Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_617.558158130470.0
YGR194C (XKS1)60058819590.0
CAGL0G09339g58258918400.0
Sklu_2014.363158017880.0
Kwal_33.1543858058117490.0
KLLA0E09746g58058117050.0
AGR324C56458515040.0
Sklu_2427.251879740.66
Kwal_33.1489097565666.0
CAGL0F08723g31647648.5
YJL100W (LSB6)607107659.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_617.5
         (581 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_617.5                                                           1178   0.0  
YGR194C (XKS1) [2144] chr7 complement(886076..887878) Xylulokina...   759   0.0  
CAGL0G09339g 891248..892996 similar to sp|P42826 Saccharomyces c...   713   0.0  
Sklu_2014.3 YGR194C, Contig c2014 3590-5485 reverse complement        693   0.0  
Kwal_33.15438                                                         678   0.0  
KLLA0E09746g 863295..865037 similar to sp|P42826 Saccharomyces c...   661   0.0  
AGR324C [4635] [Homologous to ScYGR194C (XKS1) - SH] (1335916..1...   583   0.0  
Sklu_2427.2 YOR374W, Contig c2427 1739-3295                            33   0.66 
Kwal_33.14890                                                          30   6.0  
CAGL0F08723g 864757..865707 similar to sp|P33412 Saccharomyces c...    29   8.5  
YJL100W (LSB6) [2815] chr10 (237180..239003) Phosphatidylinosito...    30   9.3  

>Scas_617.5
          Length = 581

 Score = 1178 bits (3047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/581 (97%), Positives = 566/581 (97%)

Query: 1   MSEPSYYLGLDLSTQQLKGLAINETLEIVVTETVDFDKELPHYNTTKGVYINGNDIECPV 60
           MSEPSYYLGLDLSTQQLKGLAINETLEIVVTETVDFDKELPHYNTTKGVYINGNDIECPV
Sbjct: 1   MSEPSYYLGLDLSTQQLKGLAINETLEIVVTETVDFDKELPHYNTTKGVYINGNDIECPV 60

Query: 61  GMWLEALDLLFEKFKKKGFSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKSLVS 120
           GMWLEALDLLFEKFKKKGFSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKSLVS
Sbjct: 61  GMWLEALDLLFEKFKKKGFSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKSLVS 120

Query: 121 HLIPDAFSRQTAPNWQDHSTGSQCQSFERKVGGPQALAEITGSRAHFRFTGPQIMKIAEK 180
           HLIPDAFSRQTAPNWQDHSTGSQCQSFERKVGGPQALAEITGSRAHFRFTGPQIMKIAEK
Sbjct: 121 HLIPDAFSRQTAPNWQDHSTGSQCQSFERKVGGPQALAEITGSRAHFRFTGPQIMKIAEK 180

Query: 181 EPGNYANXXXXXXXXXXXXXXXCGELTPLEEADSCGMNLYDIRKRQFNEDLLSLIDSNED 240
           EPGNYAN               CGELTPLEEADSCGMNLYDIRKRQFNEDLLSLIDSNED
Sbjct: 181 EPGNYANTSSVSLVSSFITSLLCGELTPLEEADSCGMNLYDIRKRQFNEDLLSLIDSNED 240

Query: 241 NIRTKLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLATICSLPLKTNDVL 300
           NIRTKLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLATICSLPLKTNDVL
Sbjct: 241 NIRTKLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLATICSLPLKTNDVL 300

Query: 301 VSLGTSTTILLVTNQYQPSPNYHLFIHPTIPDHYMGMICYCNGALAREKIRDELNETGEG 360
           VSLGTSTTILLVTNQYQPSPNYHLFIHPTIPDHYMGMICYCNGALAREKIRDELNETGEG
Sbjct: 301 VSLGTSTTILLVTNQYQPSPNYHLFIHPTIPDHYMGMICYCNGALAREKIRDELNETGEG 360

Query: 361 NSWNLFNEAVLDDTIDNSDELGIYFPLGEIVPSVSAIYKRAKFDKATGEIKAIVDEFANK 420
           NSWNLFNEAVLDDTIDNSDELGIYFPLGEIVPSVSAIYKRAKFDKATGEIKAIVDEFANK
Sbjct: 361 NSWNLFNEAVLDDTIDNSDELGIYFPLGEIVPSVSAIYKRAKFDKATGEIKAIVDEFANK 420

