Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_618.1340740720970.0
Sklu_1484.339935412951e-178
KLLA0E14850g39638712931e-178
YGL143C (MRF1)41339512831e-176
ADL284C42236612431e-170
Kwal_23.346740036112311e-169
CAGL0E04928g40538811821e-161
Scas_590.1116391163e-07
YLR281C155391141e-06
Kwal_56.23313158391131e-06
AGR281C176381096e-06
KLLA0C04642g168711096e-06
Sklu_2044.5123421022e-05
CAGL0F05027g18740910.001
KLLA0A07381g16574700.60
KLLA0F20966g100868692.1
Kwal_26.763569153672.9
Scas_684.29508109672.9
KLLA0F12210g104494664.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_618.13
         (407 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_618.13                                                           812   0.0  
Sklu_1484.3 YGL143C, Contig c1484 4090-5289                           503   e-178
KLLA0E14850g 1324910..1326100 gi|1172907|sp|P41767|RF1M_KLULA Kl...   502   e-178
YGL143C (MRF1) [1844] chr7 complement(234720..235961) Mitochondr...   498   e-176
ADL284C [1457] [Homologous to ScYGL143C (MRF1) - SH] (203883..20...   483   e-170
Kwal_23.3467                                                          478   e-169
CAGL0E04928g 476972..478189 similar to sp|P30775 Saccharomyces c...   459   e-161
Scas_590.1                                                             49   3e-07
YLR281C (YLR281C) [3672] chr12 complement(704495..704962) Protei...    49   1e-06
Kwal_56.23313                                                          48   1e-06
AGR281C [4592] [Homologous to ScYLR281C - SH] (1270719..1271249)...    47   6e-06
KLLA0C04642g complement(427221..427727) some similarities with s...    47   6e-06
Sklu_2044.5 YLR281C, Contig c2044 6176-6547                            44   2e-05
CAGL0F05027g complement(512367..512930) similar to tr|Q05863 Sac...    40   0.001
KLLA0A07381g complement(660082..660579) similar to sp|Q12322 Sac...    32   0.60 
KLLA0F20966g 1956869..1959895 similar to sp|P08004 Saccharomyces...    31   2.1  
Kwal_26.7635                                                           30   2.9  
Scas_684.29                                                            30   2.9  
KLLA0F12210g 1125630..1128764 highly similar to sp|P16521 Saccha...    30   4.4  

>Scas_618.13
          Length = 407

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/407 (96%), Positives = 392/407 (96%)

Query: 1   MLSRYVQSNIKSLPLRGFSIGRQIFPRGNRFQSTIPSTASNGHVELQPALISKATEYMKE 60
           MLSRYVQSNIKSLPLRGFSIGRQIFPRGNRFQSTIPSTASNGHVELQPALISKATEYMKE
Sbjct: 1   MLSRYVQSNIKSLPLRGFSIGRQIFPRGNRFQSTIPSTASNGHVELQPALISKATEYMKE 60

Query: 61  LAELNKQLSQGETFDVAQQKRFAHLASIEDAFQTYQTQLSNYKSLQELAQSDPSLKEEAQ 120
           LAELNKQLSQGETFDVAQQKRFAHLASIEDAFQTYQTQLSNYKSLQELAQSDPSLKEEAQ
Sbjct: 61  LAELNKQLSQGETFDVAQQKRFAHLASIEDAFQTYQTQLSNYKSLQELAQSDPSLKEEAQ 120

Query: 121 LELTELVPQLSQTMNELQSRLIPPHPFADKACILELRPGVGGTEAMIFTQDLLNMYIGYA 180
           LELTELVPQLSQTMNELQSRLIPPHPFADKACILELRPGVGGTEAMIFTQDLLNMYIGYA
Sbjct: 121 LELTELVPQLSQTMNELQSRLIPPHPFADKACILELRPGVGGTEAMIFTQDLLNMYIGYA 180

