Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_617.633033016850.0
YOR026W (BUB3)3413407332e-95
Sklu_1927.13453196462e-82
CAGL0H08217g3253226382e-81
AEL226W3243226243e-79
Kwal_55.199263123146121e-77
KLLA0A07106g3103205746e-72
Scas_510.53623132611e-25
CAGL0G03399g3693192462e-23
YER107C (GLE2)3652882418e-23
Sklu_2332.73672912365e-22
Kwal_27.107853672912261e-20
KLLA0E20779g3713022251e-20
AGL301C3613012251e-20
Kwal_27.12053755781128e-06
CAGL0M05335g806671102e-05
Sklu_2431.12749671083e-05
KLLA0E23529g826671073e-05
AEL246C815661056e-05
YBR198C (TAF5)798841012e-04
Scas_721.3282278993e-04
YLR129W (DIP2)943324930.002
ADL186C136131850.018
AAL009C303177830.020
ADR077C120490830.028
YDL145C (COP1)120162830.028
KLLA0F04884g121241820.038
Kwal_33.15475783132800.061
Kwal_56.24526121062800.069
KLLA0E11297g51261790.087
Scas_713.50983335790.091
Scas_624.11120532790.099
Kwal_56.23920937328780.11
Scas_655.154838770.14
KLLA0D16390g936223770.16
YDL195W (SEC31)127327770.17
Scas_721.732575750.19
YAR003W (SWD1)42643750.20
KLLA0F10263g68266760.20
YNL006W (LST8)303175750.21
CAGL0E00561g83666750.28
CAGL0J07854g43244740.34
Scas_630.662166740.36
YPR178W (PRP4)46586730.37
CAGL0A00561g412128730.38
YMR116C (ASC1)31959720.41
CAGL0H08932g90250730.43
KLLA0B01958g89069730.44
CAGL0A02772g441189720.47
Sklu_2382.2126127730.50
Scas_558.3725318720.52
CAGL0G09845g50081720.54
Kwal_23.535147463720.56
Kwal_14.159738069710.60
Scas_631.1747428710.65
KLLA0E17215g41751710.66
Sklu_2416.2135333720.68
Scas_629.1267166710.69
Scas_721.115*31859700.77
Scas_695.1532740700.77
CAGL0I03718g120132710.77
Scas_589.13131131710.80
Sklu_675.1308124700.89
KLLA0D04840g303176690.96
Sklu_2442.2303177691.0
CAGL0H03729g30340691.0
KLLA0F07403g347168691.1
ADL184W44956691.2
Kwal_23.6240913270701.2
Kwal_47.1746580036691.2
YCR084C (TUP1)71366691.2
Kwal_27.1223931657681.3
KLLA0E21043g132132691.3
Scas_592.4*31859681.3
AGR207C32057681.6
Scas_597.936968681.7
KLLA0F26653g79157681.7
Scas_704.4060880681.8
YJL112W (MDV1)71452681.8
YKR036C (CAF4)65952681.8
AGR168W82536681.8
YIL046W (MET30)640144681.8
Sklu_2160.376069681.8
Kwal_0.212303176671.8
AGL234W62966681.8
Sklu_2435.1357585681.9
YPL126W (NAN1)89639682.0
CAGL0D04884g56369672.0
Kwal_55.22076128635682.1
ABR101C82755672.1
Kwal_23.642975066672.2
YMR049C (ERB1)80755672.2
YJL069C (UTP18)59427672.3
Scas_615.1134915662.5
KLLA0D13222g736170672.6
Sklu_1880.347152662.6
Kwal_55.21450503206662.6
AAR102C59185663.0
Kwal_56.2303542432663.0
Kwal_0.4958427663.1
AFR715C71652663.1
CAGL0E01485g133636663.2
ADL082C56984663.2
KLLA0F02013g56627663.2
Scas_718.6*54652663.2
YBL008W (HIR1)84036663.3
Sklu_2379.737968653.3
Scas_649.1080676663.5
CAGL0M02563g45751653.6
Kwal_55.2114457069653.7
YLL011W (SOF1)48976653.8
CAGL0M06193g316122653.8
Sklu_1731.457627654.1
KLLA0F06688g41969654.1
ACR091W32816644.2
KLLA0B11924g141276654.2
KLLA0E12287g326180644.6
KLLA0A01650g40156644.7
CAGL0L04950g80555644.9
KLLA0C08976g91164644.9
AAR057W92266644.9
Sklu_2173.251566645.2
Scas_595.3*55535645.4
Scas_702.1681636645.4
CAGL0L00781g67380645.5
Kwal_23.4671423107635.6
AFR117C115263645.9
YGL213C (SKI8)39772635.9
Scas_442.2*79552645.9
YPR137W (RRP9)57369636.0
Scas_711.4659427636.1
Kwal_27.1258650964636.5
KLLA0E07942g39095636.6
ADL322C50160636.7
ACL099W35745636.7
Scas_603.558948636.8
KLLA0D06787g436103637.1
Kwal_47.17567590199637.3
Kwal_23.576962752637.3
Kwal_55.2155935133627.5
Sklu_1710.124033627.5
YPL151C (PRP46)45178627.6
YER082C (UTP7)55434628.0
AEL314W71552628.4
Kwal_56.2416372969628.5
KLLA0A04928g86136629.7
Sklu_1926.550960629.7
YOL138C134128629.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_617.6
         (330 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_617.6                                                            653   0.0  
YOR026W (BUB3) [4839] chr15 (379780..380805) Checkpoint protein ...   286   2e-95
Sklu_1927.1 YOR026W, Contig c1927 98-1135 reverse complement          253   2e-82
CAGL0H08217g complement(806660..807637) similar to sp|P26449 Sac...   250   2e-81
AEL226W [2280] [Homologous to ScYOR026W (BUB3) - SH] complement(...   244   3e-79
Kwal_55.19926                                                         240   1e-77
KLLA0A07106g complement(640536..641468) similar to sp|P26449 Sac...   225   6e-72
Scas_510.5                                                            105   1e-25
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    99   2e-23
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    97   8e-23
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       96   5e-22
Kwal_27.10785                                                          92   1e-20
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    91   1e-20
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    91   1e-20
Kwal_27.12053                                                          48   8e-06
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    47   2e-05
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      46   3e-05
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    46   3e-05
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    45   6e-05
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    44   2e-04
Scas_721.32                                                            43   3e-04
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    40   0.002
ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407) [...    37   0.018
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    37   0.020
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    37   0.028
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    37   0.028
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    36   0.038
Kwal_33.15475                                                          35   0.061
Kwal_56.24526                                                          35   0.069
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    35   0.087
Scas_713.50                                                            35   0.091
Scas_624.11                                                            35   0.099
Kwal_56.23920                                                          35   0.11 
Scas_655.1                                                             34   0.14 
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    34   0.16 
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    34   0.17 
Scas_721.7                                                             33   0.19 
YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and ...    33   0.20 
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    34   0.20 
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    33   0.21 
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    33   0.28 
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    33   0.34 
Scas_630.6                                                             33   0.36 
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    33   0.37 
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    33   0.38 
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    32   0.41 
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    33   0.43 
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    33   0.44 
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    32   0.47 
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         33   0.50 
Scas_558.3                                                             32   0.52 
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    32   0.54 
Kwal_23.5351                                                           32   0.56 
Kwal_14.1597                                                           32   0.60 
Scas_631.17                                                            32   0.65 
KLLA0E17215g 1526177..1527430 similar to sp|P38211 Saccharomyces...    32   0.66 
Sklu_2416.2 YOL138C, Contig c2416 613-4674 reverse complement          32   0.68 
Scas_629.12                                                            32   0.69 
Scas_721.115*                                                          32   0.77 
Scas_695.15                                                            32   0.77 
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    32   0.77 
Scas_589.13                                                            32   0.80 
Sklu_675.1 YMR146C, Contig c675 761-1687                               32   0.89 
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    31   0.96 
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            31   1.0  
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    31   1.0  
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    31   1.1  
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    31   1.2  
Kwal_23.6240                                                           32   1.2  
Kwal_47.17465                                                          31   1.2  
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    31   1.2  
Kwal_27.12239                                                          31   1.3  
KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomy...    31   1.3  
Scas_592.4*                                                            31   1.3  
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    31   1.6  
Scas_597.9                                                             31   1.7  
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    31   1.7  
Scas_704.40                                                            31   1.8  
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    31   1.8  
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    31   1.8  
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    31   1.8  
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    31   1.8  
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         31   1.8  
Kwal_0.212                                                             30   1.8  
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    31   1.8  
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         31   1.9  
YPL126W (NAN1) [5319] chr16 (310209..312899) Nucleolar protein a...    31   2.0  
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    30   2.0  
Kwal_55.22076                                                          31   2.1  
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    30   2.1  
Kwal_23.6429                                                           30   2.2  
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    30   2.2  
YJL069C (UTP18) [2843] chr10 complement(310838..312622) Protein ...    30   2.3  
Scas_615.11                                                            30   2.5  
KLLA0D13222g complement(1132067..1134277) similar to sgd|S000273...    30   2.6  
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            30   2.6  
Kwal_55.21450                                                          30   2.6  
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    30   3.0  
Kwal_56.23035                                                          30   3.0  
Kwal_0.49                                                              30   3.1  
AFR715C [3908] [Homologous to ScYCL039W - SH] (1752847..1754997)...    30   3.1  
CAGL0E01485g complement(138830..142840) similar to tr|Q08281 Sac...    30   3.2  
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    30   3.2  
KLLA0F02013g 183770..185470 similar to sp|P40362 Saccharomyces c...    30   3.2  
Scas_718.6*                                                            30   3.2  
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    30   3.3  
Sklu_2379.7 YBR246W, Contig c2379 13796-14935 reverse complement       30   3.3  
Scas_649.10                                                            30   3.5  
CAGL0M02563g complement(295156..296529) weakly similar to sp|Q03...    30   3.6  
Kwal_55.21144                                                          30   3.7  
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    30   3.8  
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    30   3.8  
Sklu_1731.4 YJL069C, Contig c1731 3709-5439 reverse complement         30   4.1  
KLLA0F06688g 644040..645299 similar to sp|P38332 Saccharomyces c...    30   4.1  
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    29   4.2  
KLLA0B11924g complement(1043344..1047582) similar to sp|P22219 S...    30   4.2  
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    29   4.6  
KLLA0A01650g complement(146030..147235) similar to sp|Q02793 Sac...    29   4.7  
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    29   4.9  
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    29   4.9  
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    29   4.9  
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            29   5.2  
Scas_595.3*                                                            29   5.4  
Scas_702.16                                                            29   5.4  
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    29   5.5  
Kwal_23.4671                                                           29   5.6  
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    29   5.9  
YGL213C (SKI8) [1783] chr7 complement(90057..91250) Protein invo...    29   5.9  
Scas_442.2*                                                            29   5.9  
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    29   6.0  
Scas_711.46                                                            29   6.1  
Kwal_27.12586                                                          29   6.5  
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    29   6.6  
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    29   6.7  
ACL099W [950] [Homologous to ScYKL018W (SWD2) - SH] complement(1...    29   6.7  
Scas_603.5                                                             29   6.8  
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    29   7.1  
Kwal_47.17567                                                          29   7.3  
Kwal_23.5769                                                           29   7.3  
Kwal_55.21559                                                          28   7.5  
Sklu_1710.1 YDR267C, Contig c1710 17-739                               28   7.5  
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    28   7.6  
YER082C (UTP7) [1514] chr5 complement(324268..325932) Component ...    28   8.0  
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    28   8.4  
Kwal_56.24163                                                          28   8.5  
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    28   9.7  
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         28   9.7  
YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible...    28   9.9  

>Scas_617.6
          Length = 330

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/330 (96%), Positives = 319/330 (96%)

Query: 1   MDKLHKVEVQNGPSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEY 60
           MDKLHKVEVQNGPSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPN           HEY
Sbjct: 1   MDKLHKVEVQNGPSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPNLKKVKLIKKVVHEY 60

Query: 61  ALLCCCYAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIA 120
           ALLCCCYAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIA
Sbjct: 61  ALLCCCYAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIA 120

Query: 121 SSWDGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDR 180
           SSWDGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDR
Sbjct: 121 SSWDGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDR 180

Query: 181 GEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQ 240
           GEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQ
Sbjct: 181 GEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQ 240

Query: 241 FVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVV 300
           FVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVV
Sbjct: 241 FVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVV 300

Query: 301 GTSDDSFKTNAVVAEPLELQSSRLYVLFKE 330
           GTSDDSFKTNAVVAEPLELQSSRLYVLFKE
Sbjct: 301 GTSDDSFKTNAVVAEPLELQSSRLYVLFKE 330

>YOR026W (BUB3) [4839] chr15 (379780..380805) Checkpoint protein
           required for cell cycle arrest in response to loss of
           microtubule function [1026 bp, 341 aa]
          Length = 341

 Score =  286 bits (733), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 149/340 (43%), Positives = 217/340 (63%), Gaps = 18/340 (5%)

Query: 4   LHKVEVQNGPSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYALL 63
           +  V+++  P +YISDI +I  KS  L+T+WDGSL+ ++++             +++ LL
Sbjct: 1   MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLL 60

Query: 64  CCCYAFVLGKLRVYVGTVQGEIFLVDFENS-DFKPVLGNSTQLGVSKMVNVGNYTFIASS 122
           CC +      L++YVGTVQGEI  VD   S  F+ +  N   LG+ ++   G+   IA+S
Sbjct: 61  CCNF-IDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAAS 119

Query: 123 WDGILQEIDMQD--NAVIRTTKL-ENNTKV----LAMDCVNNLLILALTGKKIRWLNLPL 175
           WDG+++ ID ++  + VI    L  NNTKV      MD  ++ LI+ +   +++W  LPL
Sbjct: 120 WDGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPL 179

Query: 176 NNNDRGEVTEVETGLKYQVRDIKL-TLEGDGYVTSSIDGRVAVEYFEDD------SRNFA 228
             +D G + E  +GLKYQ+RD+ L   E +GY  SSIDGRVAVE+F+D       S+ FA
Sbjct: 180 CEDDNGTIEE--SGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFA 237

Query: 229 FRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV 288
           FRCHR+NL D    +PVNS+ FSP    L+T GSDG +S WNL+T KKIK F KFNE+SV
Sbjct: 238 FRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSV 297

Query: 289 VKLACNEDILVVGTSDDSFKTNAVVAEPLELQSSRLYVLF 328
           VK+AC+++IL + TSDD+FKTNA + + +EL +S +Y++F
Sbjct: 298 VKIACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIF 337

>Sklu_1927.1 YOR026W, Contig c1927 98-1135 reverse complement
          Length = 345

 Score =  253 bits (646), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 140/319 (43%), Positives = 201/319 (63%), Gaps = 17/319 (5%)

Query: 8   EVQNGPSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYALLCCCY 67
           ++Q+   +YISD+VL++  S  + T+WDGS+S ++Y+             H++ LL    
Sbjct: 41  KLQDVTKDYISDLVLLESYSHIVCTSWDGSISMYDYD----SMNRLTSLRHKFPLLSTG- 95