Query: 421 KHDAKNIVESQALSCRIRISPLLSKEGNSNKNEMTSNENGTVKFDYAEIPISDYLSKRPN 480
           KHDAKNIVESQALSCRIRISPLLSKEGNSNKNEMTSNENGTVKFDYAEIPISDYLSKRPN
Sbjct: 421 KHDAKNIVESQALSCRIRISPLLSKEGNSNKNEMTSNENGTVKFDYAEIPISDYLSKRPN 480

Query: 481 RAFFVGGASKNDAIVKKFAQIIGAQEGNYRLETPNSCALGGCYKAIWSQLYHLGETKESF 540
           RAFFVGGASKNDAIVKKFAQIIGAQEGNYRLETPNSCALGGCYKAIWSQLYHLGETKESF
Sbjct: 481 RAFFVGGASKNDAIVKKFAQIIGAQEGNYRLETPNSCALGGCYKAIWSQLYHLGETKESF 540

Query: 541 DVYLDKHFPWGEVERICEPDEKAWELYNKKIVPMSHLEALL 581
           DVYLDKHFPWGEVERICEPDEKAWELYNKKIVPMSHLEALL
Sbjct: 541 DVYLDKHFPWGEVERICEPDEKAWELYNKKIVPMSHLEALL 581

>YGR194C (XKS1) [2144] chr7 complement(886076..887878) Xylulokinase,
           required for growth on D-xylulose [1803 bp, 600 aa]
          Length = 600

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/588 (61%), Positives = 447/588 (76%), Gaps = 12/588 (2%)

Query: 1   MSEPSYYLGLDLSTQQLKGLAINETLEIVVTETVDFDKELPHYNTTKGVYINGNDIECPV 60
           MS  SYYLG DLSTQQLK LAIN+ L+IV +ETV+F+K+LPHY+T KGVYI+G+ IECPV
Sbjct: 17  MSLDSYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYHTKKGVYIHGDTIECPV 76

Query: 61  GMWLEALDLLFEKFKKKGFSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKSLVS 120
            MWLEALDL+  K+++  F LN V A+SGSCQQHGSVYWS  A +LL+ L    +K L+ 
Sbjct: 77  AMWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAESLLEQLNKKPEKDLLH 136

Query: 121 HLIPDAFSRQTAPNWQDHSTGSQCQSFERKVGGPQALAEITGSRAHFRFTGPQIMKIAEK 180
           ++   AF+RQTAPNWQDHST  QCQ FE  +GGP+ +A++TGSRAHFRFTGPQI+KIA+ 
Sbjct: 137 YVSSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSRAHFRFTGPQILKIAQL 196

Query: 181 EPGNYANXXXXXXXXXXXXXXXCGELTPLEEADSCGMNLYDIRKRQFNEDLLSLIDSN-- 238
           EP  Y                  G L  LEEAD+CGMNLYDIR+R+F+++LL LIDS+  
Sbjct: 197 EPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRERKFSDELLHLIDSSSK 256

Query: 239 EDNIRTKLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLATICSLPLKTND 298
           +  IR KLM  P+   K +  G+I KYF++KYGFN +C + P+TGDNLATICSLPL+ ND
Sbjct: 257 DKTIRQKLMRAPM---KNLIAGTICKYFIEKYGFNTNCKVSPMTGDNLATICSLPLRKND 313

Query: 299 VLVSLGTSTTILLVTNQYQPSPNYHLFIHPTIPDHYMGMICYCNGALAREKIRDELNETG 358
           VLVSLGTSTT+LLVT++Y PSPNYHLFIHPT+P+HYMGMICYCNG+LARE+IRDELN+  
Sbjct: 314 VLVSLGTSTTVLLVTDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSLARERIRDELNKER 373

Query: 359 EG-----NSWNLFNEAVLDDTIDNSDELGIYFPLGEIVPSVSAIYKRAKFDKATGEIKAI 413
           E      N W LFN+AVLDD+  + +ELG+YFPLGEIVPSV AI KR  F+  TG I+  
Sbjct: 374 ENNYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKRVIFNPKTGMIERE 433

Query: 414 VDEFANKKHDAKNIVESQALSCRIRISPLLSKEGNSNKNEMTSNENGTVKFDYAEIPISD 473
           V +F +K+HDAKNIVESQALSCR+RISPLLS    S++  +  NE+  VKFDY E P+ D
Sbjct: 434 VAKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRL--NEDTIVKFDYDESPLRD 491

Query: 474 YLSKRPNRAFFVGGASKNDAIVKKFAQIIGAQEGNYRLETPNSCALGGCYKAIWSQLYHL 533
           YL+KRP R FFVGGASKNDAIVKKFAQ+IGA +GN+RLETPNSCALGGCYKA+WS LY  
Sbjct: 492 YLNKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGCYKAMWSLLYDS 551

Query: 534 GETKESFDVYLDKHFPWGEVERICEPDEKAWELYNKKIVPMSHLEALL 581
            +    FD +L+ +FPW  +E I + D + W+ YN KIVP+S LE  L
Sbjct: 552 NKIAVPFDKFLNDNFPWHVMESISDVDNENWDRYNSKIVPLSELEKTL 599

>CAGL0G09339g 891248..892996 similar to sp|P42826 Saccharomyces
           cerevisiae YGR194c XKS1 xylulokinase, start by
           similarity
          Length = 582

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/589 (59%), Positives = 431/589 (73%), Gaps = 16/589 (2%)

Query: 1   MSEPSYYLGLDLSTQQLKGLAINETLEIVVTETVDFDKELPHYNTTKGVYINGNDIECPV 60
           M    YYLGLDLSTQQLK LAI+  ++I  TE VDFD++LPHYNT KGVY +G+ +ECPV
Sbjct: 1   MQGEGYYLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYNTHKGVYSHGDVVECPV 60

Query: 61  GMWLEALDLLFEKFKKKGFSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKSLVS 120
           GMWLEA+DL+FEK+K  GF L+ V+AISGSCQQHGSVYW   A  LLK+L +D + +LV 
Sbjct: 61  GMWLEAIDLVFEKYKGAGFDLSQVKAISGSCQQHGSVYWKTGAGDLLKHL-NDANGNLVD 119

Query: 121 HLIPDAFSRQTAPNWQDHSTGSQCQSFERKVGGPQALAEITGSRAHFRFTGPQIMKIAEK 180
            L PD FSR+TAPNWQDHSTG QC   E+K GGP+ LAEITGSRAHFRFTGPQIMKIAE 
Sbjct: 120 QLYPDGFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFTGPQIMKIAEN 179

Query: 181 EPGNYANXXXXXXXXXXXXXXXCGELTPLEEADSCGMNLYDIRKRQFNEDLLSLIDSN-- 238
           E  NY N               C +L P+EEAD+CGMN+YDI+ +++++ LL +I     
Sbjct: 180 EEDNYKNTETISLVSSFLTSILCAKLVPIEEADACGMNIYDIKAKRYDDSLLDVISGKFG 239

Query: 239 EDNIRTKLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLATICSLPLKTND 298
           ++++  KL     KC+ P  +G+I+ YFV KYGF+  C+I+P TGDNLATICSLPL+ ND
Sbjct: 240 KEDLLKKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKND 299

Query: 299 VLVSLGTSTTILLVTNQYQPSPNYHLFIHPTIPDHYMGMICYCNGALAREKIRDELNETG 358
           +LVSLGTSTTIL+VT+QY PSPNYHLF HP I + YM MICYCNG+LAREK+RD LNE  
Sbjct: 300 ILVSLGTSTTILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLNEN- 358

Query: 359 EGNSWNLFNEAVLDDTIDNSDELGIYFPLGEIVPSVSAIYKRAKFDKATGEIKAIVDEFA 418
           +  SW  F+EAVLD+++D S EL +YFPLGEIVPSV AI KR  +D    EI   VD+F 
Sbjct: 359 QSTSWTNFDEAVLDESLDTSGELAVYFPLGEIVPSVDAITKRVLYDPKNCEIVKYVDKFD 418

Query: 419 NKKHDAKNIVESQALSCRIRISPLLS---KEGNSNKNEMTSNENGTVKFDYAEIPISDYL 475
           N +HDAK IVESQALS R+R++PLLS    E N  K+E        V FDY  +  S+Y 
Sbjct: 419 NNRHDAKIIVESQALSARVRVAPLLSGTVDESNDEKSET------MVHFDYDSMKFSEYS 472