Query: 181 HSHKWKYRILAQDENESGDGLVDAILNIDEPGSYDKLRFESGVHRVQRIPATETKGRTHT 240
           HSHKWKYRILAQDENESGDGLVDAILNIDEPGSYDKLRFESGVHRVQRIPATETKGRTHT
Sbjct: 181 HSHKWKYRILAQDENESGDGLVDAILNIDEPGSYDKLRFESGVHRVQRIPATETKGRTHT 240

Query: 241 STAAVVVLPQMGDDSDRAINAYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPT 300
           STAAVVVLPQMGDDSDRAINAYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPT
Sbjct: 241 STAAVVVLPQMGDDSDRAINAYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPT 300

Query: 301 GIVVSMQDERSQQKNKAKAFTILRAXXXXXXXXXXXXXXXDARKEQVTTTDRSDKIRTYN 360
           GIVVSMQDERSQQKNKAKAFTILRA               DARKEQVTTTDRSDKIRTYN
Sbjct: 301 GIVVSMQDERSQQKNKAKAFTILRARLAEREQKLKEEKERDARKEQVTTTDRSDKIRTYN 360

Query: 361 YPQNRVTDHRCGLTLYALDAIMKGERLGEVIDAMRQFDDRERARLEF 407
           YPQNRVTDHRCGLTLYALDAIMKGERLGEVIDAMRQFDDRERARLEF
Sbjct: 361 YPQNRVTDHRCGLTLYALDAIMKGERLGEVIDAMRQFDDRERARLEF 407

>Sklu_1484.3 YGL143C, Contig c1484 4090-5289
          Length = 399

 Score =  503 bits (1295), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 236/354 (66%), Positives = 291/354 (82%)

Query: 45  ELQPALISKATEYMKELAELNKQLSQGETFDVAQQKRFAHLASIEDAFQTYQTQLSNYKS 104
           EL P LI +A +++ EL +L   LS+G +FDV +QK+FA L+SI D FQ Y+  L NYK 
Sbjct: 30  ELHPLLIKRAEKHVDELNKLEGLLSKGSSFDVERQKKFAELSSIVDTFQNYKDGLDNYKD 89

Query: 105 LQELAQSDPSLKEEAQLELTELVPQLSQTMNELQSRLIPPHPFADKACILELRPGVGGTE 164
           L+++ Q DPSL++EA++EL E++P L ++ + L ++L+PPHPFADK CILELRPGVGGTE
Sbjct: 90  LKDMIQQDPSLEKEARIELEEIMPALIKSSSSLLNKLLPPHPFADKPCILELRPGVGGTE 149

Query: 165 AMIFTQDLLNMYIGYAHSHKWKYRILAQDENESGDGLVDAILNIDEPGSYDKLRFESGVH 224
           AMIF QDLL+MYI YAH+ +WKY I ++ ENESG G++DAIL+IDEPGSY+KLRFE+GVH
Sbjct: 150 AMIFAQDLLHMYINYAHTKRWKYHITSKSENESGSGILDAILSIDEPGSYNKLRFEAGVH 209

Query: 225 RVQRIPATETKGRTHTSTAAVVVLPQMGDDSDRAINAYERTFKPDEIRIDVMRARGKGGQ 284
           RVQRIPATETKGRTHTSTAAV+VLPQMG++S++  +AYERTFKPDEIRIDVMRARGKGGQ
Sbjct: 210 RVQRIPATETKGRTHTSTAAVIVLPQMGEESEKEADAYERTFKPDEIRIDVMRARGKGGQ 269

Query: 285 HVNTTDSAVRLTHFPTGIVVSMQDERSQQKNKAKAFTILRAXXXXXXXXXXXXXXXDARK 344
           HVNTTDSAVRLTHFP+GIV+SMQ+ERSQ KNKAKAF ILRA                ARK
Sbjct: 270 HVNTTDSAVRLTHFPSGIVISMQNERSQHKNKAKAFAILRAKLAERERKEKEESARAARK 329