Query: 68  AFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIASSWDGIL 127
             V+   ++YVG+VQGE+  VD E+  F  V   S +LG+S +  + + + IA SWDG L
Sbjct: 96  --VVHNGKIYVGSVQGEMLEVDLESEKFGTV-SESAELGISSIC-IQDASVIAGSWDGSL 151

Query: 128 QEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEVTEVE 187
           + +D ++N     T L +  KVL+MDC  N L ++LT  +++  +L       G     +
Sbjct: 152 RIVDSRNNDTQFETALGH--KVLSMDCHENKLCISLTAGEVKIFDL----RKLGAPVSRK 205

Query: 188 TGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNS 247
            GLK+Q RDIK+    +GYV SS+DGRVAVEYF+ + + FAFRCHRM+L D QFVFPVN+
Sbjct: 206 AGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRCHRMSLQDAQFVFPVNT 265

Query: 248 LAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSDDSF 307
           + F P S  LFTGGSDG +  WNL T KK  + PK  ++SVVK+ACN+ ++V  TSDDSF
Sbjct: 266 ICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKL-DSSVVKVACNDRVVVAATSDDSF 324

Query: 308 KTNAVVAEPLELQSSRLYV 326
           KT+A V E L LQ S +Y+
Sbjct: 325 KTSATV-EDLPLQPSDIYI 342

>CAGL0H08217g complement(806660..807637) similar to sp|P26449
           Saccharomyces cerevisiae YOR026w BUB3, hypothetical
           start
          Length = 325

 Score =  250 bits (638), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 131/322 (40%), Positives = 198/322 (61%), Gaps = 4/322 (1%)

Query: 6   KVEVQNGPSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYALLCC 65
           +VE+++ P EYIS I +I E++Q ++ ++DG+LS +  +             +E +L   
Sbjct: 2   RVEIKDVPREYISGIEIISEQNQIIIVSYDGTLSVYTVDRELKQVNLTVRLQYESSLTSV 61

Query: 66  CYAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIASSWDG 125
               + G+  +Y G+V G++  VD ENS F  V    +  G+S +   G+   IA SWDG
Sbjct: 62  AQLNIQGRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGD-RVIAGSWDG 120

Query: 126 ILQEIDMQDNAVIRTTKLENN-TKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEVT 184
            +  ++ + N++  T +L +   K   +    + L+++    KI    LPL    +  + 
Sbjct: 121 SIYVVNPKSNSLEFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHI- 179

Query: 185 EVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFP 244
            +++G  +Q+RD +LT EGDG+V + IDGRV+VEYF+D S+ FAFRCH+ +L D    +P
Sbjct: 180 -LDSGQIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYP 238

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSD 304
           +N++ F P +   +TGGSDGCVS W+L    KIKQ PK+NENSVV+LACNE+IL V TSD
Sbjct: 239 INAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATSD 298

Query: 305 DSFKTNAVVAEPLELQSSRLYV 326
           DSFKTNAV+   LEL+ SR+YV
Sbjct: 299 DSFKTNAVIDSNLELEPSRIYV 320

>AEL226W [2280] [Homologous to ScYOR026W (BUB3) - SH]
           complement(204812..205786) [975 bp, 324 aa]
          Length = 324

 Score =  244 bits (624), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 193/322 (59%), Gaps = 18/322 (5%)

Query: 7   VEVQNGPSEYISDIVLIDEK-SQFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYALLCC 65
           VE+++   +Y+S + L+DE+ SQ +V++WDG+ S +++  N           HE+ L   
Sbjct: 16  VELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGRLS----HEWPLTS- 70

Query: 66  CYAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIASSWDG 125
             A   G  R YVG+ QGE+  +D+E+     + G    LG+S M + G +  + S WDG
Sbjct: 71  -VAVCAGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVVVGS-WDG 128

Query: 126 ILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEVTE 185
            L  +D + N V    +L    K+L++DC     ++ +T   +         +D     E
Sbjct: 129 SLAVVDTRRNTVRHIRRLTG--KILSLDC-GAARVVCMTTDGV----YVFRTSDIDAAPE 181

Query: 186 V-ETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFP 244
             E+GLKYQ R ++L  + +GYV SS+DGRVAVEYF D+ R FAFRCHRMNL D Q VFP
Sbjct: 182 RRESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFP 241

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSD 304
           VN+L F P + LL+TGGSDG V  WNL T KK ++ PK  E+SVVKL CN   LV+  SD
Sbjct: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKV-EDSVVKLCCNRRALVIAASD 300

Query: 305 DSFKTNAVVAEPLELQSSRLYV 326
           DSFKT+AVV E + LQ SR+YV
Sbjct: 301 DSFKTSAVV-EDIALQRSRVYV 321

>Kwal_55.19926
          Length = 312

 Score =  240 bits (612), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 191/314 (60%), Gaps = 16/314 (5%)

Query: 13  PSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYALLCCCYAFVLG 72
           P++YIS +V+        VTAWDG+LS + Y  N           +  AL  C Y+ V  
Sbjct: 10  PNDYISGLVIKGITPHVNVTAWDGTLSLYNYEDNDLVLRMR----YNDALTSCAYSEVGS 65

Query: 73  KLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIASSWDGILQEIDM 132
           K  ++VG+V GE+  VDFE+  F  ++    +LG+S +    N   IA SWDG LQ +D 
Sbjct: 66  K--IFVGSVSGEVLEVDFESERFN-LISEPAELGISALCCSQN-NIIAGSWDGSLQIVDS 121

Query: 133 QDNAVIRTTKLENNTKVLAMDCV-NNLLILALTGKKIRWLNLPLNNNDRGEVTEVETGLK 191
           +        +L+N  K+L MDC  NN L+++LTG K+   +L   N  + ++ E  +GLK
Sbjct: 122 RSGDRWFRERLDN-CKILGMDCADNNKLVVSLTGGKVAIYDL--RNMIKPQIRE--SGLK 176

Query: 192 YQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSLAFS 251
           +Q RDIKL    +GYV SS+DGRVAVEYF+ +S  FAFRCHRMNL D QFVFPVNSL F+
Sbjct: 177 FQTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFN 236

Query: 252 PASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSDDSFKTNA 311
                L+TGGSDG V  WNL T KK  +FPKF E+S+VKLA   D+L V T DDSFKT  
Sbjct: 237 SNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKF-EDSIVKLAYKNDVLCVATGDDSFKTLP 295

Query: 312 VVAEPLELQSSRLY 325
            V E  E+Q  ++Y
Sbjct: 296 TV-EGAEIQPGKVY 308

>KLLA0A07106g complement(640536..641468) similar to sp|P26449
           Saccharomyces cerevisiae YOR026w BUB3 cell cycle arrest
           protein, start by similarity
          Length = 310

 Score =  225 bits (574), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 128/320 (40%), Positives = 186/320 (58%), Gaps = 17/320 (5%)

Query: 7   VEVQNGPSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYALLCCC 66
            ++Q  P +YISDI +I   ++ +V+ WDGSLS F+               H + L  C 
Sbjct: 5   AKLQGVPKDYISDIRIISSDNRVVVSCWDGSLSLFDITQQQLLMKLQ----HSWPLTSC- 59

Query: 67  YAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIASSWDGI 126
              V    R++ G+VQGE+   D+E+    P    S  LGVS + ++ ++  IASSWDG 
Sbjct: 60  --HVSKDGRIWAGSVQGEVLEADWESERLIPNDTMSFSLGVSGITSIDHF-IIASSWDGS 116

Query: 127 LQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEVTEV 186
           L  +D   N +++  K E   K+  +      ++ +L+  K++ +  P       ++TE 
Sbjct: 117 LIVLDYLRNQIVKQWKFEE--KIFQLCASEVRVMCSLSSGKVKLIQFP-----SWDITET 169

Query: 187 ETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVN 246
           E+GLKYQ R   L     G+V  S+DGRV+VE+F+D S  FAFRCHRMNL D+Q VFPV 
Sbjct: 170 ESGLKYQCRSCTLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVT 229

Query: 247 SLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSDDS 306
           +LAF P S  LFTGG+DG +  WNL T KK ++F K  +++++KL C ED LV+  SDDS
Sbjct: 230 ALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKL-DDTIMKLCCTEDYLVIAVSDDS 288

Query: 307 FKTNAVVAEPLELQSSRLYV 326
           FKT A V + +EL  S +Y+
Sbjct: 289 FKTCA-VPQDIELHPSAIYI 307

>Scas_510.5
          Length = 362

 Score =  105 bits (261), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 83/313 (26%), Positives = 134/313 (42%), Gaps = 26/313 (8%)

Query: 9   VQNGPSE-YISDIVLIDEKS-QFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYALLCCC 66
           V N P+E  ISDI    ++   F V++WDG +  ++               +E+A     
Sbjct: 28  VLNNPAEDSISDIAFSPQQDFIFSVSSWDGKVRIWDVQ----GGVAQGRSQYEHAGPVLS 83

Query: 67  YAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVG---NYTFIASSW 123
             +     +V  G     + L D  +   + +  +   +   + VN G       +  SW
Sbjct: 84  TRWSNDGSKVASGGCDNIVKLFDVASGQSQQIGMHDAPVKAVRFVNCGPSNTECLVTGSW 143

Query: 124 DGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEV 183
           D  ++  DM+    I T  + +  +V  MD    LL++    + I  +NL    N+ G +
Sbjct: 144 DKSIKYWDMRQPQAISTVIMPD--RVYTMDSKQQLLVVGTAERHIAIINL----NNPGSI 197

Query: 184 TEVE-TGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSR---NFAFRCHRMNLVD- 238
            +   + LK+Q R +    EGDGY   SI+GR A+ Y +D+ +    F+F+CHR N  + 
Sbjct: 198 FKTTLSPLKWQTRVVSCYNEGDGYAIGSIEGRCAIRYVDDEMQKKSGFSFKCHRQNNPNR 257

Query: 239 -----MQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNEN-SVVKLA 292
                   V+PVNS+AF P      T G DGC   W+     ++K FP    +  VV   
Sbjct: 258 TAGSQQSLVYPVNSIAFHPIYGTFATAGGDGCFHFWDKNHRHRLKAFPSLRSSIPVVNFN 317

Query: 293 CNEDILVVGTSDD 305
            N  +     S D
Sbjct: 318 RNGSVFAYALSYD 330

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 99.4 bits (246), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/319 (24%), Positives = 131/319 (41%), Gaps = 24/319 (7%)

Query: 2   DKLHKVEVQNGPSEYISDIVLIDEKS-QFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEY 60
           D  +++ + N   + ISDI    +    F V++WDG +  ++               +E+
Sbjct: 23  DLQNEIVINNPADDSISDIAFSPQHDFLFSVSSWDGKVRIWD----AQNGVPQGKAQYEH 78

Query: 61  ALLCCCYAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVG---NYT 117
                C  + L   R+  G     + L D  +   + +  ++  +   + V  G      
Sbjct: 79  NGPVLCTRWSLDGARIASGGCDNTVKLYDVASGQSQQIGSHNDAVKSLRFVQCGPTNTEC 138

Query: 118 FIASSWDGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNN 177
            +  SWD  ++  D +    I T  +    +V  MD    LL++    + I  +NL    
Sbjct: 139 LVTGSWDKTIKFWDTRQPQPITTIAMPE--RVYTMDNKQQLLVVGTAERHIAIINLA--- 193

Query: 178 NDRGEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSR---NFAFRCHRM 234
           N        ++ LK+Q R +    EGDGY   S++GR A++Y +D+++    F+F+CHR 
Sbjct: 194 NPTTIFKSSQSPLKWQTRVVACYNEGDGYAIGSVEGRCAIKYVDDEAQKKSGFSFKCHRQ 253

Query: 235 NLVD-------MQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNEN- 286
              +          V+PVNS+AF P      T G DG    W+     ++K FP    + 
Sbjct: 254 TQPNRAAGSSSQSLVYPVNSIAFHPIYGTFVTAGGDGSFHFWDKNQRHRLKGFPSMQGSI 313

Query: 287 SVVKLACNEDILVVGTSDD 305
            V     N  IL    S D
Sbjct: 314 PVCNFNRNGSILAYAVSYD 332

>YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear pore
           protein required for poly(A)+ RNA export, has WD (WD-40)
           repeats, functions in the nuclear export of the small
           ribosomal subunit [1098 bp, 365 aa]
          Length = 365

 Score = 97.4 bits (241), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 121/288 (42%), Gaps = 24/288 (8%)

Query: 9   VQNGPSE-YISDIVLIDEKS-QFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYALLCCC 66
           V N P+E  ISDI    ++   F  ++WDG +  ++               HE +    C
Sbjct: 30  VINSPAEDSISDIAFSPQQDFMFSASSWDGKVRIWDVQ----NGVPQGRAQHESSSPVLC 85

Query: 67  YAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVG---NYTFIASSW 123
             +     +V  G     + L D  +   + +  +S  + V + V  G       +  SW
Sbjct: 86  TRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMHSAPIKVLRFVQCGPSNTECIVTGSW 145

Query: 124 DGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEV 183
           D  ++  DM+    + T  +    +V +MD   +LL++A   + I  +NL    N     
Sbjct: 146 DKTIKYWDMRQPQPVSTVMMPE--RVYSMDNKQSLLVVATAERHIAIINLA---NPTTIF 200

Query: 184 TEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFED---DSRNFAFRCHRMNLVD-- 238
               + LK+Q R +    E DGY   S++GR ++ Y +D       F+F+CHR    +  
Sbjct: 201 KATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDGMQKKSGFSFKCHRQTNPNRA 260

Query: 239 -----MQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFP 281
                   V+PVNS+AF P      T G DG  + W+     ++K +P
Sbjct: 261 PGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHRLKGYP 308

>Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement
          Length = 367

 Score = 95.5 bits (236), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 125/291 (42%), Gaps = 27/291 (9%)

Query: 9   VQNGPSE-YISDIVLIDEKS-QFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYALLCCC 66
           V N P+E  ISDI    ++   F V++WD  +  ++ N             H+  +L   
Sbjct: 29  VINNPAEDSISDIAFSSQQDFLFSVSSWDNKVRIWDVNGGMAQGRAQYE--HQAPVLTTR 86

Query: 67  YAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVG---NYTFIASSW 123
           ++      +V  G     + L D ++   + V  + + +   + +  G       +  SW
Sbjct: 87  WS--NDGTKVASGGCDNVVKLFDVQSGQAQQVGAHDSAIRHLRFIQCGPTNTECLVTGSW 144

Query: 124 DGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEV 183
           D  ++  DM+    + T  + +  +V AMD    LL++A   + I  ++L   NN     
Sbjct: 145 DKTIKYWDMRQPQPVSTLMMPD--RVYAMDSKQKLLVVATAERHIAIIDL---NNPATIF 199