Query: 476 SKRPNRAFFVGGASKNDAIVKKFAQIIGAQEGNYRLETPNSCALGGCYKAIWSQLYHLGE 535
           SKRPNR +FVGGASKNDAIVKKF++++GA+ GN+RLETPNSCALGGC+KA+WS L+   +
Sbjct: 473 SKRPNRVYFVGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKK 532

Query: 536 TKE--SFDVYLDKHFPWGEVERICEPD-EKAWELYNKKIVPMSHLEALL 581
             E  +FD +L+++FP  E+E I   D  K WE Y  KI+P+S LE  L
Sbjct: 533 IDEKVTFDSFLNRYFPTDELEEIKVDDITKKWEAYKDKIIPLSKLEEEL 581

>Sklu_2014.3 YGR194C, Contig c2014 3590-5485 reverse complement
          Length = 631

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/580 (58%), Positives = 423/580 (72%), Gaps = 12/580 (2%)

Query: 6   YYLGLDLSTQQLKGLAINETLEIVVTETVDFDKELPHYNTTKGVYINGN-DIECPVGMWL 64
           Y+LG DLSTQQLK L +++ L++V +E VDFD++LP Y+T KGVY N +  IE PV MW 
Sbjct: 59  YFLGFDLSTQQLKCLVVDQQLQLVHSEVVDFDRDLPEYHTHKGVYFNDDGSIEAPVAMWC 118

Query: 65  EALDLLFEKFKKKG-FSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKSLVSHLI 123
           +ALD LF     +  FSL+ V  ISGSCQQHGSVYWS++    L+NL  D  ++L++ L 
Sbjct: 119 DALDHLFAGLANQNVFSLDRVLGISGSCQQHGSVYWSKDGEEALRNL--DAQQTLLTQLA 176

Query: 124 PDAFSRQTAPNWQDHSTGSQCQSFERKVGGPQALAEITGSRAHFRFTGPQIMKIAEKEPG 183
           P AFSR  APNWQDHSTG++C+ FE   GGPQ LA ITGSRAH+RFTGPQI K+A +EP 
Sbjct: 177 PKAFSRSVAPNWQDHSTGNECKLFESSCGGPQGLAAITGSRAHYRFTGPQICKVAHREPE 236

Query: 184 NYANXXXXXXXXXXXXXXXCGELTPLEEADSCGMNLYDIRKRQFNEDLLSLIDSNEDNIR 243
            YAN               CG + PLEEAD+CGMNLYDI  R ++  LL  ID + ++I+
Sbjct: 237 VYANTANITLVSNFLASLLCGYIAPLEEADACGMNLYDIVNRDYDSGLLQNIDPDVESIK 296

Query: 244 TKLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLATICSLPLKTNDVLVSL 303
            KL   P   D    L  +S Y+V++YG NP C +FP TGDNLATICSLPLK NDVLVSL
Sbjct: 297 RKLKGSPTPADNAGPLSCVSSYYVRRYGLNPQCQVFPFTGDNLATICSLPLKKNDVLVSL 356

Query: 304 GTSTTILLVTNQYQPSPNYHLFIHPTIPDHYMGMICYCNGALAREKIRDELNETGEGNSW 363
           GTSTTIL+VT+QY PSPNYHLFIHPTIP  YMGMICYCNG+LARE +RD L+     +SW
Sbjct: 357 GTSTTILIVTDQYYPSPNYHLFIHPTIPGLYMGMICYCNGSLARENVRDLLS---ADHSW 413

Query: 364 NLFNEAVLDDTIDNSDELGIYFPLGEIVPSVSAIYKRAKFDKATGEIK-AIVDEFANKKH 422
           + FN+A+LD ++DN DE+G+YFPL EIVPSV +  KRAKF K+  +I    V++F++ KH
Sbjct: 414 DPFNKALLDSSVDNHDEIGVYFPLSEIVPSVRSCTKRAKFTKSDNDINLEPVEQFSDIKH 473

Query: 423 DAKNIVESQALSCRIRISPLLSKEGNSNKNEMTSNENGTVKFDYAEIPISDYLSKRPNRA 482
           D KNIVESQALSCR+RISPLLS    +  N   S+ + TVKFDY   PIS+Y  KRP RA
Sbjct: 474 DVKNIVESQALSCRVRISPLLSDNCAAASN--NSSTSYTVKFDYDTFPISEY-RKRPRRA 530