Query: 345 EQVTTTDRSDKIRTYNYPQNRVTDHRCGLTLYALDAIMKGERLGEVIDAMRQFD 398
            QVTTTDRSDKIRTYN+PQNR+TDHRCG  L+ +D +M GERL +VI+AM +++
Sbjct: 330 GQVTTTDRSDKIRTYNFPQNRITDHRCGFNLHNIDGVMAGERLDDVIEAMERYE 383

>KLLA0E14850g 1324910..1326100 gi|1172907|sp|P41767|RF1M_KLULA
           Kluyveromyces lactis Peptide chain release factor 1,
           mitochondrial precursor (MRF-1), start by similarity
          Length = 396

 Score =  502 bits (1293), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 237/387 (61%), Positives = 305/387 (78%), Gaps = 7/387 (1%)

Query: 23  QIFPRGNRFQSTIPSTASNGH--VELQP---ALISKATEYMKELAELNKQLSQGETFDVA 77
           ++F RG  F++       N    VE +P   +LIS+A  Y+ EL EL   LSQG +FD+ 
Sbjct: 4   KLFGRGKFFRNVALQVRFNSSEAVEFRPLHSSLISRAELYVNELRELEDLLSQGGSFDLE 63

Query: 78  QQKRFAHLASIEDAFQTYQTQLSNYKSLQELAQSDPSLKEEAQLELTELVPQLSQTMNEL 137
           +QK FA L++I D++  Y+ +++ YK LQE+ + DPSL+EEA+ ++  L+P L++T + L
Sbjct: 64  KQKNFAKLSTIVDSYSKYREEVNQYKELQEILELDPSLREEAEADIAALLPDLNKTGDSL 123

Query: 138 QSRLIPPHPFADKACILELRPGVGGTEAMIFTQDLLNMYIGYAHSHKWKYRILAQDENES 197
            ++L+PPHPFADK  ILELRPGVGG+EAMIFTQDLLNMYI YA+ HKWK+ ++++ EN S
Sbjct: 124 LNKLLPPHPFADKPSILELRPGVGGSEAMIFTQDLLNMYINYANYHKWKWNLISKTENAS 183

Query: 198 GDGLVDAILNIDEPGSYDKLRFESGVHRVQRIPATETKGRTHTSTAAVVVLPQMGDDSDR 257
           G G+++AILNIDEPGSYDKL+FE+GVHRVQR+PATE+KGRTHTSTAAV+VLP+MG++S+ 
Sbjct: 184 GSGVLEAILNIDEPGSYDKLKFEAGVHRVQRVPATESKGRTHTSTAAVIVLPKMGEESES 243

Query: 258 AINAYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPTGIVVSMQDERSQQKNKA 317
             +AYERTFKPDEIRIDVMRA GKGGQHVNTTDSAVRLTH+P+GIV+SMQ+ERSQ +NKA
Sbjct: 244 --DAYERTFKPDEIRIDVMRASGKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNKA 301

Query: 318 KAFTILRAXXXXXXXXXXXXXXXDARKEQVTTTDRSDKIRTYNYPQNRVTDHRCGLTLYA 377
           KAF ILRA               +ARK+QV+TTDRSDKIRTYNYPQNR+TDHRCG TLY 
Sbjct: 302 KAFAILRARLAEKERLEKEEKERNARKDQVSTTDRSDKIRTYNYPQNRITDHRCGFTLYD 361

Query: 378 LDAIMKGERLGEVIDAMRQFDDRERAR 404
           ++ +MKGERL +VIDAM  F   ++A+
Sbjct: 362 IEGVMKGERLDDVIDAMDAFSSEQKAK 388

>YGL143C (MRF1) [1844] chr7 complement(234720..235961) Mitochondrial
           peptide chain release factor, directs termination of
           translation in response to termination codons UAA and
           UAG [1242 bp, 413 aa]
          Length = 413