Query: 184 TEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSR---NFAFRCHRMNLVDM- 239
               + LK+Q R +   +EG+GY   SI+GR A++Y ++  +    F+F+CHR       
Sbjct: 200 KTATSPLKWQTRSVSCYIEGNGYAIGSIEGRCAIQYVDEQEQRKSGFSFKCHRQQQQSTG 259

Query: 240 ---------QFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFP 281
                      V+PVNS+ F P      T G DG    W+     ++K FP
Sbjct: 260 TAGGRSNTESHVYPVNSIVFHPVYGTFATAGGDGSFHFWDKNQRHRLKGFP 310

>Kwal_27.10785
          Length = 367

 Score = 91.7 bits (226), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 121/291 (41%), Gaps = 27/291 (9%)

Query: 9   VQNGPSE-YISDIVLIDEKS-QFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYALLCCC 66
           V N P+E  ISDI    ++   F V++WD  +  ++ N             H+  +L   
Sbjct: 29  VINNPAEDSISDIAFSPQQDFLFSVSSWDKKVRVWDVNGGQAQCRAEYQ--HQAPVLATR 86

Query: 67  YAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVG---NYTFIASSW 123
           ++      ++  G     + + D  +   + V  +   +   + V  G       +  SW
Sbjct: 87  WS--TDGTKIASGGCDNAVMVFDVSSGQSQQVGAHDAAVKSLRFVQCGPSNTECLVTGSW 144

Query: 124 DGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEV 183
           D  ++  D++    + T  +    +V  MD    LL++    + I  ++L   NN     
Sbjct: 145 DKTIKYWDLRQPQPVSTLAMPE--RVYTMDSKQKLLVVGTAERHIVVIDL---NNPAAIF 199

Query: 184 TEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSR---NFAFRCHRMNLVDM- 239
               + LK+Q R +   +EG+GY   SI+GR A++Y +D  +    F+F+CHR+      
Sbjct: 200 KTTTSPLKWQTRSVSCYIEGNGYAVGSIEGRCAIQYVDDQEQRKSGFSFKCHRVQQQSTG 259

Query: 240 ---------QFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFP 281
                      V+PVNS+ F P      T G DG    W+     ++K FP
Sbjct: 260 AAGGRSSTESQVYPVNSIVFHPIYGTFATAGGDGSFHFWDKNLRHRLKGFP 310

>KLLA0E20779g complement(1841092..1842207) similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2 required for
           nuclear pore complex structure and function, start by
           similarity
          Length = 371

 Score = 91.3 bits (225), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 136/302 (45%), Gaps = 30/302 (9%)

Query: 2   DKLHKVEVQNGPSEYISDIVLIDEKS-QFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEY 60
           D  + + + N   + ISDI    +    F V++WD  +  ++               H+ 
Sbjct: 23  DLANDIVLNNAAEDSISDIAFSPQSDFMFSVSSWDSKVRIWDVQSGSPQGRAQYD--HQA 80

Query: 61  ALLCCCYAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVG--NYTF 118
            +L   ++  +   +V  G     + + D      + +  +++ +   + V+ G  N   
Sbjct: 81  PVLTTRWS--IDGTKVASGGCDNVLKVFDVTTGQAQQIGQHNSAVQSLRFVSCGPTNQEC 138

Query: 119 IAS-SWDGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNN 177
           IA+ SWD  ++  D++    I T ++    +V  MD    L+++ +  + I  ++L    
Sbjct: 139 IATGSWDKTVKYWDLRSPQPIMTLQMPE--RVYCMDASQKLMVVGMAERHIAVIDL---- 192

Query: 178 NDRGEVTEVE-TGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSR---NFAFRCHR 233
           N+ G++ +   + LK+Q R I    EG+G+   SI+GR AV+Y ++  +    F+F+CHR
Sbjct: 193 NNPGQIFKTSLSPLKWQTRSISCYNEGNGFAIGSIEGRCAVQYIDEQEQRKDGFSFKCHR 252

Query: 234 MNL-----------VDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPK 282
             +            ++Q V+PVNS+ F P      T G DG    W+     ++K FPK
Sbjct: 253 QQVQNNGAAGGRTSTEVQ-VYPVNSIVFHPIHGTFATAGGDGSFHFWDKNHRHRLKGFPK 311

Query: 283 FN 284
            N
Sbjct: 312 LN 313

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score = 91.3 bits (225), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 127/301 (42%), Gaps = 25/301 (8%)

Query: 7   VEVQNGPSEYISDIVLIDEKS-QFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYALLCC 65
           + + N  ++ +SDI    ++   F V AWD ++  ++               H+  +L  
Sbjct: 26  ITINNPANDSVSDIAFSPQQDFLFSVAAWDNTVRIWDVQ--NGMTQGRAQYEHQAPVLTT 83

Query: 66  CYAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVG---NYTFIASS 122
            ++      +V  G     + L D  +   + +  + + +   + V  G       +  S
Sbjct: 84  RWS--SDGTKVASGGCDNILKLYDVASGQAQQIGSHDSAVRALRFVQCGPSNQECIVTGS 141

Query: 123 WDGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGE 182
           WD  ++  DM+    I T  +    +V A+D    LL++    + I  ++L   NN    
Sbjct: 142 WDKTIKYWDMRQPQPISTVAMPE--RVYALDSKQKLLVVGTAERHIVVIDL---NNPAQV 196

Query: 183 VTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRN---FAFRCHRMN---- 235
                + LK+Q R +   +EG+G+   S++GR A++Y ++  +    F+F+CHR      
Sbjct: 197 FRTSMSPLKWQTRTVACYIEGNGFAIGSVEGRCAIQYVDEQEQRKNGFSFKCHRQQQPAS 256

Query: 236 --LVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLAC 293
                   V+PVNS+ F P      T G DG  + W+     ++K FP  N +  V   C
Sbjct: 257 GRASSESLVYPVNSIVFHPQYGTFATAGGDGSCNFWDKNQRHRLKGFPSMNASIPV---C 313

Query: 294 N 294
           N
Sbjct: 314 N 314

>Kwal_27.12053
          Length = 755

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNED--ILVVG 301
           PV S A SP    L TG  DG +++W++ T K++KQ     +N+V  L+ +++  +L+ G
Sbjct: 610 PVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISG 669

Query: 302 TSDDSFK---TNAVVAEP 316
            +D S +        AEP
Sbjct: 670 GADHSVRVWDVKKSTAEP 687

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 8/84 (9%)

Query: 189 GLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSL 248
           G    V    ++ +G    T S DG + V       R    R H  N V         SL
Sbjct: 606 GHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAV--------YSL 657

Query: 249 AFSPASHLLFTGGSDGCVSLWNLE 272
           ++S   H+L +GG+D  V +W+++
Sbjct: 658 SYSKEGHVLISGGADHSVRVWDVK 681

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 26/62 (41%), Gaps = 1/62 (1%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFP-KFNENSVVKLACNEDILVVGT 302
           P+  +AFSP  H   T   D    LW+ +    ++ F    N+   V    N   +  G+
Sbjct: 526 PIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGS 585

Query: 303 SD 304
           SD
Sbjct: 586 SD 587

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNED--ILVVG 301
           PV S   SP    L TG  DG + LW++ T K+IKQ     +N+V  L+ N++  +L+ G
Sbjct: 661 PVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISG 720

Query: 302 TSDDSFK 308
            +D S +
Sbjct: 721 GADHSVR 727

 Score = 35.0 bits (79), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 58/131 (44%), Gaps = 14/131 (10%)

Query: 189 GLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSL 248
           G    V   +++ +G    T S DG + +       R    R H  N V        +SL
Sbjct: 657 GHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAV--------HSL 708

Query: 249 AFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPK----FNEN-SVVKLACNEDILVVGTS 303
           +F+   ++L +GG+D  V +W+++ H   +Q P+    FN +   +  + N+DI   G  
Sbjct: 709 SFNKEGNVLISGGADHSVRVWDVK-HGTTEQGPEPEQPFNAHVGDITASINQDIKDYGRR 767

Query: 304 DDSFKTNAVVA 314
                TN +VA
Sbjct: 768 RTIIPTNDLVA 778

 Score = 32.3 bits (72), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNE 285
           V S +FSP +  L +G  D  V LW+++TH  +  +   N 
Sbjct: 536 VYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNH 576

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 21/36 (58%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF 280
           V++++F P    +FTG SD    +W++ T   ++ F
Sbjct: 620 VDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLF 655

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNED--ILVVG 301
           PV S A SP    L TG  DG +++W++ T K++KQ     +N+V  L+ +++  +LV G
Sbjct: 604 PVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSG 663

Query: 302 TSDDSFK 308
            +D S +
Sbjct: 664 GADHSVR 670

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 21/41 (51%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNE 285
           V S +FSP +  L +   D  V LW+++T+  +  +   N 
Sbjct: 479 VYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNH 519

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNED--ILVVG 301
           PV +L  SP    L TG  DG + +W++ T K+IKQ     +N +  +  N++   LV G
Sbjct: 681 PVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTG 740

Query: 302 TSDDSFK 308
            +D S +
Sbjct: 741 GADQSVR 747

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLET 273
           PV S+AFSP +  L +   D  V LW+L+T
Sbjct: 555 PVYSVAFSPDNRYLLSASEDKTVRLWSLDT 584

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 8/84 (9%)

Query: 189 GLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSL 248
           G    V  ++++ +G    T S DG + V       R    + H  N        P+ S+
Sbjct: 677 GHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKN--------PIYSI 728

Query: 249 AFSPASHLLFTGGSDGCVSLWNLE 272
            F+   + L TGG+D  V +W+++
Sbjct: 729 TFNKEGNCLVTGGADQSVRVWDIK 752

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNED--ILVVGT 302
           V S+A SP    L TG  DG + +W++ T K+IKQ     +++V  L+ N++  ILV G 
Sbjct: 671 VVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGG 730

Query: 303 SDDSFK 308
           +D S +
Sbjct: 731 ADQSVR 736

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETH 274
           PV S++FSP +  L +   D  V LW+L+T+
Sbjct: 544 PVYSVSFSPDNRYLVSASEDKTVRLWSLDTY 574

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 54/131 (41%), Gaps = 8/131 (6%)

Query: 184 TEVETGLKYQVRDIKLTLEGDGY------VTSSIDGRVAVEYFEDDS-RNFAFRCHRMNL 236
           T +E+ L  + +D   T+   G+      V+ S D R  V   ED + R ++   +   +
Sbjct: 519 TPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLV 578

Query: 237 VDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFP-KFNENSVVKLACNE 295
                  PV  + FSP  H   TG  D    LW+ +    ++ F    N+   V    N 
Sbjct: 579 SYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNG 638

Query: 296 DILVVGTSDDS 306
             ++ G+SD +
Sbjct: 639 TYVLTGSSDKT 649

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 52/133 (39%), Gaps = 18/133 (13%)

Query: 189 GLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSL 248
           G    V  + ++ +G    T S DG + V       R    R H  + V         SL
Sbjct: 666 GHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAV--------YSL 717

Query: 249 AFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV-------VKLACNEDILVVG 301
           +F+   ++L +GG+D  V +W+L   KK    P              ++ + N+D+   G
Sbjct: 718 SFNKEGNILVSGGADQSVRVWDL---KKFTNEPSLEPEQPYSGYLGDMEASVNQDVKEYG 774

Query: 302 TSDDSFKTNAVVA 314
                F T  ++A
Sbjct: 775 RRRTVFPTQDLMA 787

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNED--ILVVGT 302
           V+ + F P    + TG SD    +W+++T   ++ F   +  SVV +A + D   L  G+
Sbjct: 629 VDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF-LGHTASVVSVAVSPDGRWLTTGS 687

Query: 303 SD 304
            D
Sbjct: 688 ED 689

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 45/84 (53%), Gaps = 9/84 (10%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNED--ILVVG 301
           PV S+A  P    L TG  DG +++W++ T K++KQ     +N++  L+ +++  +L+ G
Sbjct: 653 PVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISG 712

Query: 302 TSDDSFK-------TNAVVAEPLE 318
            +D + +       T    AEP E
Sbjct: 713 GADHTVRVWDLKKATTEPSAEPDE 736

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNE 285
           V S +FSP +  L +G  D  V LW+++TH  +  +   N 
Sbjct: 528 VYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNH 568

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 54/141 (38%), Gaps = 18/141 (12%)

Query: 181 GEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQ 240
           G+   +  G    V  I +  +G    T S DG + V       R    R H  N +   
Sbjct: 641 GDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAI--- 697

Query: 241 FVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV-------VKLAC 293
                 SL++S   ++L +GG+D  V +W+L   KK    P    +         V  + 
Sbjct: 698 -----YSLSYSKEGNVLISGGADHTVRVWDL---KKATTEPSAEPDEPFIGYLGDVTASI 749

Query: 294 NEDILVVGTSDDSFKTNAVVA 314
           N+DI   G       T+ +VA
Sbjct: 750 NQDIKEYGRRRTVIPTSDLVA 770

>Scas_721.32
          Length = 822

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLA-CNE-DILVVG 301
           PV   A SP    L TG  DG ++LW++ T K++K      +N++  L+ C E ++LV G
Sbjct: 677 PVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSG 736

Query: 302 TSDDSFKT---NAVVAEP 316
            +D S +        AEP
Sbjct: 737 GADHSVRVWDLKKSTAEP 754

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNE 285
           V S +FSP +  L +G  D  V LW+ +T+  +  +   N 
Sbjct: 552 VYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNH 592

 Score = 28.9 bits (63), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 20/36 (55%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF 280
           V+ ++F P    +FTG SD    +W++ T   ++ F
Sbjct: 636 VDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLF 671

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/324 (20%), Positives = 134/324 (41%), Gaps = 40/324 (12%)

Query: 3   KLHKVEVQNGPSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYAL 62
           K H +E+Q   ++  S  + I + ++ L TA +GSL  +    N             YAL
Sbjct: 381 KTHTIELQGQRTDVRS--IDISDDNKLLATASNGSLKIW----NIKTHKCIRTFECGYAL 434

Query: 63  LCCCYAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGV--------SKMVNVG 114
            C    F+ G L V +GT  GE+ L D  +S     + ++    +         K +  G
Sbjct: 435 TC---KFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491

Query: 115 NYTFIASSWDGILQE--IDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLN 172
           +       WD  ++   +    N  +   KL ++T    ++  +++L + ++    R+L 
Sbjct: 492 SADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDT---TLELTDDILCVRVSPDD-RYLA 547

Query: 173 LPLNNN-------DRGEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSR 225
           + L +N       D  +      G K  V  I ++ +    +TSS D  + +   +    
Sbjct: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607

Query: 226 NFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQ-FPKFN 284
           + +   H+ ++++++F+         P SH  F+   D  V  W+ E  + I++ +   +
Sbjct: 608 HKSLFAHQDSIMNVKFL---------PQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQS 658