Query: 483 FFVGGASKNDAIVKKFAQIIGAQEGNYRLETPNSCALGGCYKAIWSQLYHLGETKESFDV 542
           FFVGGAS+NDAIV+ FAQ+IGA EGNY+LETPNSCALGGCYKA+WS +Y  G TK SFD+
Sbjct: 531 FFVGGASRNDAIVRTFAQVIGATEGNYKLETPNSCALGGCYKALWSYMYSGGFTKLSFDL 590

Query: 543 YLDKHFPW-GEVERICEPDEKAWELYNKKIVPMSHLEALL 581
           +L++HF W  + E IC+ + ++WE YN KI  +S LEA L
Sbjct: 591 FLNEHFDWQHDAEFICDSETESWEYYNTKIQALSALEATL 630

>Kwal_33.15438
          Length = 580

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/581 (58%), Positives = 420/581 (72%), Gaps = 15/581 (2%)

Query: 7   YLGLDLSTQQLKGLAINETLEIVVTETVDFDKELPHYNTTKGVYINGN-DIECPVGMWLE 65
           YLG DLSTQQLK L I++ L+++ +E+++FDK+L  Y T KGVY+  +  +ECPV MWLE
Sbjct: 9   YLGFDLSTQQLKCLVIDQDLKLLHSESIEFDKDLSSYKTEKGVYLRDDGTVECPVAMWLE 68

Query: 66  ALDLLFEKFKK-KGFSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKSLVSHLIP 124
           ALDL+F++  + K   L +VRA+SGSCQQHGSVYW++    LL  L  D  +SL   L P
Sbjct: 69  ALDLVFQRMSENKDVDLGSVRAMSGSCQQHGSVYWAEEGPKLLPTL--DFKQSLKDQLFP 126

Query: 125 DAFSRQTAPNWQDHSTGSQCQSFERKVGGPQALAEITGSRAHFRFTGPQIMKIAEKEPGN 184
           DAFSR  APNWQDHSTGS+CQ FE  VGGP  LA +TGSRAH RFTGPQ+MKI++KEP  
Sbjct: 127 DAFSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHHRFTGPQMMKISKKEPEV 186

Query: 185 YANXXXXXXXXXXXXXXXCGELTPLEEADSCGMNLYDIRKRQFNEDLLSLIDSNEDNIRT 244
           Y                  GE T LEEAD+CGMNLY+I KR + ++LL  ID +   +R 
Sbjct: 187 YRKTAKISLVSSFLASVLAGEFTSLEEADACGMNLYNIDKRDYEDNLLRNIDDDLSGLRE 246

Query: 245 KLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLATICSLPLKTNDVLVSLG 304
           KL   P+ CDKP  +GSIS YFVQKYG N  C +FP TGDNLATICSL LK NDVLVSLG
Sbjct: 247 KLGGAPINCDKPTPVGSISSYFVQKYGLNADCQVFPFTGDNLATICSLRLKPNDVLVSLG 306

Query: 305 TSTTILLVTNQYQPSPNYHLFIHPTIPDHYMGMICYCNGALAREKIRDELNETGEGNSWN 364
           TSTTILLVT+QY PSPNYHLFIHPTIP HYMGMICYCNGALAREKIRD+L+++   + W 
Sbjct: 307 TSTTILLVTDQYHPSPNYHLFIHPTIPKHYMGMICYCNGALAREKIRDQLSDS---HDWE 363

Query: 365 LFNEAVLDDTIDNSDELGIYFPLGEIVPSVSAIYKRAKFDKA-TGE-IKA-IVDEFANKK 421
            FN AV   TI+N +E+  YFPLGEIVP+V ++ +RA F+K+ TG+ +K  I++ FAN  
Sbjct: 364 PFNAAVTSTTIENDNEIACYFPLGEIVPNVPSVCRRATFEKSETGDSVKLNILESFANVA 423

