Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_617.479179138200.0
YGR196C (FYV8)8174759611e-117
CAGL0G09295g7674688961e-108
Kwal_33.154559144237222e-82
KLLA0D09603g8203885933e-65
ACR036C7542964502e-46
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_617.4
         (791 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_617.4                                                           1476   0.0  
YGR196C (FYV8) [2146] chr7 complement(889736..892189) Protein of...   374   e-117
CAGL0G09295g 887666..889969 similar to sp|P46949 Saccharomyces c...   349   e-108
Kwal_33.15455                                                         282   2e-82
KLLA0D09603g 811234..813696 weakly similar to sp|P46949 Saccharo...   233   3e-65
ACR036C [1084] [Homologous to ScYGR196C (FYV8) - SH] (423030..42...   177   2e-46

>Scas_617.4
          Length = 791

 Score = 1476 bits (3820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 737/791 (93%), Positives = 737/791 (93%)

Query: 1   MSSENVGRKKSHRWASASQATYDGADWNSSDSDEDHAISNEEAQPNVTKLPSLPKLNYTS 60
           MSSENVGRKKSHRWASASQATYDGADWNSSDSDEDHAISNEEAQPNVTKLPSLPKLNYTS
Sbjct: 1   MSSENVGRKKSHRWASASQATYDGADWNSSDSDEDHAISNEEAQPNVTKLPSLPKLNYTS 60

Query: 61  NEEEEEGKLTDNAEENGKLPNSEEEERPTLHITTEDETDRXXXXXXXXXXXXRTRRNSPM 120
           NEEEEEGKLTDNAEENGKLPNSEEEERPTLHITTEDETDR            RTRRNSPM
Sbjct: 61  NEEEEEGKLTDNAEENGKLPNSEEEERPTLHITTEDETDRSSSNNESKSSLNRTRRNSPM 120

Query: 121 RGVNTDLDNLMLQISKEMTPKLENEPVFPPRDSPTSASREGSTPFYNASSVIQQPNDARE 180
           RGVNTDLDNLMLQISKEMTPKLENEPVFPPRDSPTSASREGSTPFYNASSVIQQPNDARE
Sbjct: 121 RGVNTDLDNLMLQISKEMTPKLENEPVFPPRDSPTSASREGSTPFYNASSVIQQPNDARE 180

Query: 181 GEREVNEXXXXXXXXXXYELSKNGYFSDYMREGSDHEPEDNTPSHSHTESDVLDSPVAEE 240
           GEREVNE          YELSKNGYFSDYMREGSDHEPEDNTPSHSHTESDVLDSPVAEE
Sbjct: 181 GEREVNENDNDDDDDDDYELSKNGYFSDYMREGSDHEPEDNTPSHSHTESDVLDSPVAEE 240

Query: 241 MQTEPQASTEEQEPDHNRVATNERVINEHLASNNNEVISKPSVFELENASAPIPQSITLR 300
           MQTEPQASTEEQEPDHNRVATNERVINEHLASNNNEVISKPSVFELENASAPIPQSITLR
Sbjct: 241 MQTEPQASTEEQEPDHNRVATNERVINEHLASNNNEVISKPSVFELENASAPIPQSITLR 300

Query: 301 HTSKTNLIHPEQETSXXXXXXXXXXXXXXXXXXXXXXXTLSYTESIKYPNSATYSKFNHT 360
           HTSKTNLIHPEQETS                       TLSYTESIKYPNSATYSKFNHT
Sbjct: 301 HTSKTNLIHPEQETSNFDEEKNKEDDYEETDETDDDFDTLSYTESIKYPNSATYSKFNHT 360

Query: 361 DEPLPISDDDFKFSTKNRQSILQXXXXXXXXXNDDHSLQNSSDMESFKVSESGYFEKLLE 420
           DEPLPISDDDFKFSTKNRQSILQ         NDDHSLQNSSDMESFKVSESGYFEKLLE
Sbjct: 361 DEPLPISDDDFKFSTKNRQSILQSSSEEEGEENDDHSLQNSSDMESFKVSESGYFEKLLE 420