Query: 285 ENSVVKLACNEDILVVGTSDDSFK 308
           E   + +A +   +V  + D S +
Sbjct: 659 EVWALAVATDGGFVVSSSHDHSIR 682

>ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407)
           [4086 bp, 1361 aa]
          Length = 1361

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 23/31 (74%), Gaps = 1/31 (3%)

Query: 245 VNSLAFSPA-SHLLFTGGSDGCVSLWNLETH 274
           +NS+ F+   +HLL +GG DGC+ +W+L +H
Sbjct: 234 INSVDFNMGQTHLLISGGQDGCIKVWDLRSH 264

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 76/177 (42%), Gaps = 17/177 (9%)

Query: 118 FIASSWDGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKK---IRWLNLP 174
            I+   DG ++  D+ +N       LE+NT + ++   ++  +L     K     W  +P
Sbjct: 131 LISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNKGNCYVW-KMP 189

Query: 175 LNNNDRGE---VTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRC 231
            N+ D      VT+  +  KY  R + L+++     T S D    V   ED   NF    
Sbjct: 190 -NHTDTASLKPVTKFRSHSKYITR-VLLSVDVKHLATCSADHTARVWSVED---NFQLE- 243

Query: 232 HRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV 288
                +D    + V   AFS  S  L T  SD  V LW+L T + ++Q+   ++ +V
Sbjct: 244 ---TTLDAHSRW-VWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAV 296

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 36.6 bits (83), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 47/90 (52%), Gaps = 6/90 (6%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSD 304
           V+S+ F P  +L+ + G D  + +W+L+    +KQF K  ++    +  + ++ + G + 
Sbjct: 256 VDSVIFHPFQNLIISVGEDSTIRVWDLDKRTPVKQF-KREQDRFWSIRAHPNVNLFGAAH 314

Query: 305 DS----FKTNAVVAEPLELQSSRLYVLFKE 330
           DS    FK +     P+ +  ++LY + KE
Sbjct: 315 DSGIMVFKLDR-ERPPVAVNQNQLYFVNKE 343

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 17/32 (53%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHK 275
           PV  + F P   L  + G D  + +W+L THK
Sbjct: 55  PVRGVDFHPTQPLFVSAGDDYSIKVWSLSTHK 86

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 36.6 bits (83), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSD 304
           V+S+ F P  +L+ + G D  + +W+L+    +KQF + N+   + +A +  I + G + 
Sbjct: 256 VDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWL-IAAHPHINLFGAAH 314

Query: 305 DS 306
           DS
Sbjct: 315 DS 316

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHK 275
           PV  L F P   +  + G D  + +W+L+T+K
Sbjct: 55  PVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNK 86

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 36.2 bits (82), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNE 285
           V+S+ F P  +L+ + G D  V +W+L+    IKQF + N+
Sbjct: 256 VDSVIFHPQQNLIISVGEDKTVRVWDLDKRTPIKQFKREND 296

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHK 275
           PV  + F P   L  + G D  + +W+LE++K
Sbjct: 55  PVRGIDFHPTQPLFVSAGDDYTIKVWSLESNK 86

>Kwal_33.15475
          Length = 783

 Score = 35.4 bits (80), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 62/132 (46%), Gaps = 7/132 (5%)

Query: 146 NTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEVTEVETGLKYQVRDIKLTLEGDG 205
           N +  A D   +  ILA  G K   L  PL+    G V     G   +V  +K     + 
Sbjct: 12  NRQTQAGDYNCDREILAFAGGKTIALWKPLDPAHHG-VYRTLKGHNAEVTCVKFVPGTNL 70

Query: 206 YVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGC 265
            V+SS D +V +  FE+  ++ A +C  + ++D      + SL  S  S++L  G +DG 
Sbjct: 71  MVSSSEDSQVRLWAFEEKDQD-ALKC--VQVID-HHKHTITSL--SVISNILSVGCADGS 124

Query: 266 VSLWNLETHKKI 277
           VSLW  E ++ I
Sbjct: 125 VSLWLTENNQAI 136

 Score = 28.9 bits (63), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 14/68 (20%)

Query: 251 SPASHLLFTGGSDGCVSLWNLETHKKI--------------KQFPKFNENSVVKLACNED 296
           SP + LL TG  D  + LW + T++ I               +  KF     +K+A N D
Sbjct: 210 SPGNMLLATGSQDRYIRLWRIRTNELIDNSDEDEFKLNLLGNKQSKFFITPDLKVAINFD 269

Query: 297 ILVVGTSD 304
            L+VG  D
Sbjct: 270 ALIVGHDD 277

>Kwal_56.24526
          Length = 1210

 Score = 35.4 bits (80), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSD 304
           V+S+ F P  +L+ + G D  V +W+L+    +KQF + N+   + +  + +I + G + 
Sbjct: 256 VDSVIFHPHQNLIISVGEDKTVRVWDLDKRTPVKQFKRENDRFWL-VRAHPNINLFGAAH 314

Query: 305 DS 306
           DS
Sbjct: 315 DS 316

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 17/32 (53%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHK 275
           PV  + F P   L  + G D  + +W+L+T K
Sbjct: 55  PVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKK 86

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 35.0 bits (79), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTS 303
           P+ S+++SP   L+ TG + G + LWN     K+K     + + +V +  N+D   + T+
Sbjct: 211 PIISVSWSPDGELVLTGTTSGELRLWN--KQGKLKNILDSHRSPIVAMKWNQDCTHLLTT 268

Query: 304 D 304
           D
Sbjct: 269 D 269

>Scas_713.50
          Length = 983

 Score = 35.0 bits (79), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 66/335 (19%), Positives = 127/335 (37%), Gaps = 67/335 (20%)

Query: 2   DKLHKVEVQNGPSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYA 61
           +KL+ VE+Q   ++  S  + I + ++ L TA +GSL  +    N             YA
Sbjct: 418 NKLYNVELQGQRTDIRS--IDISDDNKLLATASNGSLKIW----NLKTKLCIRTFECGYA 471

Query: 62  LLCCCYAFVLGKLRVYVGTVQGEIFLVDFENS---------------------DFKPVLG 100
           L C    F+ G + V +GT  GE+ L D  +S                     D K ++ 
Sbjct: 472 LTC---KFLPGGMLVIIGTRAGELQLFDLASSTQIANIEEAHDAAIWSLDLTSDGKRLIT 528

Query: 101 NSTQLGVSKMVNVGNYTF----IASSWDGILQEIDMQDNAV------IRTTKLENNTKVL 150
            S      K V   N+      +  + D  + ++ +  +        I + ++    K L
Sbjct: 529 GS----ADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLELSDDILSVRVSPEDKFL 584

Query: 151 AMDCVNNLLILALTGKKIRWLNLPLNNNDRGEVTEVETGLKYQVRDIKLTLEGDGYVTSS 210
           A+  ++N + +        +L+L               G K  V  I ++ +    +TSS
Sbjct: 585 AVSLLDNTVKVFFLDSMKFFLSL--------------YGHKLPVLSIDISFDSKMIITSS 630

Query: 211 IDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWN 270
            D  + +   +    + +   H+ ++++++FV         P SH  F+   DG +  W+
Sbjct: 631 ADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFV---------PESHNFFSCSKDGIIKYWD 681

Query: 271 LETHKKIKQFPKFNENSVVKLACNEDILVVGTSDD 305
            +  + I++              N+   VV +S D
Sbjct: 682 GDKFECIQKLAAHQSEVWALAIANDASFVVSSSHD 716

>Scas_624.11
          Length = 1205

 Score = 35.0 bits (79), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHK 275
           PV S+ F P   +  +GG D  + +W+LET+K
Sbjct: 55  PVRSVDFHPTQPIFVSGGDDYTIKVWSLETNK 86

 Score = 32.0 bits (71), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSD 304
           V+ + F P    + + G D  + +W+L+    +KQF + N+   + +A + +I + G + 
Sbjct: 256 VDCVIFHPTQKFILSVGEDKTLRIWDLDKRIPVKQFKRENDRFWL-IASHPNINLFGAAH 314

Query: 305 DS 306
           D+
Sbjct: 315 DA 316

>Kwal_56.23920
          Length = 937

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 73/328 (22%), Positives = 125/328 (38%), Gaps = 48/328 (14%)

Query: 3   KLHKVEVQNGPSEYISDIVLID--EKSQFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEY 60
           KLH ++++     + SD+  ID    ++ L TA +G+L  +    N             Y
Sbjct: 375 KLHSIDIRG----HRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECG----Y 426

Query: 61  ALLCCCYAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVL--GNSTQLGVSKMVNVGNYTF 118
           AL C    F+ G   V +GT  G++ L D  +S     +   +S  +    M   G    
Sbjct: 427 ALAC---KFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLV 483

Query: 119 IASS------WDGILQEIDMQDNA--------VIRTTKLENNTKVLAMDCV--NNLLILA 162
             S+      WD  +++  +            +   T LE N  VLA+     N LL ++
Sbjct: 484 TGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVS 543

Query: 163 LTGKKIRWLNLPLNNNDRGEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFED 222
           L    ++   +     D  +      G K  V  I ++ +    +TSS D  + +   + 
Sbjct: 544 LLDNTVKVFFM-----DSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLD- 597

Query: 223 DSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPK 282
               F   CHR        +  V    F P SH  F+   D  V  W+ +  + I++   
Sbjct: 598 ----FG-DCHRSLFAHNDSIMKV---VFVPESHNFFSCSKDALVKYWDGDKFECIQKLAA 649

Query: 283 FNENSVVKLACNED--ILVVGTSDDSFK 308
            ++  V  LA + D   +V  + D S +
Sbjct: 650 -HQKEVWTLAISSDGRFVVSASHDQSIR 676

>Scas_655.1
          Length = 548

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 3/38 (7%)

Query: 243 FPVNSLAFSPASHLLFTGGSDGCVSL---WNLETHKKI 277
           FP+ S+   PA  + + G +DGC SL   ++L+ +KKI
Sbjct: 260 FPITSICLDPADRVCYLGTNDGCFSLDLFYSLKGNKKI 297

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 91/223 (40%), Gaps = 49/223 (21%)

Query: 60  YALLCCCYAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFI 119
           YAL   C   + G L V VGT QGE+ L D         L +ST L  ++          
Sbjct: 424 YAL---CSQMLPGGLLVVVGTRQGELQLFD---------LASSTLLSTTE-------AHT 464

Query: 120 ASSWDGILQEIDMQDNA-VIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWL-NLPLNN 177
           A+ W      +D+  N   + T   + + K    + V  L    + G K +++  L L +
Sbjct: 465 AAIW-----SLDLTSNGKRLVTGSADKSCKFWDFEVVEQL----VPGTKDKYIPQLKLVH 515

Query: 178 NDRGEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLV 237
           +   E+T+        +  +K++ E      S +D  V V +F+      +   H++   
Sbjct: 516 DTTLELTD-------DILAVKISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKL--- 565

Query: 238 DMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNL---ETHKKI 277
                 PV S+ FS  S +L T  +D  + +W +   + HK I
Sbjct: 566 ------PVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSI 602

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNEN-SVVKLACNEDILVVGTS 303
           V ++ F   + LL  G  DG + +W+L +   + QF       +V++L      LV G+ 
Sbjct: 76  VTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSK 135

Query: 304 D 304
           D
Sbjct: 136 D 136

>YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of the
           COPII coat of secretory pathway vesicles involved in
           endoplasmic reticulum to Golgi transport, associated
           with Sec13p, member of WD (WD-40) repeat family [3822
           bp, 1273 aa]
          Length = 1273

 Score = 34.3 bits (77), Expect = 0.17,   Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 255 HLLFTGGSDGCVSLWNLETHKKIKQFP 281
           HLL + G D  V LWN E+ +++ QFP
Sbjct: 271 HLLLSSGRDNTVLLWNPESAEQLSQFP 297

>Scas_721.7
          Length = 325

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 2/75 (2%)

Query: 242 VFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF-PKFNENSVVKLACNEDILVV 300
           V P++ + FSP    L     DG V +W+      ++ F P   E+  +K  C  D L  
Sbjct: 192 VVPISQVRFSPNGKFLLVSSFDGIVKIWDCVRGYVVRTFKPSDGESVALKHCCGIDFLAQ 251

Query: 301 -GTSDDSFKTNAVVA 314
            G++ +   T  VV+
Sbjct: 252 EGSNSEKLPTPLVVS 266

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 9/77 (11%)

Query: 232 HRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKL 291
           HR+    M    PV SL ++ + +LLFT   D  + +W+   H  I +    +  SVV L
Sbjct: 92  HRL----MGHTAPVISLTYNDSGNLLFTSSMDESIKIWD-TFHGAILKTISAHSESVVSL 146

Query: 292 ACNED----ILVVGTSD 304
           +   D    +L  G+ D
Sbjct: 147 SICPDRDSSVLASGSFD 163

>YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and
           COMPASS complex, contains a WD (WD-40) repeat [1281 bp,
           426 aa]
          Length = 426

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 242 VFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFN 284
           V P+ S+A+SP   LL T   D  + LW+L    K  +  +F+
Sbjct: 72  VRPITSIAWSPDGRLLLTSSRDWSIKLWDLSKPSKPLKEIRFD 114

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLA--CNEDILVVGT 302
           + S+ FSP    L TG  D  + +W+LET KKI    K +E  +  L    + + LV G+
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLET-KKIVMTLKGHEQDIYSLDYFPSGNKLVSGS 467

Query: 303 SDDSFK 308
            D + +
Sbjct: 468 GDRTVR 473

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 71/175 (40%), Gaps = 13/175 (7%)

Query: 118 FIASSWDGILQEIDMQDNAVIRTTKLENNTKV--LAMDCVNNLLILALTGKKIRWLNLPL 175
            I+   DG ++  D+ +N        E++T +  L+M    ++L  A T        +P 
Sbjct: 131 LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMP- 189

Query: 176 NNNDRGEVTEVETGLKYQVRDIKLTLEGD--GYVTSSIDGRVAVEYFEDDSRNFAFRCHR 233
           N+ D   +  V     +     ++ L  D     T S D    V   +DD     F+   
Sbjct: 190 NHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD-----FKLET 244

Query: 234 MNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV 288
                 ++V+     AFS  S  L T  SD  V LW+L T + ++Q+   ++ +V
Sbjct: 245 TLDGHQRWVW---DCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAV 296

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 79/198 (39%), Gaps = 21/198 (10%)

Query: 136 AVIRTTKLENNTKVLAMDCVNNLLILALTGKK-IRWLNLPLNNNDRGEVTEVETGLKYQV 194
            V   T   ++++V  ++  N+  +LA  G + +R  ++   N +   V   E G +  V
Sbjct: 22  GVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPN--PVASFE-GHRGNV 78

Query: 195 RDIKLTLEGDGYVTSSIDGRVAVEYFEDDS--RNFAFRCHRMNLVDMQFVFPVNSLAFSP 252
             +    +    VTSS DG + V      S  RN+                PVN +   P
Sbjct: 79  TSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNA------------PVNEVVIHP 126