Query: 422 HDAKNIVESQALSCRIRISPLLSKEGNSNKNEMTSNENGTVKFDYAEIPISDYLSKRPNR 481
           HDA+NIVESQALSCR+RISPLLS +     +EM  ++   V FDY   P+S+Y  KRP R
Sbjct: 424 HDARNIVESQALSCRVRISPLLSSDCTDTNSEMGDSK---VLFDYDNFPLSEY-RKRPRR 479

Query: 482 AFFVGGASKNDAIVKKFAQIIGAQEGNYRLETPNSCALGGCYKAIWSQLYHLGETKESFD 541
           AFFVGGASKNDAIV  FAQ++GA +GN+RLETPNSCALGGCY+A+WS L++       FD
Sbjct: 480 AFFVGGASKNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNLISSPFD 539

Query: 542 VYLDKHFPWG-EVERICEPDEKAWELYNKKIVPMSHLEALL 581
            +L++ F W  +V+ +   DEK W+ YN KI  +S LE  L
Sbjct: 540 QFLNEAFRWDFDVQSLGLTDEKDWKHYNTKIQALSELEKTL 580

>KLLA0E09746g 863295..865037 similar to sp|P42826 Saccharomyces
           cerevisiae YGR194c XKS1 xylulokinase singleton, start by
           similarity
          Length = 580

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/581 (56%), Positives = 405/581 (69%), Gaps = 10/581 (1%)

Query: 1   MSEPSYYLGLDLSTQQLKGLAINETLEIVVTETVDFDKELPHYNTTKGVYINGND-IECP 59
           MSE  YYLG DLSTQQLK LAI++ L IV T  ++FDK+ PHYNT KGVYI     I+ P
Sbjct: 1   MSESGYYLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYNTRKGVYIKDEGVIDAP 60

Query: 60  VGMWLEALDLLFEKFKKKGFSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKSLV 119
           V MWLEA+DL FE+  K    L  V+++SGSCQQHG+V+W  N + L K+L   ++  LV
Sbjct: 61  VAMWLEAIDLCFERLGK-CIDLKKVKSMSGSCQQHGTVFW--NCDHLPKDLQPSSN--LV 115

Query: 120 SHLIPDAFSRQTAPNWQDHSTGSQCQSFERKVGGPQALAEITGSRAHFRFTGPQIMKIAE 179
             L    FSR  APNWQDHST  QC     KVGGPQ LA ITGS +H+RF+G QI K+ E
Sbjct: 116 KQL-ASCFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSSHYRFSGSQIAKVHE 174

Query: 180 KEPGNYANXXXXXXXXXXXXXXXCGELTPLEEADSCGMNLYDIRKRQFNEDLLSLIDSNE 239
            EP  YAN                G++ PLEEAD+CGMNLY I K +FNEDLLS++D + 
Sbjct: 175 TEPEVYANTKKISLVSSFLASVLVGDIVPLEEADACGMNLYGIEKHEFNEDLLSVVDEDI 234

Query: 240 DNIRTKLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLATICSLPLKTNDV 299
            +I+ KL DPP   D+P  LG +S YF +KYG NP C I+P TGDNLATICSLPL+ NDV
Sbjct: 235 ASIKRKLFDPPTSSDEPKSLGPVSTYFQEKYGVNPDCQIYPFTGDNLATICSLPLQKNDV 294

Query: 300 LVSLGTSTTILLVTNQYQPSPNYHLFIHPTIPDHYMGMICYCNGALAREKIRDELNETGE 359
           L+SLGTSTTILL+T+QY  SPNYHLFIHPT+P+HYMGMICYCNG+LAREKIRD++N   +
Sbjct: 295 LISLGTSTTILLITDQYHSSPNYHLFIHPTVPNHYMGMICYCNGSLAREKIRDDINGESQ 354

Query: 360 GNSWNLFNEAVLDDTIDNSDELGIYFPLGEIVPSVSAIYKRAKFDKATGEIKAI-VDEFA 418
            + W  FNEA+LD+++ N +E+G+YFPLGEIVP++ A+ KR  F     ++    V+ F 
Sbjct: 355 THDWTKFNEALLDNSLSNDNEIGLYFPLGEIVPNMDAVTKRCYFKYIDNKVVLTNVNMFP 414

Query: 419 NKKHDAKNIVESQALSCRIRISPLLSKEGNSNKNEMTSNENGTVKFDYAEIPISDYLSKR 478
           +K+ DAKNIVESQALSCR+RISPLLS+E N+            VKFDY   P++ Y +KR
Sbjct: 415 DKRLDAKNIVESQALSCRVRISPLLSEEANAINETQVLKSELKVKFDYDFFPLASY-AKR 473