 Score =  498 bits (1283), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 243/395 (61%), Positives = 304/395 (76%), Gaps = 6/395 (1%)

Query: 15  LRGFSIGRQIFPRGNRFQSTIPSTASNGHV-----ELQPALISKATEYMKELAELNKQLS 69
            +G  +G ++ P   R  ST  ++ SNG +     EL P L+ +A +Y  EL +L+K LS
Sbjct: 14  FKGVFLGHKL-PLLVRLTSTTTNSKSNGSIPTQYTELSPLLVKQAEKYEAELKDLDKDLS 72

Query: 70  QGETFDVAQQKRFAHLASIEDAFQTYQTQLSNYKSLQELAQSDPSLKEEAQLELTELVPQ 129
            G  FDV +QK +A L+++ D F  Y+ +L+  KSLQE+  SDPSL+ EA+ E  ELVPQ
Sbjct: 73  CGIHFDVNKQKHYAKLSALTDTFIEYKEKLNELKSLQEMIVSDPSLRAEAEQEYAELVPQ 132

Query: 130 LSQTMNELQSRLIPPHPFADKACILELRPGVGGTEAMIFTQDLLNMYIGYAHSHKWKYRI 189
              T + L ++L+PPHPFADK  +LELRPGVGG EAMIFTQ+LL+MYIGYA+  KWKYRI
Sbjct: 133 YETTSSRLVNKLLPPHPFADKPSLLELRPGVGGIEAMIFTQNLLDMYIGYANYRKWKYRI 192

Query: 190 LAQDENESGDGLVDAILNIDEPGSYDKLRFESGVHRVQRIPATETKGRTHTSTAAVVVLP 249
           ++++ENESG G++DAIL+I+E GSYD+LRFE+GVHRVQRIP+TETKGRTHTSTAAVVVLP
Sbjct: 193 ISKNENESGSGIIDAILSIEEAGSYDRLRFEAGVHRVQRIPSTETKGRTHTSTAAVVVLP 252

Query: 250 QMGDDSDRAINAYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPTGIVVSMQDE 309
           Q+GD+S ++I+AYERTFKP EIR+D+MRA GKGGQHVNTTDSAVRLTH P+GIVVSMQDE
Sbjct: 253 QIGDESAKSIDAYERTFKPGEIRVDIMRASGKGGQHVNTTDSAVRLTHIPSGIVVSMQDE 312

Query: 310 RSQQKNKAKAFTILRAXXXXXXXXXXXXXXXDARKEQVTTTDRSDKIRTYNYPQNRVTDH 369
           RSQ KNKAKAFTILRA                ARK QV++T+RSDKIRTYN+PQNR+TDH
Sbjct: 313 RSQHKNKAKAFTILRARLAEKERLEKEEKERKARKSQVSSTNRSDKIRTYNFPQNRITDH 372

Query: 370 RCGLTLYALDAIMKGERLGEVIDAMRQFDDRERAR 404
           RCG TL  L  ++ GERL EVI+AM ++D  ERA+
Sbjct: 373 RCGFTLLDLPGVLSGERLDEVIEAMSKYDSTERAK 407

>ADL284C [1457] [Homologous to ScYGL143C (MRF1) - SH]
           (203883..205151) [1269 bp, 422 aa]
          Length = 422

 Score =  483 bits (1243), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 224/366 (61%), Positives = 286/366 (78%), Gaps = 2/366 (0%)

Query: 40  SNGHVELQPALISKATEYMKELAELNKQLSQGETFDVAQQKRFAHLASIEDAFQTYQTQL 99
           + G  EL P+LI +AT Y  EL  L K LS+GE+FDV +QK+++ L+SI D F+ YQ  +
Sbjct: 50  AEGFRELHPSLIKRATGYAAELETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQDNV 109

Query: 100 SNYKSLQELAQSDPSLKEEAQLELTELVPQLSQTMNELQSRLIPPHPFADKACILELRPG 159
             Y+ LQ++   D SL+ EAQ EL EL P L+++ + L  +L+PPHPFA+K CI+ELRPG
Sbjct: 110 HMYRELQDMIAQDASLRTEAQAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELRPG 169