Query: 253 ASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSDDSFKTNAV 312
               L +   DG + +W+L  ++   Q    ++ S+  L+   D  ++  ++   K N  
Sbjct: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAAN--TKGNCY 184

Query: 313 VAE-PLELQSSRLYVLFK 329
           V E P    +S L  + K
Sbjct: 185 VWEMPNHTDASHLKPVTK 202

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 33.5 bits (75), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLA--CNEDILVVGT 302
           + S+ FSP    L TG  D  + +W++E  KKI    K +E  +  L    + D LV G+
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDIE-QKKIVMVLKGHEQDIYSLDYFPSGDKLVSGS 616

Query: 303 SDDSFK 308
            D + +
Sbjct: 617 GDRTVR 622

>CAGL0J07854g complement(765463..766761) similar to sp|P53851
           Saccharomyces cerevisiae YNL253w, hypothetical start
          Length = 432

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 19/44 (43%)

Query: 243 FPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNEN 286
           F V  L   P    LF+G  DG  S+W L T   IK+      N
Sbjct: 256 FSVTCLKIDPLGRYLFSGSKDGSCSIWELRTLICIKEISGLESN 299

>Scas_630.6
          Length = 621

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNED--ILVVGT 302
           + S+ FSP    L TG  D  + +WN++  +KI    K +E  +  L    D   LV G+
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIK-ERKIVMVLKGHEQDIYSLDYFPDGQKLVSGS 402

Query: 303 SDDSFK 308
            D S +
Sbjct: 403 GDRSIR 408

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 14/86 (16%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLE-----------THKKIKQFPKFNENSVVK-- 290
           P+ ++A+SP  + + TGG DG +++W++             H+ I    +F++    K  
Sbjct: 351 PIYTVAWSPNGYQVATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKL 410

Query: 291 LACNEDILV-VGTSDDSFKTNAVVAE 315
           ++C  D L+ V +SD   K  ++   
Sbjct: 411 VSCGYDNLINVYSSDTWLKMGSLAGH 436

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 58/128 (45%), Gaps = 15/128 (11%)

Query: 182 EVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQF 241
           +VT+ ETG +     ++   EG       + G + V           F   ++  +   F
Sbjct: 248 QVTDRETGDR-----LEFGTEGKQVFAGHLSGTITVHDL--------FNKQQILQIPSSF 294

Query: 242 VFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVG 301
           V P N++A   + H + +G  DG V+ W++   ++  Q   F  N++ K+   +D L + 
Sbjct: 295 VAPCNTIA-QISEHAIVSGYEDGTVATWDIRKPQQYLQKLDFAGNAINKILNWKDKLFLS 353

Query: 302 TS-DDSFK 308
           +  D++F+
Sbjct: 354 SGLDNTFE 361

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTS 303
           +N+L  SP   L+ + G DG + LWNL   K +      +E   +  + N   L   T+
Sbjct: 199 INTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATA 257

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 32.7 bits (73), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACN 294
           + S+A  P+   + TG  D  V LWN E    ++Q  K +E+ V+ +A N
Sbjct: 100 IRSIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVAFN 149

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 9/69 (13%)

Query: 207 VTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCV 266
           +TSS D  V +  ++  S       H  N         V+   F P   ++ +G  DG V
Sbjct: 202 ITSSDDTTVKIFDYQTKSCVATLEGHMSN---------VSFAVFHPTLPIIISGSEDGTV 252

Query: 267 SLWNLETHK 275
            LWN  T+K
Sbjct: 253 KLWNSSTYK 261

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 9/69 (13%)

Query: 207 VTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCV 266
           +T+S DG + V  ++  S       H  N         V+   F P   ++ +G  DG +
Sbjct: 202 ITTSDDGTIKVWDYQTKSNVATLEGHMAN---------VSYAVFHPTLPIIISGSEDGTL 252

Query: 267 SLWNLETHK 275
            +WN  T+K
Sbjct: 253 KIWNANTYK 261

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 5/76 (6%)

Query: 224 SRNFAFRCHRMNLVDMQFVFP-----VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIK 278
           S +F  R +  N  +    F      + S+A  P    + TG  D  + LWN E +   +
Sbjct: 74  SDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKNWGCQ 133

Query: 279 QFPKFNENSVVKLACN 294
           Q    +E+ V+ +A N
Sbjct: 134 QTFTGHEHFVMSVAFN 149

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/104 (19%), Positives = 38/104 (36%), Gaps = 7/104 (6%)

Query: 206 YVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGC 265
           + +  +D  + V     D  NF  + H    V+    +P+    +      L T   DG 
Sbjct: 156 FASGCLDHTIKVWSIGQDVPNFTLKAHETKGVNYVDYYPLQDKPY------LITTSDDGT 209

Query: 266 VSLWNLETHKKIKQFPKFNEN-SVVKLACNEDILVVGTSDDSFK 308
           + +W+ +T   +        N S         I++ G+ D + K
Sbjct: 210 IKVWDYQTKSNVATLEGHMANVSYAVFHPTLPIIISGSEDGTLK 253

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 37/189 (19%), Positives = 77/189 (40%), Gaps = 25/189 (13%)

Query: 92  NSDFKPVLGNSTQLGVSKMVNVGNYTFIASSWDGILQEIDMQDNAVIRTTKLENNTKVLA 151
           +++F+P  GN   +G+S    + +Y    S  DG++Q  D   ++++      + +K ++
Sbjct: 238 SAEFRPTSGNEFVVGLSSS-KIKHYDTRVSEKDGLVQVYDHHLSSILAIKYFPDGSKFIS 296

Query: 152 MDCVNNLLILALTGKKIRWLNLPLNNNDRGEVTEVETGLKYQVRDIKLTLEGDGYVTSSI 211
                 L I         W     NN     + ++    ++ +  I +  E + + T S+
Sbjct: 297 SSEDKTLRI---------W-----NNQVNIPIKQISDTTQHSMPYIGIHPEHNYFSTQSM 342

Query: 212 DGRVAVEYFEDDSR---NFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSL 268
           D  +     +   +   N  F+ H      +        L FSP    L +G + G + L
Sbjct: 343 DSVIYSYSMKPKYKMHPNKKFKGHNSAGYGI-------GLTFSPDGRFLCSGDARGQLFL 395

Query: 269 WNLETHKKI 277
           W+  T++K+
Sbjct: 396 WDWNTNRKL 404

>Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement
          Length = 1261

 Score = 32.7 bits (73), Expect = 0.50,   Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 255 HLLFTGGSDGCVSLWNLETHKKIKQFP 281
           +LL + G D   +LWN +T +K+ QFP
Sbjct: 265 NLLLSSGRDNTCALWNPQTAQKLSQFP 291

>Scas_558.3
          Length = 725

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 74/318 (23%), Positives = 123/318 (38%), Gaps = 57/318 (17%)

Query: 12  GPSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYALLCCCY---- 67
           G ++ + DIV+ID+ SQ    + DG+L  +++N N            ++ L   CY    
Sbjct: 10  GHTQDVKDIVVIDD-SQVASVSRDGTLRLWKHNDNGTWQDIVMATSEKF-LNAVCYDKDH 67

Query: 68  --AFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNY----TFIAS 121
              F  G+  +  G     + L+D E+ D  P+    T +G    V   +Y      I+ 
Sbjct: 68  ELLFYSGQESLING-----VSLLDIESIDKDPLY---TLIGHHSNVCALSYKHMSAIISG 119

Query: 122 SWD--------GILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIR-WLN 172
           SWD        G LQ       A +   K+        +    N  I A   + ++ W  
Sbjct: 120 SWDTTAKVWINGALQWSLEGHQASVWDAKI--------ISVEENTFITASADRTVKLWKE 171

Query: 173 LPLNNNDRGEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCH 232
             L     G  ++V       +R+I++   G    T S DG + +   + + +      H
Sbjct: 172 NKLLKTFSGIHSDV-------IRNIEVLSSGKEIATCSNDGTIKISDLDGNIKQ-VLSGH 223

Query: 233 RMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV--VK 290
                   FV+ V     S     L + G D  + +W++  +  IKQ  K    S+  V 
Sbjct: 224 E------SFVYNVK---LSKQGDKLVSCGEDRSLRIWDINNNFNIKQVIKLPAVSIWCVD 274

Query: 291 LACNEDILVVGTSDDSFK 308
              N DI VVG SD++ +
Sbjct: 275 TLPNGDI-VVGCSDNTVR 291

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 32.3 bits (72), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 38/81 (46%), Gaps = 13/81 (16%)

Query: 248 LAFSPASHLLFTGGSDGCVSLWNLETHKKIK------------QFPKFNENSVVKLACNE 295
           + +S   H L TGG DG +++W+L    K+             +F K N+++++    + 
Sbjct: 388 MDWSIDGHTLATGGGDGVITIWDLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDR 447

Query: 296 DILVVGTSDDSFKTNAVVAEP 316
            I V  + D+  K ++++   
Sbjct: 448 SIFVY-SKDNYLKVSSLIGHA 467

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 70/172 (40%), Gaps = 18/172 (10%)

Query: 112 NVGNYTFIASSWDGILQEIDMQDNAVIRTTKLEN-NTKVLAMDCVNNLLILALTGKKIRW 170
           N GNY   + SW+G +  ID   N +  T  L+N + KV  +   +N  +L   G+    
Sbjct: 222 NNGNY-VASGSWNGEVSIID--SNTLEVTQTLQNHDGKVGGIAWTSNDSVLITGGEDHL- 277

Query: 171 LNLPLNNNDRGEVTEVET--GLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFA 228
             + ++N   GE     +  G + ++ D+++   G    TSS D    +   E   +   
Sbjct: 278 --ITVSNRSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLL 335

Query: 229 FRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF 280
              H   L           LAF     L+ T G+D    +W+L + K + Q 
Sbjct: 336 QEGHSKELY---------CLAFQADGALVSTAGTDKTAIIWDLRSGKAVSQL 378

>Kwal_23.5351
          Length = 474

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 2/63 (3%)

Query: 227 FAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNEN 286
           +  R  R  +V      P+  +++SP  H + TG  DG V +W++    K         N
Sbjct: 340 WDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSI--LAHN 397

Query: 287 SVV 289
           S+V
Sbjct: 398 SIV 400

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWN 270
           +  +A+S  S LL TGG+D  V +WN
Sbjct: 228 IGGVAWSSDSQLLATGGADNLVKIWN 253

>Kwal_14.1597
          Length = 380

 Score = 32.0 bits (71), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 249 AFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNED--------ILVV 300
           + SP  ++ FTGG D  ++  +L T++ I    + +E  VV + C+           ++ 
Sbjct: 203 SLSPFENVAFTGGDDSTIAAHDLRTNEAIWTNSRVHEAGVVAIKCSTQSFRTDRPTSIIT 262

Query: 301 GTSDDSFKT 309
           G+ DD  ++
Sbjct: 263 GSYDDQIRS 271

>Scas_631.17
          Length = 474

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 20/28 (71%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNL 271
           P+ S+ +SP  + + TGG DG +++W++
Sbjct: 361 PIYSVDWSPDGYHIATGGGDGVINIWDI 388

>KLLA0E17215g 1526177..1527430 similar to sp|P38211 Saccharomyces
           cerevisiae YBR004c singleton, start by similarity
          Length = 417

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 280 FPKFNENSVVKLACNEDILVVGTSDDSFKTNAVVAEPLELQSSRLYVLFKE 330
           FP F +N   KLA    +L + +S   F   +V +EP+    S L +LF++
Sbjct: 131 FPPFGQNVQTKLALTTSVLFILSSAAGFLI-SVYSEPIAFTFSLLGMLFRQ 180

>Sklu_2416.2 YOL138C, Contig c2416 613-4674 reverse complement
          Length = 1353

 Score = 32.3 bits (72), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 24/33 (72%), Gaps = 1/33 (3%)

Query: 245 VNSLAFS-PASHLLFTGGSDGCVSLWNLETHKK 276
           +NS+ F+   ++LL +GG DGC+ +W+L + ++
Sbjct: 232 INSVDFNMSQTNLLISGGQDGCIKVWDLRSSQR 264

>Scas_629.12
          Length = 671

 Score = 32.0 bits (71), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLA--CNEDILVVGT 302
           + S+ FSP    L TG  D  + +W+++  +KI    K +E  V  L    N + LV G+
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQ-ERKIVMVLKGHEQDVYSLDYFPNGEKLVSGS 448

Query: 303 SDDSFK 308
            D + +
Sbjct: 449 GDRTVR 454

>Scas_721.115*
          Length = 318

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTS 303
           VN++  SP   L+ + G DG + LWNL   K +      +E   +  + N   L   T+
Sbjct: 198 VNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFALAFSPNRYWLAAATA 256

>Scas_695.15
          Length = 327

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 249 AFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV 288
           AFS  S  L T  SD  V LW+L T + ++Q+   ++ +V
Sbjct: 281 AFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAV 320

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 77/192 (40%), Gaps = 20/192 (10%)

Query: 109 KMVNVGNYTFIASSWDGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTG-KK 167
           K  N+ +   +++ +D  ++  +       RT +  ++++V  ++  N+  +LA  G + 
Sbjct: 16  KTRNIMSVILVSAGYDHTIRFWEALTGVCSRTIQ-HSDSQVNRLEITNDKKLLAAAGYQN 74

Query: 168 IRWLNLPLNNNDRGEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDS--R 225
           +R  ++   N +     E   G K  V  +    +    VTSS DG + V      S  R
Sbjct: 75  VRLYDIRTTNPNAVATFE---GHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPR 131

Query: 226 NFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF-PKFN 284
           N+                PVN +   P    L +   DG + +W+L  ++   Q  P  +
Sbjct: 132 NYKHNA------------PVNEVVIHPNQGELISCDRDGTIKIWDLGENQCTHQLIPDDD 179

Query: 285 ENSVVKLACNED 296
             S+  L+   D
Sbjct: 180 NTSLQSLSVASD 191

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 32.0 bits (71), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 19/32 (59%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHK 275
           PV ++ F P   +  + G D  + +W+LET++
Sbjct: 55  PVRAVDFHPTQPIFVSAGDDASIKVWSLETNR 86

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHK 275
           VN  +F P   L+ TGG D  V LW + ++K
Sbjct: 212 VNWASFHPTLPLIVTGGDDRQVKLWRMSSNK 242

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 11/41 (26%), Positives = 23/41 (56%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNE 285
           V+ + F P  +L+ +   D  + +W+L+    +KQF + N+
Sbjct: 256 VDCVVFHPDQNLILSVAEDKTLRIWDLDKRTPVKQFKREND 296

>Scas_589.13
          Length = 1311

 Score = 32.0 bits (71), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 245 VNSLAFSPA-SHLLFTGGSDGCVSLWNLETH 274
           VNS  F+   S+L+ +GG DGCV +W+L ++
Sbjct: 224 VNSFDFNMVQSNLIISGGQDGCVKIWDLRSN 254