Query: 479 PNRAFFVGGASKNDAIVKKFAQIIGAQEGNYRLETPNSCALGGCYKAIWSQLYHLGETKE 538
           PNRAFFVGGASKN+AI+K  A +IGA+ GNYRLET NSCALGGCYKA+WS L        
Sbjct: 474 PNRAFFVGGASKNEAIIKTMANVIGAKNGNYRLETANSCALGGCYKALWSLLKEQNPETP 533

Query: 539 SFDVYLDKHFPW-GEVERICEPDEKAWELYNKKIVPMSHLE 578
           SFD +L+  F W  + E +C  D   WE YN KI  +S +E
Sbjct: 534 SFDRWLNAFFNWERDCEFVCNSDAAKWENYNNKIRTLSEIE 574

>AGR324C [4635] [Homologous to ScYGR194C (XKS1) - SH]
           (1335916..1337610) [1695 bp, 564 aa]
          Length = 564

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/585 (52%), Positives = 387/585 (66%), Gaps = 25/585 (4%)

Query: 1   MSEPSYYLGLDLSTQQLKGLAINETLEIVVTETVDFDKELPHYNTTKGVYIN-GNDIECP 59
           M+E   YLG DLSTQQLK LAI+E L I  T  VDFD++L  Y T KGVY    N +E P
Sbjct: 1   MAESKLYLGFDLSTQQLKCLAIDEDLAIKCTAVVDFDRDLAGYETVKGVYTREDNVVESP 60

Query: 60  VGMWLEALDLLFEKFKKKGFSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKSLV 119
           V MWLEALDL FE+  ++   L  V AISGSCQQH SVYW+++  T ++ L  D+   L 
Sbjct: 61  VEMWLEALDLCFERLARE-VDLGAVEAISGSCQQHASVYWTEDVKTRIREL--DSRSGLR 117

Query: 120 SHLIPDAFSRQTAPNWQDHSTGSQCQSFERKVGGPQALAEITGSRAHFRFTGPQIMKIAE 179
           + L P   SR  APNWQDHST +Q + FE   GGPQ LA++TGS+AHFRFTG QI KI +
Sbjct: 118 AQLGP-CLSRANAPNWQDHSTEAQREQFEAHCGGPQELAQLTGSKAHFRFTGLQIKKIRD 176

Query: 180 KEPGNYANXXXXXXXXXXXXXXXCGELTPLEEADSCGMNLYDIRKRQFNEDLLSLIDSNE 239
            EP                     G+L P EEAD+CGM LY+I + ++ E LL ++D   
Sbjct: 177 TEPATLTATPSISLASSFLASVLVGKLVPPEEADACGMILYNIAQHRYVEGLLQMVD--- 233

Query: 240 DNIRTKLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLATICSLPLKTNDV 299
           D +  KL   P++CD    LG++S+YF +KYG N SC+I+ LTGDNLATICSLPL+ ND+
Sbjct: 234 DALFDKLCGNPVRCDNVRPLGTVSRYFKEKYGINTSCNIYQLTGDNLATICSLPLQKNDL 293

Query: 300 LVSLGTSTTILLVTNQYQPSPNYHLFIHPTIPDHYMGMICYCNGALAREKIRDELNETGE 359
           LVSLGTSTT+L VT +Y PSPNYH+FIHPTIP +YMGM+CYCNGALARE+I+D L   G+
Sbjct: 294 LVSLGTSTTVLAVTEKYSPSPNYHMFIHPTIPGNYMGMVCYCNGALARERIKDTL---GD 350

Query: 360 GNSWNLFNEAVLDDTIDNSDELGIYFPLGEIVPSVS-AIYKRAKFD-KATGEIKAIVDEF 417
            + W  F++A+ DD++D S ELG+YFPL EIVPSV   + KR +   K   E    V+ F
Sbjct: 351 ESGWAAFSKALEDDSVDTSAELGVYFPLPEIVPSVDHPLVKRVRISPKGLQE----VESF 406