Query: 160 VGGTEAMIFTQDLLNMYIGYAHSHKWKYRILAQDENESGDGLVDAILNIDEPGSYDKLRF 219
           VGG EAMIFTQDLLNMYIGYA  H+WK+ + +  EN +G GL +AIL+IDEPGSYD+++F
Sbjct: 170 VGGIEAMIFTQDLLNMYIGYAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRVKF 229

Query: 220 ESGVHRVQRIPATETKGRTHTSTAAVVVLPQMGDDSDRAINAYERTFKPDEIRIDVMRAR 279
           ESGVHRVQRIPATE+KGRTHTSTAAVVVLP+M ++++   +AYERTFKP EIRIDVMRA 
Sbjct: 230 ESGVHRVQRIPATESKGRTHTSTAAVVVLPKMAEEAES--DAYERTFKPGEIRIDVMRAS 287

Query: 280 GKGGQHVNTTDSAVRLTHFPTGIVVSMQDERSQQKNKAKAFTILRAXXXXXXXXXXXXXX 339
           GKGGQHVNTTDSAVR+THFP+GI + MQ+ERSQ +NKAKAF ILRA              
Sbjct: 288 GKGGQHVNTTDSAVRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLADLERKEREARE 347

Query: 340 XDARKEQVTTTDRSDKIRTYNYPQNRVTDHRCGLTLYALDAIMKGERLGEVIDAMRQFDD 399
             ARK+QV++TDRSDKIRTYN+PQNRVTDHRC ++L+AL  ++ GERL E+ID+M ++D 
Sbjct: 348 RSARKDQVSSTDRSDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARYDS 407

Query: 400 RERARL 405
            ++A+L
Sbjct: 408 EQKAKL 413

>Kwal_23.3467
          Length = 400

 Score =  478 bits (1231), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 228/361 (63%), Positives = 290/361 (80%), Gaps = 1/361 (0%)

Query: 45  ELQPALISKATEYMKELAELNKQLSQGE-TFDVAQQKRFAHLASIEDAFQTYQTQLSNYK 103
           EL P L+ +A +Y++EL +L + +++G  +FDV +QK+F+ L+++ D+F+ Y  ++S +K
Sbjct: 30  ELHPLLLKRAEKYVEELQKLEEWMAKGGGSFDVERQKKFSKLSAVVDSFRIYSREVSTFK 89

Query: 104 SLQELAQSDPSLKEEAQLELTELVPQLSQTMNELQSRLIPPHPFADKACILELRPGVGGT 163
            LQ++ + DPSL++EA+LEL ++ PQL +T + L ++L+PPHPFAD+ CILE+RPGVGG 
Sbjct: 90  ELQDMVKDDPSLRDEAELELVQIKPQLEKTASSLLTQLLPPHPFADRPCILEIRPGVGGI 149

Query: 164 EAMIFTQDLLNMYIGYAHSHKWKYRILAQDENESGDGLVDAILNIDEPGSYDKLRFESGV 223
           EAMIF QDLLNMYI +AH  +WKY +++  ENESG G+VDAIL+IDEPGSY+ LRFESGV
Sbjct: 150 EAMIFAQDLLNMYINFAHIKRWKYHLISSSENESGSGIVDAILSIDEPGSYEMLRFESGV 209

Query: 224 HRVQRIPATETKGRTHTSTAAVVVLPQMGDDSDRAINAYERTFKPDEIRIDVMRARGKGG 283
           HRVQRIPATETKGRTHTSTAAVVVLPQM +DS++  ++YERTFKPDEIRIDVMRARGKGG
Sbjct: 210 HRVQRIPATETKGRTHTSTAAVVVLPQMAEDSEKEADSYERTFKPDEIRIDVMRARGKGG 269