Query: 421 EDEMNPSTDQESHHEELDKEENNSEGTEDDILSIPASIESDKVEENPEGINKEADETSEK 480
           EDEMNPSTDQESHHEELDKEENNSEGTEDDILSIPASIESDKVEENPEGINKEADETSEK
Sbjct: 421 EDEMNPSTDQESHHEELDKEENNSEGTEDDILSIPASIESDKVEENPEGINKEADETSEK 480

Query: 481 EKDRESENSKSGDDQETTITEGDSSRDSINLGSWKPDTDAIRSGFVQDTNKRAPPGFVYD 540
           EKDRESENSKSGDDQETTITEGDSSRDSINLGSWKPDTDAIRSGFVQDTNKRAPPGFVYD
Sbjct: 481 EKDRESENSKSGDDQETTITEGDSSRDSINLGSWKPDTDAIRSGFVQDTNKRAPPGFVYD 540

Query: 541 ENGKLVDLTPSSMKPRVVSTYSEMESTWAAFPSNGNPENNEDLETIKDTKTLYDNNTIFN 600
           ENGKLVDLTPSSMKPRVVSTYSEMESTWAAFPSNGNPENNEDLETIKDTKTLYDNNTIFN
Sbjct: 541 ENGKLVDLTPSSMKPRVVSTYSEMESTWAAFPSNGNPENNEDLETIKDTKTLYDNNTIFN 600

Query: 601 VPGIMTNNENLPPLPKNVNIEQGSLPVARTLTAGSEVDKKSIKSIHSEGPSVHKPDSYEM 660
           VPGIMTNNENLPPLPKNVNIEQGSLPVARTLTAGSEVDKKSIKSIHSEGPSVHKPDSYEM
Sbjct: 601 VPGIMTNNENLPPLPKNVNIEQGSLPVARTLTAGSEVDKKSIKSIHSEGPSVHKPDSYEM 660

Query: 661 AKLSDQDPLPELDLNELISSKASHLSKIEQLQAYSQSLADYDSGIQTWINYTLKSSSKAD 720
           AKLSDQDPLPELDLNELISSKASHLSKIEQLQAYSQSLADYDSGIQTWINYTLKSSSKAD
Sbjct: 661 AKLSDQDPLPELDLNELISSKASHLSKIEQLQAYSQSLADYDSGIQTWINYTLKSSSKAD 720

Query: 721 RDYLFDEYKKNEHVREAYANAEDLSRKNTVINTVASVNQNVSHLRKKVFSHSMKPRGLLS 780
           RDYLFDEYKKNEHVREAYANAEDLSRKNTVINTVASVNQNVSHLRKKVFSHSMKPRGLLS
Sbjct: 721 RDYLFDEYKKNEHVREAYANAEDLSRKNTVINTVASVNQNVSHLRKKVFSHSMKPRGLLS 780

Query: 781 TIGKKIIERET 791
           TIGKKIIERET
Sbjct: 781 TIGKKIIERET 791

>YGR196C (FYV8) [2146] chr7 complement(889736..892189) Protein of
           unknown function [2454 bp, 817 aa]
          Length = 817

 Score =  374 bits (961), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 222/475 (46%), Positives = 297/475 (62%), Gaps = 67/475 (14%)

Query: 340 LSYTESIKYPNSATYSKFNHTDEPL--------PISD-----DDFKFSTKNRQSILQXXX 386
           LSYTESIKY  + T  + N  +E +         I D     D +KFS + + SIL    
Sbjct: 383 LSYTESIKYSTNETEEEDNEDNESIEDKNEDNESIEDENEDTDSYKFSNREKGSILLTSD 442

Query: 387 XXXXXXNDDHSLQNSSDMESFKVSESGYFEKLLEEDEMNPSTDQESHHEELDKEENNSEG 446
                  ++  + + SD  S K  +SGYF K++  D+   S  Q +  + ++    ++ G
Sbjct: 443 EEE----EEKGMSSDSDEGSLKAPKSGYFSKMIGNDDKGDSALQPNQIDTIENTNLSNSG 498

Query: 447 TEDDILSIPASIESDKVEENPEGINKEADETSEKEKDRESENSKSGDDQETTITEGDSSR 506
           +E                EN +G    +DE     +D+              + E  S +
Sbjct: 499 SE---------------LENSDG----SDEEDHINEDK--------------VLEESSVK 525

