Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_617.742042021040.0
AGR323C4023929081e-120
YGR193C (PDX1)4104218841e-116
Sklu_2014.24153918821e-115
Kwal_33.154354103958701e-114
CAGL0G09361g4294057881e-101
KLLA0E09768g4053907723e-99
Scas_694.104791842355e-21
YNL071W (LAT1)4821832091e-17
Sklu_2037.44711862072e-17
CAGL0J10186g469822029e-17
AER364W453821992e-16
KLLA0F04741g473781964e-16
Kwal_23.47254721821939e-16
YBR208C (DUR1,2)183558790.15
Kwal_56.2393444253760.22
KLLA0D16522g46876760.23
Scas_685.920064740.26
Sklu_2380.528964730.42
AGL200W436105730.53
KLLA0E24046g28075720.53
KLLA0A04928g86186730.65
Kwal_56.2289238947711.1
CAGL0E01287g41371701.1
ADR051C181958692.1
Sklu_2124.1183058692.2
Scas_693.2944271673.1
Sklu_1778.341537663.6
Sklu_2172.143253663.7
Kwal_26.890381547655.0
YDR148C (KGD2)46371655.7
KLLA0F20834g61664656.0
CAGL0G01100g522143646.2
Scas_721.40183458656.7
KLLA0E08107g182958656.8
YKL024C (URA6)20464628.0
Kwal_27.11951186958648.1
CAGL0L09867g26064628.6
KLLA0E08030g30264629.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_617.7
         (420 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_617.7                                                            815   0.0  
AGR323C [4634] [Homologous to ScYGR193C (PDX1) - SH] (1334333..1...   354   e-120
YGR193C (PDX1) [2143] chr7 complement(884512..885744) Pyruvate d...   345   e-116
Sklu_2014.2 YGR193C, Contig c2014 2083-3330 reverse complement        344   e-115
Kwal_33.15435                                                         339   e-114
CAGL0G09361g 893614..894903 similar to sp|P16451 Saccharomyces c...   308   e-101
KLLA0E09768g 865604..866821 similar to sp|P16451 Saccharomyces c...   301   3e-99
Scas_694.10                                                            95   5e-21
YNL071W (LAT1) [4519] chr14 (491522..492970) Dihydrolipoamide S-...    85   1e-17
Sklu_2037.4 YNL071W, Contig c2037 4059-5474 reverse complement         84   2e-17
CAGL0J10186g complement(995223..996632) highly similar to sp|P12...    82   9e-17
AER364W [2865] [Homologous to ScYNL071W (LAT1) - SH] complement(...    81   2e-16
KLLA0F04741g complement(463107..464528) similar to sp|P12695 Sac...    80   4e-16
Kwal_23.4725                                                           79   9e-16
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...    35   0.15 
Kwal_56.23934                                                          34   0.22 
KLLA0D16522g complement(1394850..1396256) similar to sp|P19262 S...    34   0.23 
Scas_685.9                                                             33   0.26 
Sklu_2380.5 YKL024C, Contig c2380 11212-12081                          33   0.42 
AGL200W [4112] [Homologous to ScYDR148C (KGD2) - SH] complement(...    33   0.53 
KLLA0E24046g complement(2136583..2137425) similar to ca|CA3771|C...    32   0.53 
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    33   0.65 
Kwal_56.22892                                                          32   1.1  
CAGL0E01287g 120567..121808 highly similar to sp|P19262 Saccharo...    32   1.1  
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...    31   2.1  
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement           31   2.2  
Scas_693.29                                                            30   3.1  
Sklu_1778.3 YDL044C, Contig c1778 2200-3447 reverse complement         30   3.6  
Sklu_2172.1 YDR148C, Contig c2172 307-1605                             30   3.7  
Kwal_26.8903                                                           30   5.0  
YDR148C (KGD2) [993] chr4 complement(753669..755060) 2-oxoglutar...    30   5.7  
KLLA0F20834g complement(1942016..1943866) weakly similar to sp|P...    30   6.0  
CAGL0G01100g 104031..105599 similar to tr|Q06137 Saccharomyces c...    29   6.2  
Scas_721.40                                                            30   6.7  
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...    30   6.8  
YKL024C (URA6) [3231] chr11 complement(392169..392783) Uridine-m...    28   8.0  
Kwal_27.11951                                                          29   8.1  
CAGL0L09867g 1054344..1055126 some similarities with sp|P15700 S...    28   8.6  
KLLA0E08030g complement(724562..725470) some similarities with s...    28   9.7  

>Scas_617.7
          Length = 420

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/420 (96%), Positives = 404/420 (96%)

Query: 1   MLSYNAMRSCLQGQTXXXXXXXXXXXXXXXXAQKFTMPAMSPTMEKGGIVSWKFKVGEPF 60
           MLSYNAMRSCLQGQT                AQKFTMPAMSPTMEKGGIVSWKFKVGEPF
Sbjct: 1   MLSYNAMRSCLQGQTRRSLIRSIHLSRSLLSAQKFTMPAMSPTMEKGGIVSWKFKVGEPF 60

Query: 61  SSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYLADVDDDLSTLKIS 120
           SSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYLADVDDDLSTLKIS
Sbjct: 61  SSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYLADVDDDLSTLKIS 120

Query: 121 AEEEEQVKVTPVSKVEEKTTSGNKEPLQNTKKAKESPIATDKNGVLQVAKSNQTLLPSVS 180
           AEEEEQVKVTPVSKVEEKTTSGNKEPLQNTKKAKESPIATDKNGVLQVAKSNQTLLPSVS
Sbjct: 121 AEEEEQVKVTPVSKVEEKTTSGNKEPLQNTKKAKESPIATDKNGVLQVAKSNQTLLPSVS 180