Query: 284 QHVNTTDSAVRLTHFPTGIVVSMQDERSQQKNKAKAFTILRAXXXXXXXXXXXXXXXDAR 343
           QHVNTTDSAVRLTH+P+GIV++MQ+ERSQ KNKAKAF ILRA                 R
Sbjct: 270 QHVNTTDSAVRLTHYPSGIVINMQNERSQHKNKAKAFAILRARLAEAERKEKEEKARALR 329

Query: 344 KEQVTTTDRSDKIRTYNYPQNRVTDHRCGLTLYALDAIMKGERLGEVIDAMRQFDDRERA 403
           K QVTTTDRSDKIRTYN+PQNRVTDHRCG  L+ ++ IM GERL +VI AM  +D   RA
Sbjct: 330 KGQVTTTDRSDKIRTYNFPQNRVTDHRCGFNLHDMEGIMAGERLEDVISAMSVYDSDSRA 389

Query: 404 R 404
           +
Sbjct: 390 K 390

>CAGL0E04928g 476972..478189 similar to sp|P30775 Saccharomyces
           cerevisiae YGL143c MRF1 peptide chain release factor,
           hypothetical start
          Length = 405

 Score =  459 bits (1182), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 289/388 (74%), Gaps = 6/388 (1%)

Query: 15  LRGFSIGRQIFPRGNRFQSTIPSTASNGHVELQ---PALISKATEYMKELAELNKQLSQG 71
           L+  S  R    R  RF ST  S A    +E Q   P L+ + +   KELAEL KQ+S G
Sbjct: 8   LKVLSRARIPVWRAYRFASTAASEADEEALEFQELNPLLLKRVSGVSKELAELEKQISNG 67

Query: 72  ETFDVAQQKRFAHLASIEDAFQTYQTQLSNYKSLQELAQSDPSLKEEAQLELTELVPQLS 131
              DV  Q+++  L S++D +  Y+ QL NY+ L+E+   D SL EEA  EL ELVP L 
Sbjct: 68  YDEDV--QRKYNSLMSLQDVYDRYKEQLGNYRELKEMIDVDKSLAEEAAAELHELVPNLK 125

Query: 132 QTMNELQSRLIPPHPFADKACILELRPGVGGTEAMIFTQDLLNMYIGYAHSHKWKYRILA 191
           +T  +L  RLIPPHPFA+KAC+LELRPGVGG+EAMIF +DLLNMYIGYAH+ KWK+ I++
Sbjct: 126 KTTQDLLHRLIPPHPFAEKACMLELRPGVGGSEAMIFAKDLLNMYIGYAHNKKWKHHIVS 185

Query: 192 QDENESGDGLVDAILNIDEPGSYDKLRFESGVHRVQRIPATETKGRTHTSTAAVVVLPQM 251
             ENE+G G++DA+L IDEPG+Y+ L++E+GVHRVQRIPATE+KGRTHTSTAAVVVLPQ+
Sbjct: 186 IRENEAGSGIMDAVLAIDEPGTYNILKYEAGVHRVQRIPATESKGRTHTSTAAVVVLPQL 245

Query: 252 GDDSDRAINAYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPTGIVVSMQDERS 311
           GD+  + ++A+ER+FKP+EIRIDV RA GKGGQHVNTT+SAVRLTH PTGI++ MQDERS
Sbjct: 246 GDEG-KDLDAFERSFKPEEIRIDVKRASGKGGQHVNTTESAVRLTHIPTGIMIHMQDERS 304

Query: 312 QQKNKAKAFTILRAXXXXXXXXXXXXXXXDARKEQVTTTDRSDKIRTYNYPQNRVTDHRC 371
           Q +NKAKAF+ILR+                 RKEQVTT DRSDKIRTYN+ QNR+TDHRC
Sbjct: 305 QHRNKAKAFSILRSKLAELEQQQKAEKERQVRKEQVTTMDRSDKIRTYNFSQNRITDHRC 364