Query: 418 ANKKHDAKNIVESQALSCRIRISPLLSKEGNSNKNEMTSNENGTVKFDYAEIPISDYLSK 477
           A+  HDAKNIVESQALSCR+R++PLLS           S+  G   FD  +  ++++ ++
Sbjct: 407 ASPAHDAKNIVESQALSCRVRVAPLLSTPPE------ISDTGGHAAFDGQQRDVAEF-TR 459

Query: 478 RPNRAFFVGGASKNDAIVKKFAQIIGAQEGNYRLETPNSCALGGCYKAIWSQLYHLGETK 537
           RPNR FFVGGASKNDAIV+    I+GA+ GNYRLET NSCALGGCYKA WS L +  +T 
Sbjct: 460 RPNRVFFVGGASKNDAIVRAMPNILGAKGGNYRLETSNSCALGGCYKAFWSDLLYKQKTN 519

Query: 538 ESFDVYLDKHFPWG-EVERICEPDEKAWELYNKKIVPMSHLEALL 581
            SF  +LD  F W  + + +C+ D + W     KI  +S LE  L
Sbjct: 520 ASFADWLDSVFKWDRDCKMLCKTDNRKWAASLGKIAALSRLEETL 564

>Sklu_2427.2 YOR374W, Contig c2427 1739-3295
          Length = 518

 Score = 33.1 bits (74), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 42/79 (53%), Gaps = 7/79 (8%)

Query: 336 GMICYCNGALAREKIRDELNETGEGNSWNL-FNEAVLDDTIDNSDELGIYFPLGEIVPSV 394
           G   Y N  +  +K+  EL     G S N+ F +A L + + N   LGIYF  GE+  + 
Sbjct: 273 GRHIYQNAGVNLKKVTLELG----GKSPNIIFADANLKEAVKNVI-LGIYFNSGEVCCAG 327

Query: 395 SAIY-KRAKFDKATGEIKA 412
           S +Y + + +DKA  EIKA
Sbjct: 328 SRVYVEESIYDKAVEEIKA 346

>Kwal_33.14890
          Length = 975

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 27/65 (41%)

Query: 58  CPVGMWLEALDLLFEKFKKKGFSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKS 117
            P G W E L  + +  +KKG   N V    G+   +     S+     L  LG DT  +
Sbjct: 416 APAGKWQEELKTVCQAHRKKGRRNNTVIVAEGALDNNLKPITSEEVKDALVELGLDTKIT 475

Query: 118 LVSHL 122
            + H+
Sbjct: 476 TLGHV 480

>CAGL0F08723g 864757..865707 similar to sp|P33412 Saccharomyces
           cerevisiae YGR007w MUQ1 choline phosphate
           cytidylyltransferase, start by similarity
          Length = 316

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 242 IRTKLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLAT 288
           I T   D   + D+ V L  ++KY   + G+ P C+++  T DN+  
Sbjct: 147 ILTGSRDHHSRPDEVVTLEELTKYSYDRDGYGPGCTVYRETLDNIVV 193

>YJL100W (LSB6) [2815] chr10 (237180..239003) Phosphatidylinositol
           4-kinase with a possible role in the regulation of actin
           cytoskeletal organization [1824 bp, 607 aa]
          Length = 607

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 48/107 (44%), Gaps = 10/107 (9%)

Query: 377 NSDELGIYFPLGEIVPSVSAIYKRAKFDKATGEIKAIVDEFANKKHDAKNIVESQALSCR 436
           N+DE    +PL  +   V   + R    K++GE      +  +K    +N+ +    S +
Sbjct: 294 NADEFFHKYPLPGMYSDVKHSFHR----KSSGE------DINHKPETTRNLTDETEPSKQ 343

Query: 437 IRISPLLSKEGNSNKNEMTSNENGTVKFDYAEIPISDYLSKRPNRAF 483
           I  SP+ ++   ++K E T +     + +  ++ I DY+ +  +R  
Sbjct: 344 INSSPISTESEENSKFEWTESSLSQFRLELEKLIILDYIMRNTDRGL 390

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,494,672
Number of extensions: 946421
Number of successful extensions: 2382
Number of sequences better than 10.0: 19
Number of HSP's gapped: 2400
Number of HSP's successfully gapped: 19
Length of query: 581
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 474
Effective length of database: 12,891,983
Effective search space: 6110799942
Effective search space used: 6110799942
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)