEMEEEVEQEVNKIVNQYTSAKLDK 180

Query: 181 INNVPTTXXXXXXXXXXXXXXXXXXXXADKMLREMKERLNALQN 224
           I+N+PT+                    AD ML EM+ERL ALQN
Sbjct: 181 IDNIPTS--EPPMAHEEIVPEDKIDDEADNMLNEMRERLKALQN 222

>ABR049C [640] [Homologous to ScYKL041W (VPS24) - SH]
           (482245..482916) [672 bp, 223 aa]
          Length = 223

 Score =  231 bits (588), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 118/224 (52%), Positives = 152/224 (67%), Gaps = 1/224 (0%)

Query: 1   MDYIKKTIWGPDPKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQQLIKRAAKKNDIKT 60
           M++IK  IWG DP+EQ R++KA+LRKN+R L+KSLR+L  L+ KTQ LIK++AK ND+KT
Sbjct: 1   MNFIKTAIWGVDPREQHRKMKAILRKNHRQLDKSLRELAALKGKTQVLIKKSAKTNDVKT 60

Query: 61  VRIYARELYQINKQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVR 120
           VRIYA+ELYQINKQY R+Y+SK QL SV  +I+EA  +  M   MA+S GLMREVNSLV 
Sbjct: 61  VRIYAKELYQINKQYDRIYTSKAQLQSVGMKIEEAFHMNKMQQTMAQSAGLMREVNSLVS 120

Query: 121 LPELQGTMIELEKELMKSGIISEMVDETXXXXXXXXXXXXXXXXXXNKIVEQYTNEKFEK 180
           +P+L+ TM+ELEKEL++SGI+SEMV+++                   +IV QYT  KF  
Sbjct: 121 VPQLRSTMMELEKELLRSGIVSEMVNDS-LENIDMTVDDEEVDEQVEQIVMQYTGAKFNA 179

Query: 181 INNVPTTXXXXXXXXXXXXXXXXXXXXADKMLREMKERLNALQN 224
           ++NVP T                    AD MLREM+ERLNALQ 
Sbjct: 180 VDNVPETQLERQDALEEVVPEEDIKDEADNMLREMRERLNALQG 223

>KLLA0F25366g 2361279..2361953 similar to sp|P36095 Saccharomyces
           cerevisiae YKL041w VPS24 endosomal Vps protein complex
           subunit singleton, start by similarity
          Length = 224

 Score =  228 bits (581), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 154/225 (68%), Gaps = 2/225 (0%)

Query: 1   MDYIKKTIWGPDPKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQQLIKRAAKKNDIKT 60
           M++IK  IWGPDPKEQ R++K++LRKN+R L KSL +L++L+ KTQQLIK+AAK+NDIKT
Sbjct: 1   MNFIKTAIWGPDPKEQHRKLKSILRKNDRQLSKSLNELSSLKAKTQQLIKQAAKQNDIKT 60

Query: 61  VRIYARELYQINKQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVR 120
           VR+YA+ELY +NKQY RMY+SK QL SV  +I+E  ++  + DKMA+S  LMR+VNSLVR
Sbjct: 61  VRLYAKELYHVNKQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVR 120

Query: 121 LPELQGTMIELEKELMKSGIISEMVDETXXXXXXXXXXXXXXXXXXNKIVEQYTNEKFEK 180
           LP+L+GTMIELEKEL+KSGII+EM+D+                   ++IV +YT+EK  K
Sbjct: 121 LPQLRGTMIELEKELVKSGIITEMMDDA-MESYEDMEEEEEINEQVDQIVAEYTSEKLGK 179

Query: 181 INNVP-TTXXXXXXXXXXXXXXXXXXXXADKMLREMKERLNALQN 224
           +   P                       AD M++ MKERLNALQ 
Sbjct: 180 VEETPNVVLSEPPPAEQEVVPESNIDAEADNMIKAMKERLNALQG 224

>YKL002W (DID4) [3255] chr11 (437421..437480,437549..438187) Class E
           vacuolar protein-sorting (vps) factor involved in
           endosome to vacuole transport, component of ESCRT-III
           complex with Vps24p, Vps20p, and Snf7p, has similarity
           to human BC-2 breast adenocarcinoma marker protein [699
           bp, 232 aa]
          Length = 232

 Score = 55.1 bits (131), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 76/148 (51%), Gaps = 12/148 (8%)

Query: 8   IWGPDPKEQQRRIKAVLRKNNRALEKSLRDLT------NLQNK-TQQLIKRAAKKNDIKT 60
           ++G +   Q+R     L+KN RALE++ R+L        LQ+K     IK++AK   +  
Sbjct: 7   VFGKNVTPQER-----LKKNQRALERTQRELEREKRKLELQDKKLVSEIKKSAKNGQVAA 61

Query: 61  VRIYARELYQINKQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVR 120
            ++ A++L +      +  + K QL ++S +I        M+  M+E+TGL+  +N  + 
Sbjct: 62  AKVQAKDLVRTRNYIQKFDNMKAQLQAISLRIQAVRSSDQMTRSMSEATGLLAGMNRTMN 121

Query: 121 LPELQGTMIELEKELMKSGIISEMVDET 148
           LP+LQ   +E EK+    G   E +DE 
Sbjct: 122 LPQLQRISMEFEKQSDLMGQRQEFMDEA 149

>Scas_668.26
          Length = 233

 Score = 55.1 bits (131), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 65/122 (53%)