Query: 181 LLLAANNISKEDAIRNIKASGRDGLLLKGDVLAYLGKIPESSLIKVSEYVKNKEKQDFSH 240
           LLLAANNISKEDAIRNIKASGRDGLLLKGDVLAYLGKIPESSLIKVSEYVKNKEKQDFSH
Sbjct: 181 LLLAANNISKEDAIRNIKASGRDGLLLKGDVLAYLGKIPESSLIKVSEYVKNKEKQDFSH 240

Query: 241 IELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFIEEG 300
           IELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFIEEG
Sbjct: 241 IELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFIEEG 300

Query: 301 FEYTHAMPLSNINSQYFDDIFEDLITTAPREPRFQVNYELYCPVEEEERFTRKDREDIFD 360
           FEYTHAMPLSNINSQYFDDIFEDLITTAPREPRFQVNYELYCPVEEEERFTRKDREDIFD
Sbjct: 301 FEYTHAMPLSNINSQYFDDIFEDLITTAPREPRFQVNYELYCPVEEEERFTRKDREDIFD 360

Query: 361 LLAGSESRTPLRGPVVSNSEASTPASEWTLSLELEVSDKYSDSKQKAERFLEYMWQLDLS 420
           LLAGSESRTPLRGPVVSNSEASTPASEWTLSLELEVSDKYSDSKQKAERFLEYMWQLDLS
Sbjct: 361 LLAGSESRTPLRGPVVSNSEASTPASEWTLSLELEVSDKYSDSKQKAERFLEYMWQLDLS 420

>AGR323C [4634] [Homologous to ScYGR193C (PDX1) - SH]
           (1334333..1335541) [1209 bp, 402 aa]
          Length = 402

 Score =  354 bits (908), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 202/392 (51%), Positives = 260/392 (66%), Gaps = 28/392 (7%)

Query: 35  FTMPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDG 94
           F MPAMSPTMEKGGIVSWKFKVGEPF +GDV+LEVETDKAQIDVEAQDDGKLA I+KGDG
Sbjct: 31  FHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVILEVETDKAQIDVEAQDDGKLAAIVKGDG 90

Query: 95  SKDVDVGETIAYLADVDDDLSTLKI----SAEEEEQVKVTPVSKVEEKTTSGNKEPLQNT 150
           SKDVDVGET+A+LA+V+DDLS L+I    ++E  ++ +  P  KV E          Q  
Sbjct: 91  SKDVDVGETVAFLAEVEDDLSALEIPKVVTSEAPKEAEAKPSPKVSE----------QAP 140

Query: 151 KKAKESPIATDKNGVLQVAKSNQTLLPSVSLLLAANNISKEDAIRNIKASGRDGLLLKGD 210
             A+++P  T  NG+LQ A  NQTLLPSV  LL AN ++ E+A  NIKASG +G +LKGD
Sbjct: 141 APARKTPSKTVSNGILQQADKNQTLLPSVITLLHANGVTVEEAFANIKASGPNGRILKGD 200

Query: 211 VLAYLGKIPESSLIKVSEYVKNKEKQDFSHIELGSLTKAEPPQSEKLEDKAIEKISKEPV 270
           VL YLGKI   S++KVSEY+K  E  D S+IE   L  A+PP+     DK  E     P 
Sbjct: 201 VLGYLGKISADSVVKVSEYIKKFEHLDLSNIE---LRPAQPPKGAA--DKKAEPKPAPPA 255

Query: 271 L--LHSEITLKVPSNVSRERLDNTVKSFIEEGFEYTHAMPLSNINSQYFDDIFEDLITTA 328
              LH  + LKVP +VS ER  N +K +I E     H   L N  S  FD +FE+L++  
Sbjct: 256 YRTLHERLILKVPEHVSFERFSNALKQYIREATYTAHGEALDNPYSDRFDPLFEELLSVQ 315

Query: 329 PREPRFQVNYELYCPVEEEERFTRKDREDIFDLLAGSESRTPLRGPVVSNSEASTPASEW 388
           PREPRF+V+Y++  P+      + K +EDIFD+L+G+   +    P  S+SE S  A E+
Sbjct: 316 PREPRFEVSYDV-LPLTVVPS-SPKPKEDIFDILSGNSVES---KPAPSSSEPS--AHEY 368

Query: 389 TLSLELEVSDKYSDSKQKAERFLEYMWQLDLS 420
            L L L+V +K+SDS+ +A RF++Y+ +LDLS
Sbjct: 369 ALDLYLKVENKFSDSETRAARFIDYIKELDLS 400

>YGR193C (PDX1) [2143] chr7 complement(884512..885744) Pyruvate
           dehydrogenase complex protein X, the binding protein for
           Lpd1p [1233 bp, 410 aa]
          Length = 410

 Score =  345 bits (884), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 196/421 (46%), Positives = 273/421 (64%), Gaps = 16/421 (3%)

Query: 1   MLSYNAMRSCLQGQTXXXXXXXXXXXXXXXXAQKFTMPAMSPTMEKGGIVSWKFKVGEPF 60
           MLS  +  S L+  T                 + F+MPAMSPTMEKGGIVSWK+KVGEPF
Sbjct: 1   MLSAISKVSTLKSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPF 60

Query: 61  SSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYLADVDDDLSTLKIS 120
           S+GDV+LEVETDK+QIDVEA DDGKLAKILK +GSKDVDVGE IAY+ADVDDDL+T+K+ 
Sbjct: 61  SAGDVILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLP 120

Query: 121 AEEE-EQVKVTPVSKVEEKTTSGNKEPLQNTKKAKESPIATDKNGVLQVAKSNQTLLPSV 179
            E      K   + K    +T   +   Q+ KKA  +PI T        A   QTLLPSV
Sbjct: 121 QEANTANAKSIEIKKPSADSTEATQ---QHLKKATVTPIKTVDGS---QANLEQTLLPSV 174