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 31.6 bits (70), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 51/124 (41%), Gaps = 9/124 (7%)

Query: 200 TLEGDGYVTSSIDGRVAVEYFEDDSRNFAFR----CHRMNLVDMQFVFPVNSLAFSPASH 255
           T EG      SID     EY    S +F+ +    C   N+   +   PV  + FSPA  
Sbjct: 47  TFEGHMGTIWSIDVDQFTEYAVTGSADFSVKLWKVCDGSNVYTWKTKTPVRRVEFSPAGD 106

Query: 256 LLFT-----GGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSDDSFKTN 310
            +        G  G V+++++  + +  +    NE  V ++  ++D  +   +   F+  
Sbjct: 107 KILAVLDGVMGYAGSVTVYDVVRNTETNEIVNINEEPVFEILTHDDFGIASVASWGFEGK 166

Query: 311 AVVA 314
            +VA
Sbjct: 167 YIVA 170

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 31.2 bits (69), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 74/176 (42%), Gaps = 15/176 (8%)

Query: 118 FIASSWDGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIR---WLNLP 174
            I+   DG ++  D+ +N        E+NT + ++   ++  +L     K     W  +P
Sbjct: 131 LISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGNCYVW-KMP 189

Query: 175 LNNNDRG--EVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCH 232
            + +      VT+ ++  KY  R + L+ +     T S D    V   ED   NF     
Sbjct: 190 HHTDASTLEPVTKFKSHTKYITR-VLLSADVKHLATCSADHTARVWNIED---NFELE-- 243

Query: 233 RMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV 288
               +D    + V   AFS  S  L T  SD  V LW+L T + ++Q+   ++ +V
Sbjct: 244 --TTLDGHQRW-VWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGGHHKGAV 296

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 64/164 (39%), Gaps = 25/164 (15%)

Query: 175 LNNNDRGEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDS--RNFAFRCH 232
           + +N+   V+  E G K  V  I    E    V+SS DG + V      S  RN+     
Sbjct: 60  IRSNNPNPVSSFE-GHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNA- 117

Query: 233 RMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLA 292
                      PVN +A  P    L +   DG + +W+L  ++   Q    +   +  L+
Sbjct: 118 -----------PVNEVAIHPNQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLS 166

Query: 293 CNED--ILVVGTSDDS-------FKTNAVVAEPL-ELQSSRLYV 326
              D  +LV G +  +         T+A   EP+ + +S   Y+
Sbjct: 167 VASDGSMLVAGNNKGNCYVWKMPHHTDASTLEPVTKFKSHTKYI 210

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 74/177 (41%), Gaps = 17/177 (9%)

Query: 118 FIASSWDGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKK---IRWLNLP 174
            I+   DG ++  D+ +N        E++T + ++   ++  +L     K     W  +P
Sbjct: 131 LISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNKGNCYVW-QMP 189

Query: 175 LNNNDRGE---VTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRC 231
            N+ D      VT+  +  KY  R + L+ +     T S D    V   ED   NF    
Sbjct: 190 -NHTDAANLKPVTKFRSHTKYITR-VLLSSDVKHLATCSADHTARVWSIED---NFKLE- 243

Query: 232 HRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV 288
                +D    + V   AFS  S  L T  SD  V LW+L T + ++Q+   ++ +V
Sbjct: 244 ---TTLDGHQRW-VWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAV 296

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%)

Query: 249 AFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV 288
           AFS  S  L T  SD  V LW+L T   I+Q+   ++ +V
Sbjct: 257 AFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGHHKGAV 296

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 69/166 (41%), Gaps = 19/166 (11%)

Query: 118 FIASSWDGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKK-IRWLNLPLN 176
            +++ +D  ++  +      +RT +   +++V  ++  N+  +LA  G + IR  ++  +
Sbjct: 5   LVSAGYDHTIRFWEALTGVCLRTIQ-HPDSQVNRLEITNDKKLLAAAGHQNIRLYDIKTS 63

Query: 177 NNDRGEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDS--RNFAFRCHRM 234
           N++   V   E G +  V  +    +    VTSS DG + V      S  RN+       
Sbjct: 64  NSN--PVASFE-GHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNA--- 117

Query: 235 NLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF 280
                    PVN +   P    L +   DG + +W+L  ++   Q 
Sbjct: 118 ---------PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQL 154

>KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces
           cerevisiae YMR146c TIF34 translation initiation factor
           eIF3, p39 subunit singleton, start by similarity
          Length = 347

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/168 (19%), Positives = 68/168 (40%), Gaps = 24/168 (14%)

Query: 175 LNNNDRGEVTEVETGLKYQVRDIK---------LTLEGDGYVTSSIDGRVAVEYFEDDSR 225
           L  N+ GE+  V+    Y++  I+          +  G   +    DG+++  Y E+   
Sbjct: 127 LIRNENGEIVNVKEEPDYEITTIEQATKVFVASWSYNGKYIIAGHEDGQISAYYGENGEF 186

Query: 226 NFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPK--- 282
             A + H  ++ D+Q         FSP      T   D   SL +++T + +K +     
Sbjct: 187 VQAKKIHEKSIKDIQ---------FSPDRTYFITSSRDSVASLVDVDTFEVLKTYKADCP 237

Query: 283 FNENSVVKLACNEDILVVGTSDDSFKTNAVVAEPLELQSSRLYVLFKE 330
            N  S+  L   ++ +++G   D+       A   + ++   + +F++
Sbjct: 238 LNSASITPL---KEFVILGGGQDAKDVTTTSAREGKFEARIYHKVFQD 282

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 5/56 (8%)

Query: 216 AVEYFE--DDSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLW 269
           A+++F+   D+ N    CH +     + V    SLA+SP  H+L +   D  +  W
Sbjct: 314 AIKHFDLLHDNSNSTPACHTIPYAHEKSV---TSLAYSPVGHILASAAKDRTIRFW 366

>Kwal_23.6240
          Length = 913

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 58/270 (21%), Positives = 102/270 (37%), Gaps = 38/270 (14%)

Query: 12  GPSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPNXXXXXXXXXXXHEYALLCCCYAFVL 71
           G  +Y+       ++ +    + DG++ Q+EY P             E  +    Y++ +
Sbjct: 189 GHRDYVMGAFFSADQERIYTVSKDGAVFQWEYTPRPGFESPEQD--EETEIDPSLYSWRI 246

Query: 72  GKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIASSWDGILQEID 131
            K + Y    Q  +  V F  +    V+G +   G  ++  +  +T I        Q++ 
Sbjct: 247 TK-KNYFYASQARVKCVTFHANSNTLVVGFNN--GEFRLYELPEFTLI--------QQLS 295

Query: 132 MQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEVTEVETGLK 191
           M  NAV        NT      CVN+      +G+   WL     ++  G++   E   +
Sbjct: 296 MGQNAV--------NTV-----CVND------SGE---WL--AFGSSKLGQLLVYEWQSE 331

Query: 192 YQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQ-FVFPVNSLAF 250
             +   +   +    VT S DG   V   ED             LV  Q     V++LAF
Sbjct: 332 SYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAF 391

Query: 251 SPASHLLFTGGSDGCVSLWNLETHKKIKQF 280
           +    +LF+   DG V  W+L  ++  + F
Sbjct: 392 AKRGQVLFSASLDGTVRAWDLVRYRNFRTF 421

>Kwal_47.17465
          Length = 800

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF 280
           +  + ++P S +L T G D  V +WN  T +KIK+F
Sbjct: 82  IQDICWAPDSSILVTVGLDRSVIVWNGSTFEKIKRF 117

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLA--CNEDILVVGT 302
           + S+ FSP    L TG  D  + +W++E ++KI    + +E  +  L    + D LV G+
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIE-NRKIVMILQGHEQDIYSLDYFPSGDKLVSGS 504

Query: 303 SDDSFK 308
            D + +
Sbjct: 505 GDRTVR 510

>Kwal_27.12239
          Length = 316

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 242 VFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDIL 298
           V P++ + FS     L     DG + +W+    K ++ F K  E+S ++ +C  D L
Sbjct: 192 VVPISQVKFSRNGKYLLVKSLDGILKIWDFVRGKVVRTF-KSGESSSLRYSCGMDFL 247

>KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomyces
           cerevisiae YOL138c, hypothetical start
          Length = 1321

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 245 VNSLAFSPA-SHLLFTGGSDGCVSLWNLETHK 275
           +NS+ F+   + LL +GG DGC+ +W+L + K
Sbjct: 228 INSVDFNMVQTSLLISGGQDGCIKIWDLRSPK 259

>Scas_592.4*
          Length = 318

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTS 303
           VN++  SP   L+ + G DG + LWNL   K +      +E   +  + N   L   T+
Sbjct: 198 VNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFSLAFSPNRYWLAAATA 256

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 25/57 (43%)

Query: 242 VFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDIL 298
           V P++ + FS     L     DG V LW+      ++ F   +  S +K +C  D L
Sbjct: 189 VVPISQVKFSRNGKFLLVRSLDGVVKLWDFIRGCVVRTFKDASGESRMKYSCGMDFL 245

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 50/117 (42%), Gaps = 22/117 (18%)

Query: 194 VRDIKLTLEGDGYVTSSIDGRV---------AVEYFEDDS--RNFAFRCHRMNLVDMQFV 242
           +  +K +  G   +  S+DG V          V  F+D S      + C       M F+
Sbjct: 192 ISQVKFSRNGKFLLVRSLDGVVKLWDFIRGCVVRTFKDASGESRMKYSC------GMDFL 245

Query: 243 FPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENS-VVKLACNEDIL 298
           +P +      A  ++  GG DG + +WN ++    +     +E+S V+ ++C E ++
Sbjct: 246 YPDSE----AADVMVVVGGEDGNICVWNAQSKAVAQTLKGQHEDSPVIAVSCKETLV 298

>Scas_597.9
          Length = 369

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 31/68 (45%), Gaps = 8/68 (11%)

Query: 250 FSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDI--------LVVG 301
            +P   ++FTGG D  +   +L +H  I    + +E  VV + C            ++ G
Sbjct: 195 LAPFQDVIFTGGDDATIMAHDLRSHDAIWTNNRIHEAGVVGIKCATPTFRPHKPTSIITG 254

Query: 302 TSDDSFKT 309
           + DD+ ++
Sbjct: 255 SYDDNIRS 262

>KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces
           cerevisiae YMR049c singleton, start by similarity
          Length = 791

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 3/57 (5%)

Query: 223 DSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQ 279
           D R F  RC   + V +     + +++  P    L TG  DG V +W + T +++ Q
Sbjct: 410 DLRPFPIRC---STVYVGHKGKIRTMSIDPTGLWLATGSDDGTVRVWEILTGREVYQ 463

>Scas_704.40
          Length = 608

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 12/80 (15%)

Query: 229 FRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV 288
           F+ H   ++ +QF +            LLFTG  D  V++W+L ++K I++    + + V
Sbjct: 249 FKGHMDGVLTLQFNY-----------RLLFTGSYDSTVAIWDLCSNKLIRRLSG-HTDGV 296

Query: 289 VKLACNEDILVVGTSDDSFK 308
             L  +E  LV G+ D + +
Sbjct: 297 KTLYFDEAKLVTGSLDKTIR 316

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 19/36 (52%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF 280
           VN +   P S   F+G  D  + +W++ T+  +K F
Sbjct: 375 VNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF 410

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 257 LFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSDDSFK 308
           L TG  DG V LW+L + K I+   K + +++  L  +   LV G+ D + +
Sbjct: 579 LATGTKDGVVRLWDLRSGKVIRTL-KGHTDAITSLKFDSACLVTGSYDRTVR 629

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 257 LFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSDDSFK 308
           L TG  DG V LW+L   K ++   + + + +  L  + + LV G+ D+S +
Sbjct: 518 LATGTKDGIVRLWDLRVGKPVRLL-EGHTDGITSLKFDSEKLVTGSMDNSVR 568

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF 280
           +  + ++P S +L T G D  + +WN  T +KIK+F
Sbjct: 137 IQDICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRF 172

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 59/144 (40%), Gaps = 14/144 (9%)

Query: 173 LPLNNNDRGEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCH 232
           LPL +  R  + +  TG      DI+        V      +V   + +   R   F+ H
Sbjct: 243 LPLLHMKRARIQQNSTGSSSNA-DIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKGH 301

Query: 233 RMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLA 292
              ++ +QF +            LLFTG  D  + +W+L T K I++    + + V  L 
Sbjct: 302 MDGVLTLQFNY-----------RLLFTGSYDSTIGIWDLFTGKLIRRLSG-HSDGVKTLY 349

Query: 293 CNEDILVVGTSDDSFKT-NAVVAE 315
            ++  L+ G+ D + +  N +  E
Sbjct: 350 FDDRKLITGSLDKTIRVWNYITGE 373

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 9/69 (13%)

Query: 207 VTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCV 266
           +TSS D  V +  ++  S       H  N         V+   F P+  ++ +G  DG V
Sbjct: 84  ITSSDDRSVKIWDYQTKSCVATLEGHMAN---------VSYAIFHPSLPIIISGSEDGTV 134

Query: 267 SLWNLETHK 275
            +WN  T+K
Sbjct: 135 KIWNANTYK 143

>Kwal_0.212
          Length = 303

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 75/176 (42%), Gaps = 15/176 (8%)

Query: 118 FIASSWDGILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKK---IRWLNLP 174
            I+   DG ++  D+ +N  +     E++T + ++   ++  +L     K     W  +P
Sbjct: 131 LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW-QMP 189

Query: 175 LNNN--DRGEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCH 232
              +  +   VT+  +  KY  R + L+ +     T S D    V   +D   NF     
Sbjct: 190 HQTDAANPKPVTKFRSHAKYITR-VLLSSDVKHLATCSADHTARVWSIDD---NFQLETT 245

Query: 233 RMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV 288
             N    ++V+     AFS  S  L T  SD  V LW+L T + ++Q+   ++ ++
Sbjct: 246 LDN--HQRWVW---DCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAI 296

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLA--CNEDILVVGT 302
           + S+ FSP    L TG  D  + +W+L T KKI    + +E  +  L      D LV G+
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTT-KKILMTLQGHEQDIYSLDYFPAGDKLVSGS 413

Query: 303 SDDSFK 308
            D + +
Sbjct: 414 GDRTVR 419

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 9/85 (10%)

Query: 247 SLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFP-KFNENSVVKLA--CNEDILVVGTS 303
           ++A SP    + TGG D  + +W+ E+   +K  P K     V+ LA   N D L    +
Sbjct: 243 TVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEVLSLAFRKNSDQLFASCA 302

Query: 304 DDSFKTNAVVAEPLELQSSRLYVLF 328
           D   +T A+       Q S+L VL+
Sbjct: 303 DYKVRTYAIN------QFSQLEVLY 321

>YPL126W (NAN1) [5319] chr16 (310209..312899) Nucleolar protein
           associated with Net1p, component of U3 snoRNP (also
           called small subunit processome), which is required for
           18S biogenesis [2691 bp, 896 aa]
          Length = 896