Query: 372 GLTLYALDAIMKGERLGEVIDAMRQFDD 399
           GL LY L+ ++ GERL +VI+A+R FDD
Sbjct: 365 GLNLYDLEGVISGERLDDVINAVRSFDD 392

>Scas_590.1
          Length = 116

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (71%)

Query: 278 ARGKGGQHVNTTDSAVRLTHFPTGIVVSMQDERSQQKNK 316
            RG GGQ +N  +S V+L H PTGI+VS Q+ RS+ +N+
Sbjct: 1   GRGAGGQKINKCNSKVQLKHVPTGIIVSCQETRSRDQNR 39

>YLR281C (YLR281C) [3672] chr12 complement(704495..704962) Protein
           containing a peptidyl-tRNA hydrolase domain, which
           contain peptidyl-tRNA hydrolase activity [468 bp, 155
           aa]
          Length = 155

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (71%)

Query: 278 ARGKGGQHVNTTDSAVRLTHFPTGIVVSMQDERSQQKNK 316
            RG GGQ +N  +S V+L H PTGIVV  Q+ RS+++N+
Sbjct: 45  GRGPGGQKINKCNSKVQLRHEPTGIVVECQETRSREQNR 83

>Kwal_56.23313
          Length = 158

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%)

Query: 278 ARGKGGQHVNTTDSAVRLTHFPTGIVVSMQDERSQQKNK 316
            RG GGQ +N  +S V+L H PTGIVV  Q+ RS+ +N+
Sbjct: 47  GRGPGGQKINKCNSKVQLRHLPTGIVVECQETRSRDQNR 85

>AGR281C [4592] [Homologous to ScYLR281C - SH] (1270719..1271249)
           [531 bp, 176 aa]
          Length = 176

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 27/38 (71%)

Query: 279 RGKGGQHVNTTDSAVRLTHFPTGIVVSMQDERSQQKNK 316
           RG GGQ +N  +S V+L H P+GIV+  Q  RS+++N+
Sbjct: 62  RGPGGQKINKCNSKVQLRHVPSGIVIECQATRSREQNR 99

>KLLA0C04642g complement(427221..427727) some similarities with
           sgd|S0004271 Saccharomyces cerevisiae YLR281c,
           hypothetical start
          Length = 168

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 11/71 (15%)

Query: 249 PQMGDDSDRAINAYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPTGIVVSMQD 308
           P+  DD +R I   E  F        +   RG GGQ +N  +S V+L H PTGIVV  Q 
Sbjct: 38  PKFTDDMERDI---EEKF--------LHGGRGPGGQKINKCNSKVQLRHVPTGIVVDCQA 86

Query: 309 ERSQQKNKAKA 319
            RS+ +N+  A
Sbjct: 87  TRSRDQNRKIA 97

>Sklu_2044.5 YLR281C, Contig c2044 6176-6547
          Length = 123

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 28/42 (66%)

Query: 278 ARGKGGQHVNTTDSAVRLTHFPTGIVVSMQDERSQQKNKAKA 319
            RG GGQ +N  +S V+L H PTGIVV  Q+ RS+ +N+  A
Sbjct: 13  GRGPGGQKINKCNSKVQLKHLPTGIVVECQETRSRDQNRTIA 54

>CAGL0F05027g complement(512367..512930) similar to tr|Q05863
           Saccharomyces cerevisiae YLR281c, hypothetical start
          Length = 187

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%)

Query: 280 GKGGQHVNTTDSAVRLTHFPTGIVVSMQDERSQQKNKAKA 319
           G GGQ +N  +S V++ H P+ IVV+ Q  RS+ +N+  A
Sbjct: 61  GPGGQKINKCNSKVQIKHVPSNIVVTCQATRSRDQNRKIA 100

>KLLA0A07381g complement(660082..660579) similar to sp|Q12322
           Saccharomyces cerevisiae YOL114c singleton, start by
           similarity
          Length = 165