Query: 180 SLLLAANNISKEDAIRNIKASGRDGLLLKGDVLAYLGKIPESSLIKVSEYVKNKEKQDFS 239
           SLLLA NNISK+ A++ I  SG +G LLKGDVLAYLGKIP+ S+ KV+E++K  E+ D S
Sbjct: 175 SLLLAENNISKQKALKEIAPSGSNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLS 234

Query: 240 HIELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFIEE 299
           +I+   L   +P  +E+ + KA +K    PV    ++    P+++  ++L  ++ SF++E
Sbjct: 235 NIKPIQL---KPKIAEQAQTKAADKPKITPVEFEEQLVFHAPASIPFDKLSESLNSFMKE 291

Query: 300 GFEYTHAMPLSNINSQYFDDIFEDLITTAPREPRFQVNYELYCPVEEEERFTRKDREDIF 359
            ++++H  PL + NS+YFD IFEDL+T +PREPRF+ +Y+L    +         +EDIF
Sbjct: 292 AYQFSHGTPLMDTNSKYFDPIFEDLVTLSPREPRFKFSYDLMQIPKANNMQDTYGQEDIF 351

Query: 360 DLLAGSESRTPLRGPVVSNSEASTP-ASEWTLSLELEVSD-KYSDSKQKAERFLEYMWQL 417
           DLL GS++      PV    E + P  +E+ L+L + V++ K++D++ KA+RFL+Y+ +L
Sbjct: 352 DLLTGSDATASSVRPV----EKNLPEKNEYILALNVSVNNKKFNDAEAKAKRFLDYVREL 407

Query: 418 D 418
           +
Sbjct: 408 E 408

>Sklu_2014.2 YGR193C, Contig c2014 2083-3330 reverse complement
          Length = 415

 Score =  344 bits (882), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 194/391 (49%), Positives = 258/391 (65%), Gaps = 21/391 (5%)

Query: 32  AQKFTMPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILK 91
           AQ FTMPAMSPTMEKGG+V WK+KVGEPFS+GDVLLEVETDKAQIDVEAQDDGKLA I+ 
Sbjct: 36  AQAFTMPAMSPTMEKGGVVEWKYKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAAIII 95

Query: 92  GDGSKDVDVGETIAYLADVDDDLSTLKISAEEEEQVKVTPVSKVEEKTTSGNKEPLQNTK 151
            +GSKD+ VGETIAYLA+VDDDL+TL+I  +E    K TP  +    T +   EP ++  
Sbjct: 96  DNGSKDIKVGETIAYLAEVDDDLATLEIPKQEPAAPKPTPKKQETAPTPAATPEPKKDNA 155

Query: 152 KAKESPIATDKNGVLQVAKSNQTLLPSVSLLLAANNISKEDAIRNIKASGRDGLLLKGDV 211
              E P     +G+L  A  +QTL PSV  LL  N IS EDA+ NIKASG +G +LKGDV
Sbjct: 156 PTSE-PKKDTPSGILSTANPSQTLFPSVQSLLHENGISVEDALNNIKASGPNGRILKGDV 214

Query: 212 LAYLGKIPESSLIKVSEYVKNKEKQDFSHIELGSLTKAEPPQSEKLEDKAIEKISK-EPV 270
           LAYLGKI    ++KV+EY+K+ E  D ++IE   L K E     KLE    + + K EPV
Sbjct: 215 LAYLGKISNDCVVKVTEYIKSGESLDLTNIE---LKKPE----LKLELGTSKTLLKPEPV 267

Query: 271 LLHSEITLKVPSNVSRERLDNTVKSFIEEGFEYTHAMPLSNINSQYFDDIFEDLITTAPR 330
           +    +TL+VPS VS ++L  +++S+I E    +H  P++   S Y+D IFE+LIT  PR
Sbjct: 268 VFTETLTLRVPSAVSSDQLSKSLRSYINEANYLSHEQPVNASTSDYYDPIFEELITPEPR 327

Query: 331 EPRFQVNYEL--YCPVEEEERFTRKDREDIFDLLAGSESRTPLRGPVVSNSEASTPASEW 388
           +PRF V+Y+L    PV      + K  +DIFDLL+G+ + T    P V     +T   E+
Sbjct: 328 QPRFSVSYQLTPLVPV-----LSPKQHDDIFDLLSGTSAAT--SSPQVEQPSKTT---EY 377

Query: 389 TLSLELEVSDKYSDSKQKAERFLEYMWQLDL 419
           +L + ++V+ K+ D+  KA+RF+EY+  L+L
Sbjct: 378 SLDVSVQVNGKFDDATLKAQRFIEYLKDLEL 408

>Kwal_33.15435
          Length = 410

 Score =  339 bits (870), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/395 (49%), Positives = 268/395 (67%), Gaps = 24/395 (6%)

Query: 32  AQKFTMPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILK 91
           AQ F MPAMSPTMEKGG+V WKFKVGEPFS+GDVLLEVETDKAQIDVEAQDDGKLAKIL 
Sbjct: 29  AQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKILV 88

Query: 92  GDGSKDVDVGETIAYLADVDDDLSTLKISAEEEEQVKVTPVSKVEEKTTS------GNKE 145
            DG+KD++VGE IAYLA+ +DDL+TL++   E +Q    P  KVE+   +      G++ 
Sbjct: 89  NDGAKDINVGEPIAYLAEPEDDLATLELPQSENKQSTKAPEPKVEKDVKASAQKGQGSEP 148

Query: 146 PLQNTKKAKESPIATDKNGVLQVAKSNQTLLPSVSLLLAANNISKEDAIRNIKASGRDGL 205
             Q   +   S  + D +GV+  A   QTLLPSV LLL ANNIS EDA+ NI+ASG +G 
Sbjct: 149 KAQKQTQVSSSSGSKDVSGVMVKADPAQTLLPSVQLLLHANNISNEDALNNIQASGPNGR 208