Query: 13  PKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQQLIKRAAKKNDIKTVRIYARELYQIN 72
           P+E+ ++ +  L +  R LE+  R L   + K  Q IK++AK+  I   +I A++L +  
Sbjct: 14  PQERLKKNQRALERAQRELEREKRKLATQEKKIIQEIKKSAKQGQINAAKIQAKDLVRTR 73

Query: 73  KQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVRLPELQGTMIELE 132
               +  + + QL ++S +I        M+  M E+TGL+  +N  + LP+LQ   +E E
Sbjct: 74  NYMEKFDNMRTQLQAISLRIQAVRSSDQMTSSMREATGLLAGMNRSMNLPQLQNISMEFE 133

Query: 133 KE 134
           K+
Sbjct: 134 KQ 135

>KLLA0B13343g join(complement(1171345..1171404), similar to
           sp|P36108 Saccharomyces cerevisiae YKL002w class E
           vacuolar-protein sorting and endocytosis factor
           singleton, start by similarity
          Length = 236

 Score = 55.1 bits (131), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 70/134 (52%), Gaps = 12/134 (8%)

Query: 8   IWGPDPKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQ-------QLIKRAAKKNDIKT 60
           ++G     Q+R     +RKN RALE++ R+L   + K +       Q IK++AK   +  
Sbjct: 7   VFGSSMTPQER-----MRKNQRALERAQRELEREKKKLEAQEKKLIQEIKKSAKNGQVNA 61

Query: 61  VRIYARELYQINKQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVR 120
            +I A++L +  K   +  + K QL ++S ++        M+  M E+TGL+  +N  + 
Sbjct: 62  AKIQAKDLVRTRKYTEKFGNMKTQLQAISLRVQAVRSSDQMAVSMREATGLLAGMNRSMN 121

Query: 121 LPELQGTMIELEKE 134
           LP+LQ   +E EK+
Sbjct: 122 LPQLQRISMEFEKQ 135

>ABR002C [593] [Homologous to ScYKL002W (DID4) - SH]
           (400237..400881,400948..401007) [705 bp, 234 aa]
          Length = 234

 Score = 52.0 bits (123), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 64/122 (52%)

Query: 13  PKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQQLIKRAAKKNDIKTVRIYARELYQIN 72
           P+E+ ++ +  L +  R LE+  R L   + +  Q IK++AK   I   +I A++L +  
Sbjct: 14  PQERLKKNQNALDRTQRELEREKRKLEAQEKRLVQDIKKSAKNGQINAAKIQAKDLVRTK 73

Query: 73  KQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVRLPELQGTMIELE 132
           +   +    K QL ++S +I        M+  M E+TGL+  +N  + LP+LQ   +E E
Sbjct: 74  RYIEKFNGMKTQLQAISLRIQAVRSSDQMAISMREATGLLSSMNRSMNLPQLQRISMEFE 133

Query: 133 KE 134
           ++
Sbjct: 134 RQ 135

>CAGL0K02827g 254429..254890 highly similar to sp|P36108
           Saccharomyces cerevisiae YKL002w, start by similarity
          Length = 153

 Score = 32.3 bits (72), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 36/75 (48%), Gaps = 9/75 (12%)

Query: 82  KVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVRLPELQGTMIELEK-------- 133
           K QL ++S +I        M+  M E+TGL+  +N  + LP+LQ   +E EK        
Sbjct: 2   KAQLQAISLRIQAVRSSDQMTRSMREATGLLAGMNRSMNLPQLQKISMEFEKQSDLMDQR 61

Query: 134 -ELMKSGIISEMVDE 147
            E M   I + M DE
Sbjct: 62  QEFMDEAIDNVMGDE 76

>Kwal_26.7923
          Length = 148

 Score = 30.4 bits (67), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 82  KVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVRLPELQGTMIELEKE 134
           K QL ++S +I        M+  M E+TGL+  +N  + LP++Q    E EK+
Sbjct: 2   KTQLQAISLRIQAVRSSDQMTTSMREATGLLASMNRSMNLPQIQLISAEFEKQ 54

>YGR070W (ROM1) [2031] chr7 (627808..631275) GDP-GTP exchange factor
           for Rho1p [3468 bp, 1155 aa]
          Length = 1155

 Score = 28.1 bits (61), Expect = 7.8,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 43/90 (47%), Gaps = 5/90 (5%)

Query: 4   IKKTIWGPDPKEQQRRIKAV--LRKNNRALEKSL---RDLTNLQNKTQQLIKRAAKKNDI 58
           + K++W    K+Q +R +A+  L    +   KSL   RD    +     +I    + N +
Sbjct: 450 VPKSVWESLSKQQIKRQEAIYELFTTEKKFVKSLEIIRDTFMKKLLETNIIPSDVRINFV 509

Query: 59  KTVRIYARELYQINKQYTRMYSSKVQLTSV 88
           K V  +  E+Y +N+++ +  + +  L+ +
Sbjct: 510 KHVFAHINEIYSVNREFLKALAQRQSLSPI 539

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.127    0.330 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,424,913
Number of extensions: 180545
Number of successful extensions: 805
Number of sequences better than 10.0: 65
Number of HSP's gapped: 782
Number of HSP's successfully gapped: 65
Length of query: 224
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 126
Effective length of database: 13,203,545
Effective search space: 1663646670
Effective search space used: 1663646670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)