 Score = 31.6 bits (70), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 245 VVVLPQMGDDSDRAINAYERTFKPDEIRIDVM-----RARGKGGQHVNTTDSAVRLTHFP 299
           + VL +   D+     A+   FK + + + +      R+RGKGGQ+VN  +S   LT + 
Sbjct: 2   LTVLKRHYSDAIAVGRAWIEGFKAENVPLKLFVATYDRSRGKGGQNVNKVNSKCTLTLYN 61

Query: 300 TGIVVSMQDERSQQ 313
                   DE  +Q
Sbjct: 62  FSKCSWFPDEIRKQ 75

>KLLA0F20966g 1956869..1959895 similar to sp|P08004 Saccharomyces
           cerevisiae YNL192w CHS1 chitin synthase I, start by
           similarity
          Length = 1008

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 5/68 (7%)

Query: 343 RKEQVTTTDRSDKIRTYN-----YPQNRVTDHRCGLTLYALDAIMKGERLGEVIDAMRQF 397
           R + VT      +  T+N     YP  R T+    +T+Y  D I+ G+ L  V+D +R F
Sbjct: 301 RYQAVTCEPNQFQSNTFNLRQLMYPYPRRTELMIVITMYNEDDILLGKTLKGVMDNIRHF 360

Query: 398 DDRERARL 405
             R  + +
Sbjct: 361 TKRSNSSV 368

>Kwal_26.7635
          Length = 691

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 65  NKQLSQGETFDVAQQKRFAHLASIEDAFQTYQTQLSNYKSLQELAQSDPSLKE 117
           N   ++  TFDV ++  F  +    D F    + L   KS Q+L  SDPSLK+
Sbjct: 244 NLTFNKISTFDVTRKLNFLKI----DVFARIPSILLPSKSWQQLNSSDPSLKD 292

>Scas_684.29
          Length = 508

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 47/109 (43%), Gaps = 16/109 (14%)

Query: 80  KRFAHLASIEDAFQTYQTQLSNYKSLQELAQSDPSLKEEAQLELTELVPQLSQTMNELQS 139
           KR    AS+E   Q+  +Q    K  Q+L  S P+LK   ++  T L P        +Q+
Sbjct: 22  KRSPKTASLEMETQSNDSQTIPTK-FQDLTLSPPTLKAIEKMGFTTLTP--------VQA 72

Query: 140 RLIPPHPFADKACILELRPGVGGTEAMIFTQDLLNMYIGYAHSHKWKYR 188
           R IPP   A +  +   + G G T A +         I   HS K+K R
Sbjct: 73  RTIPPL-MAGRDVLGAAKTGSGKTLAFLIPA------IELLHSLKFKPR 114

>KLLA0F12210g 1125630..1128764 highly similar to sp|P16521
           Saccharomyces cerevisiae YLR249w YEF3 translation
           elongation factor eEF3 P6.7.f5.1, start by similarity
          Length = 1044

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 44  VELQPALISKATEYMKELAEL--NKQLSQGETFDVAQQKRF-AHLASIEDAFQTYQTQLS 100
           V L P++  KA +  KE+  L  +  L+  +  + A  K F   L S  D+   +Q ++S
Sbjct: 89  VNLVPSICDKAGDKDKEIQVLASDALLAIAKAINPAAIKAFLPLLTSALDSTSKWQEKVS 148

Query: 101 NYKSLQELAQSDPSLKEEAQLELTELVPQLSQTM 134
               +  L  +    KE+  L + EL+P LS+ M
Sbjct: 149 ILAVISVLVDT---AKEQLGLRMPELIPALSEAM 179

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,962,919
Number of extensions: 473136
Number of successful extensions: 1637
Number of sequences better than 10.0: 51
Number of HSP's gapped: 1657
Number of HSP's successfully gapped: 51
Length of query: 407
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 303
Effective length of database: 12,995,837
Effective search space: 3937738611
Effective search space used: 3937738611
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)