Query: 206 LLKGDVLAYLGKIPESSLIKVSEYVKNKEKQDFSHIELGSLTKAEPPQSEKLEDKAIEK- 264
           +LKGDVL+YLGK+ + ++ K+++Y++  E  D S+IE   L K EP        KA E  
Sbjct: 209 ILKGDVLSYLGKVSQEAIAKLTKYIQKGEVLDLSNIE---LKKPEP------ASKAPESV 259

Query: 265 ISKEPVLLHSEITLKVPSNVSRERLDNTVKSFIEEGFEYTHAMPLSNINSQYFDDIFEDL 324
           + KEPV+   ++ LKV  NV+ E+   ++KS+I+E    +H  P+SN+ S Y+D +FE+L
Sbjct: 260 VKKEPVIFTEQLHLKVEPNVTFEQFSRSLKSYIDEARIISHGEPVSNVQSDYYDALFEEL 319

Query: 325 ITTAPREPRFQVNYELYCPVEEEERFTRKDREDIFDLLAGSESRTPLRGPVVSNSEASTP 384
           IT  PR+PRF V+Y++  P+        K ++DIFDLLAG+++ TP      S    +  
Sbjct: 320 ITPEPRKPRFSVSYDI-IPLNARS-LNAKQQDDIFDLLAGTKN-TP-----ASTESGNLQ 371

Query: 385 ASEWTLSLELEVSDKYSDSKQKAERFLEYMWQLDL 419
           ++E  ++L ++VSDK+SD+K KAERF++Y+  L++
Sbjct: 372 SNEVLVNLSVQVSDKFSDAKLKAERFVDYVKDLEI 406

>CAGL0G09361g 893614..894903 similar to sp|P16451 Saccharomyces
           cerevisiae YGR193c PDX1 pyruvate dehydrogenase complex
           protein X, hypothetical start
          Length = 429

 Score =  308 bits (788), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 187/405 (46%), Positives = 242/405 (59%), Gaps = 44/405 (10%)

Query: 35  FTMPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDG 94
           F MPAMSPTMEKGGIVSWKFK  + F++GDVLLEVETDKAQIDVEAQDDGKLAKI++GDG
Sbjct: 43  FLMPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDG 102

Query: 95  SKDVDVGETIAYLADVDDDLSTLKISAEEEEQVKVTPVSKVEEKTTSGNKE--PLQNT-- 150
           SKDV VG+ IA+ AD +DDLSTLKI    E   +V+  S  E++  + ++E  PLQ    
Sbjct: 103 SKDVLVGDVIAFTADPEDDLSTLKIPEVTESMKQVSSGSGKEDQKPAKSEEPAPLQRKEG 162

Query: 151 KKAKESPIATDKNGVLQVAKSNQTLLPSVSLLLAANNISKEDAIRNIKASGRDGLLLKGD 210
           K   ES  A     VL  A ++QTLLPSV + LA N ISKEDA+ NIKASG +G +LKGD
Sbjct: 163 KNVSESKTAKSSGDVLTTADASQTLLPSVVMALADNGISKEDALANIKASGANGRILKGD 222

Query: 211 VLAYLGKIPESSLIKVSEYVKNKEKQDFSHIELGSL--------------TKAEPPQSEK 256
           VLAY GKI + S++KV+EYV   +K D S+IE   L                    Q + 
Sbjct: 223 VLAYAGKIQQDSVVKVAEYVNRNQKLDLSNIERIVLEVNSEEGGDGQAQAQAQAQAQGQG 282

Query: 257 LEDKAIEKISK----EPVLLHSEITLKVPSNVSRERLDNTVKSFIEEGFEYTHAMPLSNI 312
            +     K++K    EP+ +  EI L+V   V   R +  V+ +I++ ++YTH  PL N 
Sbjct: 283 QDSGKTGKLAKPAQVEPIRIQEEILLEVRRGVDFTRFERAVREYIDDIYQYTHEQPLENT 342

Query: 313 NSQYFDDIFEDLITTAPREPRFQVNYELYCPVEEEERFTRKDREDIFDLLAGSESRTPLR 372
            S+ +D +FEDL+T  PR  RF V Y L          T    EDIFDLL          
Sbjct: 343 MSERYDSLFEDLVTVDPRSARFDVEYSLL--------ETTDGSEDIFDLL---------- 384

Query: 373 GPVVSNSEASTPASEWTLSLELEVSDKYSDSKQKAERFLEYMWQL 417
           GP     E       ++L + + V+DKY D+ +KA+RF+E + QL
Sbjct: 385 GP----GEVKEGKQVYSLEVSVTVNDKYDDAVEKADRFMECLRQL 425

>KLLA0E09768g 865604..866821 similar to sp|P16451 Saccharomyces
           cerevisiae YGR193c PDX1 pyruvate dehydrogenase complex
           protein X, start by similarity
          Length = 405

 Score =  301 bits (772), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 174/390 (44%), Positives = 248/390 (63%), Gaps = 12/390 (3%)

Query: 32  AQKFTMPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILK 91
           AQ F MPAMSPTME+GG+V WKFK G+ FS+GDVLLEVETDKA IDVEAQDDGKLAKILK
Sbjct: 24  AQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVETDKATIDVEAQDDGKLAKILK 83

Query: 92  GDGSKDVDVGETIAYLADVDDDLSTLKISAEEEEQVKVTPVSKVEEKTTSGNKEPLQNTK 151
            +G+KD+ VGE IAY+ADVDDDL+TL+     E + +  PV   +E+      +P++ T 
Sbjct: 84  ENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKESKPVETKKEEA-----KPVEKTD 138