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 247 SLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF-PKFN 284
           SL+FS     L +GG +  +SLW LET+   +QF P+ N
Sbjct: 302 SLSFSHDGSYLLSGGWEKVMSLWQLETNS--QQFLPRLN 338

>CAGL0D04884g 475678..477369 highly similar to tr|Q06506
           Saccharomyces cerevisiae YPR137w RRP9, start by
           similarity
          Length = 563

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 247 SLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFP-KFNENSVVKLA--CNEDILVVGTS 303
           ++A SP   ++ TGG D  + +W+ E+   IK  P K  +  ++ L    N D L V  +
Sbjct: 232 TVAASPKGDVVVTGGRDRKLIVWSTESLAPIKVIPTKDRKGQILSLTFRRNSDQLYVACA 291

Query: 304 DDSFKTNAV 312
           D   +T ++
Sbjct: 292 DYKIRTYSI 300

>Kwal_55.22076
          Length = 1286

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 245 VNSLAFSPA-SHLLFTGGSDGCVSLWNLETHKKIK 278
           +NS+ F+ A S LL +G  DGC+ +W+L + +  K
Sbjct: 216 INSVDFNMAQSSLLISGSQDGCIKVWDLRSSQGRK 250

>ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH]
           (567357..569840) [2484 bp, 827 aa]
          Length = 827

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 223 DSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKI 277
           D R F  RC   + V       + +L+  P+   L TG  DG V +W + T +++
Sbjct: 447 DLRPFPIRC---STVYAGHKGKIRTLSIDPSGLWLATGSDDGTVRVWEILTGREV 498

>Kwal_23.6429
          Length = 750

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLA--CNEDILVVGT 302
           + S+ FSP    L TG  D  + +W+L T + +    + +E  +  L    + D LV G+
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTL-QGHEQDIYSLDYFPSGDKLVSGS 531

Query: 303 SDDSFK 308
            D + +
Sbjct: 532 GDRTVR 537

>YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein with
           possible role in ribosome biogenesis, has similarity to
           mouse Bop1 growth suppressor, has five WD (WD-40)
           domains [2424 bp, 807 aa]
          Length = 807

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 223 DSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKI 277
           D R F  RC   + +       V +L+  P+   L TG  DG V +W + T +++
Sbjct: 421 DLRPFPIRC---STIYAGHKGKVRTLSIDPSGLWLATGSDDGTVRVWEILTGREV 472

>YJL069C (UTP18) [2843] chr10 complement(310838..312622) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.8054p
           [1785 bp, 594 aa]
          Length = 594

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 16/27 (59%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNL 271
           V S+AFSP+  LL  G   G V LW L
Sbjct: 565 VTSVAFSPSGGLLAVGNEQGKVRLWKL 591

>Scas_615.11
          Length = 349

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 13/15 (86%)

Query: 256 LLFTGGSDGCVSLWN 270
           +L TGG DGCV+LWN
Sbjct: 332 MLATGGDDGCVNLWN 346

>KLLA0D13222g complement(1132067..1134277) similar to sgd|S0002732
           Saccharomyces cerevisiae YDR324c, start by similarity
          Length = 736

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 70/170 (41%), Gaps = 24/170 (14%)

Query: 134 DNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEVTEVETGLKYQ 193
           ++ VI +  + N+   LA+ C N  ++L             +N +    V E E+ L  Q
Sbjct: 116 NSGVIWSIAMSNDMNKLAVGCDNGSVVL-------------INISGGKGVLEHESILTRQ 162

Query: 194 ---VRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNL----VDMQFVFPVN 246
              V  +  T   +  V    DGR+ + Y ++   N     H M +     +   V+ V 
Sbjct: 163 ESRVLSLTWTANDESLVAGCSDGRIRIWYTKEQDENKGRLLHTMKVDKSKKESTLVWSVL 222

Query: 247 SLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNED 296
            LA     + + +G S G V  W+L  +  + Q  K ++  V+ LA + D
Sbjct: 223 YLA---KQNQIVSGDSTGSVKFWDL-NYATLTQSFKVHDADVLCLATDLD 268

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 243 FPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACN 294
           F +N   FSP    + +G S G V +W+ +T + +K+F   +   V  LA +
Sbjct: 401 FGIN-FGFSPDGQYIVSGDSRGSVVVWDWKTTRTLKRFEVPDGKPVTTLAWH 451

>Kwal_55.21450
          Length = 503

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 35/206 (16%), Positives = 84/206 (40%), Gaps = 31/206 (15%)

Query: 93  SDFKPVLGNSTQLGVSKMVNVGNYTFIASSWDGILQEIDMQDNAVIRTTKLENNTKVLAM 152
           ++F+P   N   +G+S    + +Y    S  +G++Q  D   +++I      + +K ++ 
Sbjct: 301 AEFRPSNSNEFIVGLSNS-EIRHYDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSS 359

Query: 153 DCVNNLLILALTGKKIRWLNLPLNNNDRGEVTEVETGLKYQVRDIKLTLEGDGYVTSSID 212
               ++ I          +N+P        + ++    +Y +  I +  E + +   S+D
Sbjct: 360 SEDKSMRIWE------NQINIP--------IKQISDTSQYSMPYIGIHPEQNYFAAQSMD 405

Query: 213 GRVAV-----EYFEDDSRNFA-FRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCV 266
             +       +Y     ++F+  +C    +             FSP    + +G + G V
Sbjct: 406 NAIYAFSMKPKYKRHPKKHFSGHKCAGFGI----------GFGFSPDGQYIASGDTRGRV 455

Query: 267 SLWNLETHKKIKQFPKFNENSVVKLA 292
            +W+ +T   +K F   ++ ++V +A
Sbjct: 456 YIWDWKTTHLLKHFDVPDKKTIVTVA 481

>AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH]
           (526057..527832) [1776 bp, 591 aa]
          Length = 591

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 9/85 (10%)

Query: 247 SLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFP-KFNENSVVKLA--CNEDILVVGTS 303
           ++A SP    + TGG D  + +W+ E+   +K  P K     V+ LA   N D L    +
Sbjct: 260 TVAASPDGKYVVTGGRDKKLIVWSTESLAPVKVIPTKDRRGEVLGLAFRRNTDQLYAACA 319

Query: 304 DDSFKTNAVVAEPLELQSSRLYVLF 328
           D   +T A+       Q S+L VL+
Sbjct: 320 DYKIRTFAIN------QFSQLEVLY 338

>Kwal_56.23035
          Length = 424

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 17/32 (53%)

Query: 241 FVFPVNSLAFSPASHLLFTGGSDGCVSLWNLE 272
           F   + SLAF      L + G DG V+LW ++
Sbjct: 45  FPIGITSLAFDNTGQYLLSSGEDGSVALWAMD 76

>Kwal_0.49
          Length = 584

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNL 271
           V S+AFSP   +L  G   G V LW L
Sbjct: 554 VTSVAFSPRGEMLAAGNEQGKVRLWRL 580

>AFR715C [3908] [Homologous to ScYCL039W - SH] (1752847..1754997)
           [2151 bp, 716 aa]
          Length = 716

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 11/52 (21%)

Query: 222 DDSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLF-TGGSDGCVSLWNLE 272
           DDSRN  F   ++           N++A++P +  LF +GG DG V +W ++
Sbjct: 673 DDSRNKNFPMTKV----------CNTVAWNPVNSRLFASGGDDGLVKIWKVD 714

>CAGL0E01485g complement(138830..142840) similar to tr|Q08281
           Saccharomyces cerevisiae YOL138c, start by similarity
          Length = 1336

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 245 VNSLAFS-PASHLLFTGGSDGCVSLWNLETHKKIKQ 279
           +NS  F+   ++L+ +GG DGCV +W++ +    +Q
Sbjct: 287 INSFDFNMSQTNLIISGGQDGCVKVWDIRSDSMKRQ 322

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 6/84 (7%)

Query: 248 LAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSDDSF 307
           L+    + LL TG  D  V++W+L T K I++    + + V  L  ++  L+ G+ D + 
Sbjct: 263 LSLQLTNKLLLTGSYDSTVAIWDLATGKLIRRLSG-HTDGVKALRFDDQKLITGSLDKTI 321

Query: 308 K-----TNAVVAEPLELQSSRLYV 326
           +     T A V+     Q S L V
Sbjct: 322 RVWNYVTGACVSTYRGHQDSVLSV 345

>KLLA0F02013g 183770..185470 similar to sp|P40362 Saccharomyces
           cerevisiae YJL069c singleton, start by similarity
          Length = 566

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNL 271
           V S+AFSP   +L  G   G V LW L
Sbjct: 537 VTSVAFSPQGEMLAVGNEQGKVRLWRL 563

>Scas_718.6*
          Length = 546

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNED 296
           + +L++SP   L+ T   +G + LWN +   +++    F+ + +V +  NED
Sbjct: 241 ITALSWSPDGELIITSVENGELRLWNKDG--RLQNVFNFHRSPIVSIKWNED 290

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF 280
           +  + ++P S +L T G D  V +WN  T +K+K+F
Sbjct: 140 IQDICWAPDSSILVTVGLDRSVIVWNGSTFEKLKRF 175

>Sklu_2379.7 YBR246W, Contig c2379 13796-14935 reverse complement
          Length = 379

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/68 (22%), Positives = 30/68 (44%), Gaps = 8/68 (11%)

Query: 250 FSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDI--------LVVG 301
             P  +++FTGG D  +   +L T   +    + +E  VV + C+           ++ G
Sbjct: 204 LQPLQNIIFTGGDDATIVAHDLRTRDHVWSNNRIHEAGVVGIKCSTPTFRVSKPTSIITG 263

Query: 302 TSDDSFKT 309
           + DD  ++
Sbjct: 264 SYDDHIRS 271

>Scas_649.10
          Length = 806

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 6/76 (7%)

Query: 223 DSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHK---KIKQ 279
           D R F  RC   + +       + +L+  P+   L TG  DG V +W + T +   K+  
Sbjct: 421 DLRPFPIRC---STIFAGHKGKIRTLSIDPSGLWLATGSDDGTVRVWEILTGREVYKVSL 477

Query: 280 FPKFNENSVVKLACNE 295
                ENS   + C E
Sbjct: 478 IDDTEENSDDHIECIE 493

>CAGL0M02563g complement(295156..296529) weakly similar to sp|Q03010
           Saccharomyces cerevisiae YPL139c UME1 or sp|Q12206
           Saccharomyces cerevisiae YOR229w WTM2 or sp|Q12363
           Saccharomyces cerevisiae YOR230w WTM1, hypothetical
           start
          Length = 457

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 7/51 (13%)

Query: 223 DSRNFAFRCHRMNLVDMQFVFPVNSLAFSP-ASHLLFTGGSDGCVSLWNLE 272
           DSRN A    +   ++ + +    S AFSP    LL TGG++G ++ W+++
Sbjct: 268 DSRNLATPIWK---IENEHIL---SFAFSPLVETLLITGGANGIINFWDVK 312

>Kwal_55.21144
          Length = 570

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 3/69 (4%)

Query: 247 SLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFP-KFNENSVVKLA--CNEDILVVGTS 303
           +LA SP    + TGG D  + +W+ E+   +K  P K     V+ L    N D L    +
Sbjct: 238 TLAASPDGKYVITGGRDRKLIIWSTESLAPVKVIPTKDRRGEVLSLVFRKNSDQLYAACA 297

Query: 304 DDSFKTNAV 312
           D   +T ++
Sbjct: 298 DYKIRTYSI 306

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 30/76 (39%), Gaps = 8/76 (10%)

Query: 194 VRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSLAFSPA 253
           V D+  +  GD  VT S D  + +           +   RM     Q VF V    +S  
Sbjct: 308 VMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRM-----QHVFQV---KYSMD 359

Query: 254 SHLLFTGGSDGCVSLW 269
           S  + +G  DG V LW
Sbjct: 360 SKYIISGSDDGNVRLW 375

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 55/122 (45%), Gaps = 14/122 (11%)

Query: 192 YQVRDIKLTLE---GDGYVTSSIDGRVAVEYFEDDSRNFAFR----CHRMNLVDMQFVFP 244
           YQ+R+  L LE   G   +  S DG+      +D +     R     HR+    +    P
Sbjct: 44  YQLRE-TLVLEHAAGVSQICWSPDGKCIASCSDDFTVVVTHRQLGLLHRL----VGHTAP 98

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV-VKLACNE-DILVVGT 302
           V SL ++   +LLFT   D  + +W++ T   +K     +E  V + L+ N+  IL  G+
Sbjct: 99  VISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGS 158

Query: 303 SD 304
            D
Sbjct: 159 HD 160

>Sklu_1731.4 YJL069C, Contig c1731 3709-5439 reverse complement
          Length = 576

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNL 271
           V S+AFSP   +L  G   G V LW L
Sbjct: 547 VTSVAFSPRGEMLAVGNEQGKVRLWRL 573

>KLLA0F06688g 644040..645299 similar to sp|P38332 Saccharomyces
           cerevisiae YBR246w singleton, start by similarity
          Length = 419

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 31/69 (44%), Gaps = 8/69 (11%)

Query: 249 AFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDI--------LVV 300
             +P   ++FTGG D  ++  +L + KKI    K ++  V  +    +         L+ 
Sbjct: 243 CLAPLKDVVFTGGDDSAIAAHDLNSGKKIWSNSKIHQAGVTAIKAARETFRGNKPTSLIT 302

Query: 301 GTSDDSFKT 309
           G+ DD  ++
Sbjct: 303 GSYDDHIRS 311

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 11/16 (68%), Positives = 13/16 (81%)

Query: 256 LLFTGGSDGCVSLWNL 271
           LL TGG DGCV++W L
Sbjct: 310 LLVTGGDDGCVNVWEL 325

>KLLA0B11924g complement(1043344..1047582) similar to sp|P22219
            Saccharomyces cerevisiae YBR097w VPS15 ser/thr protein
            kinase singleton, start by similarity
          Length = 1412

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 9/76 (11%)

Query: 244  PVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF-PKFNE---NSVVKLA--CNEDI 297
            PV ++A +     + TG  DG + +W+L   +K   F P  N    +S+V +    N D+
Sbjct: 1037 PVTAVAANNYKPYIVTGSDDGFLKIWDLSKIEKGSTFKPVVNHELGSSIVDITFIANYDV 1096

Query: 298  LVVGTSDDS---FKTN 310
             VV  +D S   FK N
Sbjct: 1097 FVVSANDGSINLFKIN 1112

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 73/180 (40%), Gaps = 19/180 (10%)

Query: 114 GNYTFIASSWDGILQEIDMQ-DNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLN 172
           GNY  +++SWD  L+  ++   N+  R      +   +A+D  ++ +I A   K IR  N
Sbjct: 78  GNYA-VSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWN 136