Query: 152 KAKESPIAT--DKNGVLQVAKSNQTLLPSVSLLLAANNISKEDAIRNIKASGRDGLLLKG 209
           K K++  +    KNG +Q A ++QTL PSV  LL  NNIS  DA+  IKA+G +G +LKG
Sbjct: 139 KKKQTSASKTPSKNGSVQ-ANASQTLFPSVLSLLEENNISTADALDKIKATGPNGRILKG 197

Query: 210 DVLAYLGKIPESSLIKVSEYVKNKEKQDFSHIELGSLTKAEPPQSEKLEDKAIEKISKEP 269
           DVLAYLGKI + SL KV+EY+K+ EK D ++IEL    +     +     K  + +   P
Sbjct: 198 DVLAYLGKISQDSLNKVTEYIKSHEKLDLTNIELRPARETAAAAAAAQAAKPAKPL---P 254

Query: 270 VLLHSEITLKVPSNVSRERLDNTVKSFIEEGFEYTHAMPLSNINSQYFDDIFEDLITTAP 329
           ++L  +ITL VP NV+  +L   + S+++E     H  PL+N  S+ +D +FE+L+   P
Sbjct: 255 LVLSEQITLHVPENVTYSQLSAAIASYVKECSFLAHDEPLTNDASELYDPLFEELLVQEP 314

Query: 330 REPRFQVNYELYCPVEEEERFTRKDREDIFDLLAGSESRTPLRGPVVSNSEASTPASEWT 389
            +PRF+V Y +          T   + DIFDLL+G+ ++  L+    + S+      E+ 
Sbjct: 315 TKPRFKVTYNIVDLEPTPRHRTSSPQPDIFDLLSGTTTQE-LQQEASAVSKQQQTRHEYA 373

Query: 390 LSLELEVSDKYSDSKQKAERFLEYMWQLDL 419
           L++ + V +  +D+KQ+AE F+  +  L+L
Sbjct: 374 LNVSVAVDESLTDAKQRAENFVAQLSNLEL 403

>Scas_694.10
          Length = 479

 Score = 95.1 bits (235), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 96/184 (52%), Gaps = 18/184 (9%)

Query: 37  MPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSK 96
           MP++SPTM  G +V+W  +VG+  + GDVL E+ETDKAQ+D E QDDG LAKIL  +G+K
Sbjct: 43  MPSLSPTMTHGNLVAWSKQVGDQLAPGDVLAELETDKAQMDFEFQDDGYLAKILVPEGTK 102

Query: 97  DVDVGETIA-YLADVDD--DLSTLKISAEEEEQVKVTPVSKVEEK-----TTSGNKEPLQ 148
           DV + + IA Y+ D DD       KI    +     T     EEK       +  ++P Q
Sbjct: 103 DVPINKPIAVYVEDADDVAAFKDFKIEDSADAAATTTTTEVKEEKPQQPEKINAQQQPTQ 162

Query: 149 NTKKAKESPIATDKNGVLQVAKSNQTLLPSVSLLLAANNISKEDAIRNIKASGRDGLLLK 208
            +K+ K SP+  +      +A       P    +   N +    A++  K SG  G ++K
Sbjct: 163 KSKEQKSSPVTQEDTTGRIIAS------PLAKKIALENGV----ALKGFKGSGPHGRIVK 212

Query: 209 GDVL 212
            DVL
Sbjct: 213 DDVL 216

>YNL071W (LAT1) [4519] chr14 (491522..492970) Dihydrolipoamide
           S-acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [1449 bp, 482 aa]
          Length = 482

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 96/183 (52%), Gaps = 13/183 (7%)

Query: 37  MPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSK 96
           MPA+SPTM +G + +W  K G+  S G+V+ E+ETDKAQ+D E Q+DG LAKIL  +G+K
Sbjct: 39  MPALSPTMTQGNLAAWTKKEGDQLSPGEVIAEIETDKAQMDFEFQEDGYLAKILVPEGTK 98

Query: 97  DVDVGETIAYLADVDDDLSTLKISAEEEEQVKVTPVSKVEEKTTSGNKEPLQNTKKAKES 156
           D+ V + IA   +   D+   K    E+        S  + KT++  +      +K +E+
Sbjct: 99  DIPVNKPIAVYVEDKADVPAFKDFKLED--------SGSDSKTSTKAQPAEPQAEKKQEA 150

Query: 157 PIATDKNGVLQVAKSNQTLLPSVSLLLA--ANNISKEDAI--RNIKASGRDGLLLKGDVL 212
           P    K    +  KS+    P   +  +  A  I+ E  I  +++  +G  G + K D+ 
Sbjct: 151 PAEETKTSAPEAKKSD-VAAPQGRIFASPLAKTIALEKGISLKDVHGTGPRGRITKADIE 209

Query: 213 AYL 215
           +YL
Sbjct: 210 SYL 212

>Sklu_2037.4 YNL071W, Contig c2037 4059-5474 reverse complement
          Length = 471

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 96/186 (51%), Gaps = 4/186 (2%)

Query: 37  MPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSK 96
           MPA+SPTM +G +  W  KVG+  S G+V+ E+ETDKAQ+D E Q++G LAKIL  +G+K
Sbjct: 37  MPALSPTMTQGNLAVWSKKVGDSLSPGEVIAEIETDKAQMDFEFQEEGFLAKILVPEGTK 96

Query: 97  DVDVGETIAYLADVDDDLSTLKISAEEEEQVKVTPVSKVEEKTTSGNKEPLQNTKKAKES 156
           D+ V + IA   + + D+   K    ++        +  EE      +     TK A  +
Sbjct: 97  DIPVNKPIAVYVEEEGDVEAFKDFTVDDSASPAKKEAPKEEAPKEEEQA---ATKPASST 153

Query: 157 PIATDKNGVLQVAKSNQTLLPSVSLLLAANNISKEDAIRNIKASGRDGLLLKGDVLAYLG 216
           P + +K+     + S        S L     + K  A++N+  +G  G + K D+  +L 
Sbjct: 154 P-SQNKSSSSSSSSSAHAGRIFASPLAKTIALEKGIALKNVTGTGPHGRITKADIETFLA 212

Query: 217 KIPESS 222
           K PE++
Sbjct: 213 KGPETA 218

>CAGL0J10186g complement(995223..996632) highly similar to sp|P12695
           Saccharomyces cerevisiae YNL071w LAT1 dihydrolipoamide
           S-acetyltransferase, start by similarity
          Length = 469

 Score = 82.4 bits (202), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (65%)

Query: 37  MPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSK 96
           MPA+SPTM +G +  W  K G+  + GDVL E+ETDKAQ+D E QD+G LAKIL   G+K
Sbjct: 40  MPALSPTMSQGNLAVWSKKEGDSLAPGDVLAEIETDKAQMDFEFQDEGYLAKILVPAGTK 99

Query: 97  DVDVGETIAYLADVDDDLSTLK 118
           DV V   IA   + + D++  K
Sbjct: 100 DVAVSRPIAVYVEDEADVAAFK 121

>AER364W [2865] [Homologous to ScYNL071W (LAT1) - SH]
           complement(1312487..1313848) [1362 bp, 453 aa]
          Length = 453

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%)

Query: 37  MPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSK 96
           MPA+SPTM +G +  W  K G+  S G+VL EVETDKAQ+D E Q++G LAKIL  +G+K
Sbjct: 36  MPALSPTMTQGNLAVWTKKEGDKLSPGEVLAEVETDKAQMDFEFQEEGFLAKILVPEGAK 95

Query: 97  DVDVGETIAYLADVDDDLSTLK 118
           DV V + IA   + + D++  K
Sbjct: 96  DVPVNKPIAVYVEEEGDVAAFK 117

>KLLA0F04741g complement(463107..464528) similar to sp|P12695
           Saccharomyces cerevisiae YNL071w LAT1 dihydrolipoamide
           S-acetyltransferase, start by similarity
          Length = 473

 Score = 80.1 bits (196), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 53/78 (67%)

Query: 37  MPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSK 96
           MPA+SPTM +GG+  W   VG+    GDVL EVETDKAQ+D E Q++G LAKIL   G+K
Sbjct: 37  MPALSPTMVQGGLTEWSKNVGDRLEPGDVLAEVETDKAQMDFEFQEEGYLAKILVPAGTK 96

Query: 97  DVDVGETIAYLADVDDDL 114
           D+ V + +A   + + D+
Sbjct: 97  DIPVNKPLAVYVEEESDV 114

>Kwal_23.4725
          Length = 472

 Score = 79.0 bits (193), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 89/182 (48%), Gaps = 8/182 (4%)

Query: 37  MPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSK 96
           MPA+SPTM +G +  W  K G+    G+ + E+ETDKAQ++ E Q+DG LAKIL  +GSK
Sbjct: 37  MPALSPTMTQGNLAVWLKKAGDKLEPGEAIAEIETDKAQMEFEFQEDGYLAKILVPEGSK 96

Query: 97  DVDVGETIAYLADVDDDLSTLKISAEEEEQVKVTPVSKVEEKTTSGNKEPLQNTKKAKES 156
           D+ VG+ IA   + + D     + A  +   +     K          EP Q   + +ES
Sbjct: 97  DLPVGKPIAVYVEEEGD-----VGAFADFTAEEAAPEKPAAAPEKKQDEPQQQAAQKEES 151

Query: 157 PIATDK-NGVLQVAKSNQTLLPSVSLLLAANNISKEDAIRNIKASGRDGLLLKGDVLAYL 215
                K +G    A S   ++   S L     + K  +++ +  +G  G + K DV  YL
Sbjct: 152 GKPAKKSSGATSAAPSGDRII--ASPLAKTIALDKGISLKAVTGTGPRGRITKADVEEYL 209

Query: 216 GK 217
            K
Sbjct: 210 SK 211

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 52   WK--FKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYL 107
            WK    VG+   +G  LL +E  KA++ + A   GK+ KI  G+G   VD G+ +A +
Sbjct: 1775 WKSIASVGDVIEAGQGLLIIEAMKAEMIISAPKSGKIIKICHGNGDM-VDSGDIVAVI 1831

>Kwal_56.23934
          Length = 442

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%)

Query: 37  MPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKI 89
           +P M+ ++ +G +  +  +VGE     ++L  +ETDK  ++V A   GK+ K+
Sbjct: 60  VPPMAESLTEGSLKEYTKQVGEFIKQDELLATIETDKIDVEVNAPTSGKVTKL 112

>KLLA0D16522g complement(1394850..1396256) similar to sp|P19262
           Saccharomyces cerevisiae YDR148c KGD2 2-oxoglutarate
           dehydrogenase complex E2 component, start by similarity
          Length = 468

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 32  AQKFTMPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILK 91
           A    +P M+ ++ +G +  +  KVG+     ++L  +ETDK  ++V +   G +AK L 
Sbjct: 79  ATSVPVPPMAESLTEGSLKEYTKKVGDFIEKDELLATIETDKIDVEVISPISGTIAK-LN 137

Query: 92  GDGSKDVDVGETIAYL 107
                 V VGE IA +
Sbjct: 138 FSPDDTVTVGEEIAQI 153

>Scas_685.9
          Length = 200

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%)

Query: 238 FSHIELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFI 297
           F H+  G L +AE  +        I+    E +++  EITL +  N  +E  D  +K F+
Sbjct: 37  FVHLSAGDLLRAEQNREGSEFGTLIKHYITEGLIVPQEITLALLKNAIQENYDKGMKKFL 96