Query: 173 LPLNNNDRGEVTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCH 232
                 D   V    T    +VR     LE DG V    DGR+    F     +   R  
Sbjct: 137 TV---GDCAYVLLGHTDWVTKVRVAPKNLE-DGEVD---DGRIT---FVSAGMDKIVRSW 186

Query: 233 RMN----LVDMQFVFP---VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNE 285
            +N     ++  F+     +N +  SP   L  + G DG + +WNL+       F   +E
Sbjct: 187 SLNEDSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDE 246

>KLLA0A01650g complement(146030..147235) similar to sp|Q02793
           Saccharomyces cerevisiae YGL213c SKI8 antiviral protein
           of the beta-transducin (WD-40) repeat family singleton,
           start by similarity
          Length = 401

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 6/56 (10%)

Query: 245 VNSLAFSPASHLLFTG---GSDGCVSLWNLETHKKIKQF--PKF-NENSVVKLACN 294
           +  + FSPA  LL      GS GCVSL+  E  ++I  F  P   N+ ++   A N
Sbjct: 240 IRDIKFSPAGSLLAVAHDSGSYGCVSLYETEFGERIGNFTVPTHGNQTTIASYAHN 295

>CAGL0L04950g complement(562491..564908) highly similar to sp|Q04660
           Saccharomyces cerevisiae YMR049c, start by similarity
          Length = 805

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%)

Query: 223 DSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKI 277
           D R F  RC   + +       + +L+  P    L TG  DG V +W + T +++
Sbjct: 420 DLRPFPIRC---STIYSGHEGKIRTLSIDPTGIWLATGSDDGSVRIWEILTGREV 471

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 1/64 (1%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVV-GTS 303
           V+++ F+    +LF+   DG V  W+L  ++  + F          LA +    VV   S
Sbjct: 386 VSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAGS 445

Query: 304 DDSF 307
           +DSF
Sbjct: 446 EDSF 449

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNEN-SVVKLACNEDILVVGTS 303
           +N+LA+SP    + T   DG + +W++ +   +  F +   + + V+ A N  I+   + 
Sbjct: 359 LNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQFAKNGQIMFSSSL 418

Query: 304 DDSFKT 309
           D + K 
Sbjct: 419 DGTVKA 424

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNED--ILVVGT 302
           VN +AFSP    + +   D  + LWN    K I  F + +  SV ++A + D  +LV  +
Sbjct: 405 VNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTF-RGHVASVYQVAWSSDCRLLVSCS 463

Query: 303 SDDSFK 308
            D + K
Sbjct: 464 KDTTLK 469

>Scas_595.3*
          Length = 555

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 256 LLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVK 290
           LL  GG+D   SLWN+   +  K+F   N  + VK
Sbjct: 377 LLAVGGNDNSCSLWNITDSEIPKKFFTLNHTAAVK 411

>Scas_702.16
          Length = 816

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF 280
           +  + ++P S LL + G D  V +WN  T +K+K+F
Sbjct: 140 IQDICWAPDSSLLVSVGLDRAVIIWNGITFEKLKRF 175

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/107 (17%), Positives = 45/107 (42%), Gaps = 11/107 (10%)

Query: 183 VTEVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNL-VDMQF 241
           ++ +E    Y++  + ++ +G    T  +DG++ +   +   +       +  + +D + 
Sbjct: 9   LSHIEESRSYEIYTVDVSPDGKRVATGGLDGKIRIWSVDSIKQIVKILSLKDEVPIDKEL 68

Query: 242 VFPVNS----------LAFSPASHLLFTGGSDGCVSLWNLETHKKIK 278
             P+ S          L FSP    L +G  D  + +W L+  + I+
Sbjct: 69  KKPLASMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQ 115

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 12/80 (15%)

Query: 229 FRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV 288
           F+ H   ++ +QF +            LLFTG  D  V++W+L T K I++    ++  V
Sbjct: 330 FKGHMDGVLTLQFNY-----------RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSD-GV 377

Query: 289 VKLACNEDILVVGTSDDSFK 308
             L  ++  L+ G+ D + +
Sbjct: 378 KTLYFDDQKLITGSLDKTIR 397

>Kwal_23.4671
          Length = 423

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 51/107 (47%), Gaps = 13/107 (12%)

Query: 77  YVGTVQGEIFLVDFEN------SDFKPVLGNSTQLGVSKMVNVGN--YTFIASSWDGILQ 128
           Y+GT + +IF +D  +      +D K +  ++   GV++++   N  + F+       ++
Sbjct: 243 YMGTYKCDIFAIDTRSGQPELVADRKALGSDAGPAGVTQLLLSANKHFMFVVKRNSNKIE 302

Query: 129 EIDMQ-----DNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRW 170
            +D +      N +I  + + N     ++D VN LLI    GK ++W
Sbjct: 303 VLDTRFSFTKVNELILPSWIGNQKFKASLDQVNGLLIGTSDGKLLQW 349

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
           (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 29.3 bits (64), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 16/63 (25%)

Query: 131 DMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEVTEVETGL 190
           D Q+  VI+ TK  +N       C   +L + L   ++ WL+LPLN       + VE G 
Sbjct: 325 DRQETLVIKVTKPTDN-------CTLGILTIIL---RLTWLSLPLNE------SAVELGS 368

Query: 191 KYQ 193
           +Y+
Sbjct: 369 QYE 371

>YGL213C (SKI8) [1783] chr7 complement(90057..91250) Protein
           involved in meiotic recombination and in protection from
           double-stranded RNA (dsRNA) viruses, member of the WD
           (WD-40) repeat family [1194 bp, 397 aa]
          Length = 397

 Score = 28.9 bits (63), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 10/72 (13%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSD 304
           V SL+F+ +   L + G DG +  W+++T ++I       ++    +   EDIL V    
Sbjct: 294 VMSLSFNDSGETLCSAGWDGKLRFWDVKTKERITTLNMHCDD----IEIEEDILAVDEHG 349

Query: 305 DSFKTNAVVAEP 316
           DS      +AEP
Sbjct: 350 DS------LAEP 355

>Scas_442.2*
          Length = 795

 Score = 29.3 bits (64), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 245 VNSLAF----SPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLA 292
           + SLAF    +P  +LL +G  D  + LW +  +  +K+  + +E+   KLA
Sbjct: 211 IKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLMKKQDEDDEDIATKLA 262

>YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component of
           U3 snoRNP (also called small subunit processome) which
           is required for 18S rRNA biogenesis, required for
           pre-rRNA processing [1722 bp, 573 aa]
          Length = 573

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 3/69 (4%)

Query: 247 SLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFP-KFNENSVVKLA--CNEDILVVGTS 303
           ++A SP    + TGG D  + +W+ E+   +K  P K     V+ LA   N D L    +
Sbjct: 241 TVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEVLSLAFRKNSDQLYASCA 300

Query: 304 DDSFKTNAV 312
           D   +T ++
Sbjct: 301 DFKIRTYSI 309

>Scas_711.46
          Length = 594

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNL 271
           V S+AFSP   ++  G   G V LW L
Sbjct: 565 VTSVAFSPRGEMIAVGNEQGKVRLWRL 591

>Kwal_27.12586
          Length = 509

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 234 MNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETH-KKIKQFPKFNENSVVKLA 292
           +N+ D      V  L +SP      TG   G + LW   TH  K++    F+++S+V + 
Sbjct: 198 INVADASSSCDVTCLEWSPKGDSFLTGVESGEIRLW---THDAKLQNAFDFHKSSIVTIK 254

Query: 293 CNED 296
            N D
Sbjct: 255 WNSD 258

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 28.9 bits (63), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 40/95 (42%), Gaps = 8/95 (8%)

Query: 227 FAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNEN 286
           F+   H   + D QF         +   H L T GSDG + +W+++T  ++  +      
Sbjct: 271 FSLLGHSNRVKDFQFYH-------NKFGHYLVTIGSDGRIVVWDMKTRDQVAVYDCGERL 323

Query: 287 SVVKLACNEDILVVGTSDDSFKTNAVVAEPLELQS 321
           + V + C+E I    T          V EP ++++
Sbjct: 324 NCVAV-CDESIEKYDTVKKRAPEEVEVGEPSDVEA 357

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSD 304
           V  L ++PA   L TG   G + LW++E   K++    ++   +V +  N D   V T D
Sbjct: 197 VTCLEWAPAGQSLLTGVESGELRLWSVE--GKLQNILSYHRAPIVCIKWNSDETHVLTCD 254

>ACL099W [950] [Homologous to ScYKL018W (SWD2) - SH]
           complement(165316..166389) [1074 bp, 357 aa]
          Length = 357

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 19/45 (42%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVV 289
           V+ LA SP      +   D  V LW+L T K     P    NSV 
Sbjct: 145 VSDLAMSPLDDTFLSASYDESVRLWDLRTSKAQAIVPSVVPNSVA 189

>Scas_603.5
          Length = 589

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 257 LFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSD 304
           L TG  DG + LW+L + K ++   K ++  +  L  +   ++ G++D
Sbjct: 454 LATGSKDGIIRLWDLRSGKVVRTLLK-HQGPITSLQFDSTKIITGSTD 500

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 44/103 (42%), Gaps = 5/103 (4%)

Query: 207 VTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCV 266
           +T+S D   A+       R   F  H  +++ M    P N+  +    H   TGGSDG  
Sbjct: 190 LTASGDMTCAMWDIPKSKRVTEFIDHLGDVLTMDLP-PANTGRYG---HNFITGGSDGYA 245

Query: 267 SLWNLETHKKIKQFPKFNEN-SVVKLACNEDILVVGTSDDSFK 308
            LW++      + F   + + S +K   N +  + G+ D S +
Sbjct: 246 YLWDVRQPNSAQSFFISDSDVSAIKFFNNGESFMAGSDDGSAR 288

>Kwal_47.17567
          Length = 590

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 42/199 (21%), Positives = 82/199 (41%), Gaps = 24/199 (12%)

Query: 85  IFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIASSWDGILQEIDMQDNAVIRTTKLE 144
           IFL D   ++   +     +      V  G++  +  + +G++   D++    IRT    
Sbjct: 309 IFLTDNNTNEVTQLSTTDNEYTSLSWVGAGSHLAVGQT-NGLVNIFDVEKKKCIRTIPGH 367

Query: 145 NNTKVLAMDCVNNLLILALTGKKI--RWLNLPLNNNDRGEVTEVET-GLKYQVRDIKLTL 201
            + +V  +   N++L      ++I  R +  P ++ +       E  GLK+ V D KL  
Sbjct: 368 ID-RVACLSWNNHILTSGSRDRRILHRDVRTPQSSFEEIRTHNQEVCGLKWNVEDNKLAS 426

Query: 202 EGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASH-LLFTG 260
            G+       DG   + + + +    A                V ++A+SP    +L TG
Sbjct: 427 GGNDNAVFVYDGTSRLPFLKLEEHTAA----------------VKAMAWSPHRRGILATG 470

Query: 261 G--SDGCVSLWNLETHKKI 277
           G  +D  + +WN++T  K+
Sbjct: 471 GGTADKRLKIWNVKTSVKL 489

>Kwal_23.5769
          Length = 627

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 11/52 (21%)

Query: 229 FRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF 280
           F+ H   ++ +QF +            LLFTG  D  V++W+L T K +++ 
Sbjct: 313 FKGHMDGVLSLQFNY-----------RLLFTGSYDSTVAIWDLATGKLVRRL 353

>Kwal_55.21559
          Length = 351

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 2/33 (6%)

Query: 242 VFPVNSLAFSPA--SHLLFTGGSDGCVSLWNLE 272
           ++ +N + ++    S LL TGG DGC ++W+ +
Sbjct: 318 IYEINVVKWATVDDSVLLLTGGDDGCANIWSFK 350

>Sklu_1710.1 YDR267C, Contig c1710 17-739
          Length = 240

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 242 VFPVNSLAFSP--ASHLLFTGGSDGCVSLWNLE 272
           V+  N + ++      LL TGG DGCV++W  E
Sbjct: 208 VYETNVVKWTQIDGETLLVTGGDDGCVNIWKNE 240

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 28.5 bits (62), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 12/78 (15%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSV-----------VKLA 292
           P+N +  +P    + +  +D  V LW++   K +K     ++ SV           V  A
Sbjct: 268 PINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKVL-THHKRSVRATALHPKEFSVASA 326

Query: 293 CNEDILVVGTSDDSFKTN 310
           C +DI   G ++ S  TN
Sbjct: 327 CTDDIRSWGLAEGSLLTN 344

>YER082C (UTP7) [1514] chr5 complement(324268..325932) Component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, has one WD (WD-40)
           domain [1665 bp, 554 aa]
          Length = 554

 Score = 28.5 bits (62), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 21/34 (61%)

Query: 244 PVNSLAFSPASHLLFTGGSDGCVSLWNLETHKKI 277
           PVNS+A   + + + T G+D  + +W++   K++
Sbjct: 276 PVNSIAIDRSGYYMATTGADRSMKIWDIRNFKQL 309

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 28.5 bits (62), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 257 LFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSDDSFK 308
           L TG  DG V LW+L + + ++   + + ++V  L  +   LV G+ D+S +
Sbjct: 580 LATGTKDGIVRLWDLRSGRVVRTL-EGHSDAVTSLQFDSLNLVTGSLDNSIR 630

>Kwal_56.24163
          Length = 729

 Score = 28.5 bits (62), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 9/69 (13%)

Query: 207 VTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCV 266
           +TSS D  V +  ++  S       H  N         V+   F P+  ++ +G  DG +
Sbjct: 59  ITSSDDRTVKIWDYQTKSCVATLEGHMAN---------VSYAVFHPSLPIILSGSEDGTL 109

Query: 267 SLWNLETHK 275
            +WN  T+K
Sbjct: 110 KVWNSNTYK 118

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 10/36 (27%), Positives = 22/36 (61%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQF 280
           +  + ++P S ++ + G D  + +WN  T +K+K+F
Sbjct: 137 IQDICWAPDSSIMVSVGLDRAIIIWNGSTFEKVKRF 172

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSD 304
           V  L++SP+   L TG  +G + +W+      ++    F+ + VV +  N D   V TSD
Sbjct: 210 VTCLSWSPSGESLITGVENGELRMWSF--RGILQNVFNFHRSPVVSIEWNADSTHVLTSD 267

>YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible
           component of a glycogen synthase kinase, homozygous
           diploid null mutant accumulates glycogen [4026 bp, 1341
           aa]
          Length = 1341

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 245 VNSLAFSPA-SHLLFTGGSDGCVSLWNL 271
           +NS  F+   S+L+ +GG D CV +W+L
Sbjct: 261 INSFDFNMVESNLIISGGQDSCVKIWDL 288

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,800,667
Number of extensions: 459690
Number of successful extensions: 2001
Number of sequences better than 10.0: 174
Number of HSP's gapped: 1970
Number of HSP's successfully gapped: 220
Length of query: 330
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 228
Effective length of database: 13,065,073
Effective search space: 2978836644
Effective search space used: 2978836644
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)