Query: 298 EEGF 301
            +GF
Sbjct: 97  VDGF 100

>Sklu_2380.5 YKL024C, Contig c2380 11212-12081
          Length = 289

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%)

Query: 238 FSHIELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFI 297
           F H+  G L +AE  +        I+   KE +++  E+T+ +  N  RE  ++  K F+
Sbjct: 125 FVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVTVALLQNAIRENFEDGKKRFL 184

Query: 298 EEGF 301
            +GF
Sbjct: 185 VDGF 188

>AGL200W [4112] [Homologous to ScYDR148C (KGD2) - SH]
           complement(321080..322390) [1311 bp, 436 aa]
          Length = 436

 Score = 32.7 bits (73), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 6/105 (5%)

Query: 37  MPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSK 96
           +P M+ ++ +G +  +  +VGE     ++L  +ETDK  I+V A   G + K L      
Sbjct: 65  VPPMAESLTEGSLKEFTKQVGEYIEQDELLATIETDKIDIEVNAPVSGTVTK-LNFKPED 123

Query: 97  DVDVGETIAYLADVDDDLSTLKISAEEE-----EQVKVTPVSKVE 136
            V VGE +A + +        K +A+EE     E    +P +K E
Sbjct: 124 TVTVGEELAQIEEGAAPAGGQKPAAKEETSAPQEAAPASPAAKEE 168

>KLLA0E24046g complement(2136583..2137425) similar to
           ca|CA3771|CaSOU1 Candida albicans Sorbitol utilization
           protein Sou1p [Candida albicans], hypothetical start
          Length = 280

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 7/75 (9%)

Query: 342 CPVEEEERFTRKDREDIF------DLLAGSESRTPLRGPVVSNSEASTPASEWTLSLELE 395
           CPV EE +  +K  ED+       D+   +      +GP+V  +E+ T   EW   +  +
Sbjct: 87  CPVTEEAK-VKKTIEDVIQEFGKIDVFIANAGVPWTKGPLVEAAESGTDTDEWNKVIHTD 145

Query: 396 VSDKYSDSKQKAERF 410
            +  Y  +K    +F
Sbjct: 146 FNGVYYCAKYVGAQF 160

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 191 EDAIRNIKASGRDGLLLKGDVLAYLGKIPESSLIKVSEYVKNKEKQDFSHIELGSLTKAE 250
           ED  +N+K S  D  LL+ + L   G I E ++++V    + +     +H +  + +KAE
Sbjct: 412 EDQAKNLKKSNVDMNLLE-NRLGKPGTIAEPNILQVRSKKRAQLTGTGNHTDNNTTSKAE 470

Query: 251 PPQSEKLEDKAIEKISKEPVLLHSEI 276
           PP    L+ K   K++    +LH  +
Sbjct: 471 PPHVNILQVKRKNKVTGVTEVLHDTV 496

>Kwal_56.22892
          Length = 389

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 255 EKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFIEEGF 301
           +K   KA E + + P   H  +   +P N++ E+  NT+   +E+GF
Sbjct: 49  KKRHKKARESVQRTPAAQHKLVLRLLPPNLTEEQFFNTLSGVLEQGF 95

>CAGL0E01287g 120567..121808 highly similar to sp|P19262
           Saccharomyces cerevisiae YDR148c oxoglutarate
           dehydrogenase complex E2 component, hypothetical start
          Length = 413

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 37  MPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSK 96
           +P+M+ ++ +G +  +  KVGE     ++L  +ETDK  I+V +   G + K L  +   
Sbjct: 45  VPSMAESLTEGSLKEFTKKVGEFVEQDELLATIETDKIDIEVNSPVSGTVTK-LNFEPED 103

Query: 97  DVDVGETIAYL 107
            V VG+ +A +
Sbjct: 104 TVTVGDELAQI 114

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 52   WK--FKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYL 107
            WK    VG+    GD L+ +E  K ++ V A  DG++  IL  +G   VD G  +  L
Sbjct: 1760 WKQVVSVGDKVKEGDKLVIIEAMKTEMVVSATADGEVINILHANGDM-VDAGNLVVVL 1816

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 52   WKFKV--GEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYL 107
            WK  V  G+  + GD L+ VE  K ++ V A+  GK+ KI+  +G   VD G  +A +
Sbjct: 1773 WKPMVSAGDTVTKGDGLVIVEAMKTEMVVPAKKSGKVLKIVHKNGDM-VDAGGIVAVI 1829

>Scas_693.29
          Length = 442

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 37  MPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSK 96
           +P M+ ++ +G +  +   VG+     ++L  +ETDK  I+V A   G ++K L      
Sbjct: 68  VPQMAESLTEGSLKEFTKAVGDFIEQDELLATIETDKIDIEVIAPVSGTVSK-LNFKPED 126

Query: 97  DVDVGETIAYL 107
            V VGE +A +
Sbjct: 127 TVTVGEELATI 137

>Sklu_1778.3 YDL044C, Contig c1778 2200-3447 reverse complement
          Length = 415

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 314 SQYFDDIFEDLITTAPREPRFQVNYELYCPVEEEERF 350
           S Y D I  D I T P +PR QVN +    +E +E+ 
Sbjct: 157 SLYLDKISLDDIATVPAKPRLQVNPQTLAALETQEKL 193

>Sklu_2172.1 YDR148C, Contig c2172 307-1605
          Length = 432

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 30/53 (56%)

Query: 37  MPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKI 89
           +P M+ ++ +G +  +  +VGE     ++L  +ETDK  ++V +   G + K+
Sbjct: 58  VPPMAESLTEGSLKEFTKQVGEFIEQDELLATIETDKIDVEVNSPVSGTITKL 110

>Kwal_26.8903
          Length = 815

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 301 FEYTHAM-PLSNINSQYFDDIFEDLITTAPREPRFQVNYELYCPVEE 346
            E+T AM    N+N++Y     ED +   P+E   QV++   C +EE
Sbjct: 337 LEHTQAMLKKENLNAKYNQQRIEDRVQRTPQELSRQVHFLSKCVLEE 383

>YDR148C (KGD2) [993] chr4 complement(753669..755060) 2-oxoglutarate
           dehydrogenase (alpha-ketoglutarate dehydrogenase)
           complex KE2 component dihydrolipoamide
           S-succinyltransferase [1392 bp, 463 aa]
          Length = 463

 Score = 29.6 bits (65), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 37  MPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSK 96
           +P M+ ++ +G +  +   VG+     ++L  +ETDK  I+V +   G + K L      
Sbjct: 78  VPPMAESLTEGSLKEYTKNVGDFIKEDELLATIETDKIDIEVNSPVSGTVTK-LNFKPED 136

Query: 97  DVDVGETIAYL 107
            V VGE +A +
Sbjct: 137 TVTVGEELAQV 147

>KLLA0F20834g complement(1942016..1943866) weakly similar to
           sp|P34761 Saccharomyces cerevisiae YNL197c WHI3 involved
           in regulation of cell size, start by similarity
          Length = 616

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 53  KFKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYLADVDD 112
           +F   +PFS+ +  +      AQ  ++  D GK   +++GDG  D   G   + L+ V++
Sbjct: 238 RFSFSDPFSAENPHIPPAQTSAQTPLQNIDAGKSFLLMEGDGINDTIWGSNPS-LSTVNN 296

Query: 113 DLST 116
            ++T
Sbjct: 297 MVNT 300

>CAGL0G01100g 104031..105599 similar to tr|Q06137 Saccharomyces
           cerevisiae YLR345w, start by similarity
          Length = 522

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 56/143 (39%), Gaps = 24/143 (16%)

Query: 212 LAYLGKIPESSLIKVSEYVKNKEKQ-DFSHIELGSLTKAEPPQSEKLEDKAIEKISKEPV 270
           + Y  ++    L +++E  K +E++ D S I  G  +K  P      E   I+ I KE +
Sbjct: 325 IEYSNRLTTLILNRIAEIRKYREREEDISEIHHGDYSKQLP------EHHVIDNIRKELL 378

Query: 271 LLHSEITLKVPSNVSRERLDNTVKSFIEEGFEYTHAMPLSNINSQYFDDIFEDLITT-AP 329
           +              R+R  +T K F + GF       L  +N     D+ ED I    P
Sbjct: 379 VW----------TAPRKRTYDTAKPFQDLGFNVRQRSQLKQLNPGVIADMSEDEIAKEYP 428

Query: 330 REPRFQVNYELYCPVEEEERFTR 352
            E      Y+ YC      RF R
Sbjct: 429 EE------YKEYCRDRYHFRFPR 445

>Scas_721.40
          Length = 1834

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 52   WKFKV--GEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYL 107
            WK  V  GE   SG  L+ +E  K ++ V    DGK+ KI+  +GS  VD G+ +  +
Sbjct: 1773 WKPLVTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNGSM-VDSGDLVVVI 1829

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 52   WK--FKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYL 107
            WK    VG+   +GD ++ +E  K ++ V A   GK+ KIL  +G   V+ G+ +A +
Sbjct: 1772 WKPVAAVGDHVEAGDGVIIIEAMKTEMVVGATKSGKVYKILHKNGDM-VEAGDLVAVI 1828

>YKL024C (URA6) [3231] chr11 complement(392169..392783)
           Uridine-monophosphate kinase (uridylate kinase),
           catalyzes the conversion of ATP and UMP to ADP and UDP
           [615 bp, 204 aa]
          Length = 204

 Score = 28.5 bits (62), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%)

Query: 238 FSHIELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFI 297
           F H+  G L +AE  ++     + I+   KE  ++  EITL +  N   + +      F+
Sbjct: 42  FVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFL 101

Query: 298 EEGF 301
            +GF
Sbjct: 102 IDGF 105

>Kwal_27.11951
          Length = 1869

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 52   WK--FKVGEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYL 107
            WK    VG+   +GD L+ VE  K ++ V A   GK+ K++  +G   V+ G+ +  +
Sbjct: 1812 WKPLVSVGDVVKAGDGLIVVEAMKTEMMVSAPKGGKVLKVVHKNGDM-VEAGDVVVVI 1868

>CAGL0L09867g 1054344..1055126 some similarities with sp|P15700
           Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase, hypothetical start
          Length = 260

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%)

Query: 238 FSHIELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFI 297
           F H+  G L +AE  +      + I+   KE +++  EITL +     +E  +     F+
Sbjct: 96  FVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQEITLSLLQKAIKENYEKNYTKFL 155

Query: 298 EEGF 301
            +GF
Sbjct: 156 VDGF 159

>KLLA0E08030g complement(724562..725470) some similarities with
           sp|P15700 Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase singleton, hypothetical
           start
          Length = 302

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 32/64 (50%)

Query: 238 FSHIELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFI 297
           F H+  G L +AE  +      + I+K  K+  ++  E+T+ +  N      +++ K F+
Sbjct: 138 FVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVTVALLKNAITSNYNSSNKKFL 197

Query: 298 EEGF 301
            +GF
Sbjct: 198 VDGF 201

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.128    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,514,107
Number of extensions: 623490
Number of successful extensions: 2538
Number of sequences better than 10.0: 122
Number of HSP's gapped: 2502
Number of HSP's successfully gapped: 123
Length of query: 420
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 316
Effective length of database: 12,995,837
Effective search space: 4106684492
Effective search space used: 4106684492
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 63 (28.9 bits)