Query: 507 DSINLGSWKPDTDAIRSGFVQDT-NKRAPPGFVYDENGKLVDLTPSSMKPRVVSTYSEME 565
           DS ++ SWKPD++A+RSGFVQDT NK+APPG+V D NGKLVDLTP+SMKPRVVSTYSEME
Sbjct: 526 DSTDVDSWKPDSEALRSGFVQDTANKKAPPGYVIDSNGKLVDLTPASMKPRVVSTYSEME 585

Query: 566 STWAAFPSNGNPENNEDLETIKDTKTLYDNNTIFNVPGIMTNNENLPPLPKNVN--IEQG 623
           STW AFPS G    ++DLETI+DTKT+YDNNTI+NVPG++ N  NLPPLP +    +  G
Sbjct: 586 STWDAFPSKGE---DDDLETIRDTKTIYDNNTIYNVPGLIGNQSNLPPLPMDAQEQLNAG 642

Query: 624 ----------SLPVARTLTAGSEVDKKSIKSI-HSEGPSVHKPDSYEMAKLSDQDPLPEL 672
                     S   A  L A S   K   +++   E  SVH+P + EMAKL  Q+ LP+L
Sbjct: 643 NDNSTTDNDNSNNTANDLAARSASFKSENRTVSQGEMTSVHEPSTEEMAKLGQQNNLPKL 702

Query: 673 DLNELISSKASHLSKIEQLQAYSQSLADYDSGIQTWINYTLKSSSKADRDYLFDEYKKNE 732
           D+N+L++SK SH  KIEQL+ Y + L +YD+GIQTWINYTLKSSS  D+D++ +EYK++ 
Sbjct: 703 DMNKLLNSKTSHAGKIEQLRNYKRELDEYDTGIQTWINYTLKSSSNKDKDFIAEEYKQHS 762

Query: 733 HVREAYANAEDLSRKNTVINTVASVNQNVSHLRKKVFSHSMKPRGLLSTIGKKII 787
           HVREAYANA+DLS+K+TVINTVASVNQNV+HLR+KVF HSMKP+ L ++IGKK +
Sbjct: 763 HVREAYANADDLSKKHTVINTVASVNQNVTHLRRKVFQHSMKPKDLFASIGKKKL 817

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 96/196 (48%), Gaps = 29/196 (14%)

Query: 1   MSSENVGRKKSHRWASASQATYDGADWNSSD----SDEDHAISNEEAQPNVTKLPSLPKL 56
           MS+E VGRKKS+RW SASQA+YDGA W+SSD    S ED    +E  +  ++ LPSLPKL
Sbjct: 1   MSTEQVGRKKSYRWVSASQASYDGAGWDSSDEYDYSSEDGTKGSEIHKQKISNLPSLPKL 60

Query: 57  NYTSNEEEEEGKLTDNAEEN------GKLPNSEEE-------------ERPTLHITTEDE 97
           NYT    E +    +N + N        +  S++E              R ++ +  +  
Sbjct: 61  NYTDVNGEHDENTGENKDSNDNNVSKSDISPSDKEVGYLSDGVPKLMASRESVELQAKKS 120

Query: 98  TDRXXXXXXXXXXXXRT---RRNSPM--RGVNTDLDNLMLQISKEMTPKLENEPVFPPRD 152
           ++             ++    + SP   R VN DLDNL+ QIS+EMTP++     F  RD
Sbjct: 121 SEHSKSDYLSSTASLKSPSENKKSPHTNRAVNEDLDNLIEQISREMTPEIRQTSDF-RRD 179

Query: 153 SPTSASREGSTPFYNA 168
           S +    +   P   A
Sbjct: 180 SDSCDEIQNEAPLGEA 195

>CAGL0G09295g 887666..889969 similar to sp|P46949 Saccharomyces
           cerevisiae YGR196c, start by similarity
          Length = 767

 Score =  349 bits (896), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 212/468 (45%), Positives = 284/468 (60%), Gaps = 67/468 (14%)

Query: 340 LSYTESIKYPNSATYSKFNHTDEPLPISDDDFKFSTKNRQSILQXXXXXXXXXNDDHS-- 397
           LS+TESI+Y  S   S+ N  D+   +S+   +    N  +  +          DDH+  
Sbjct: 347 LSFTESIQYDQSDGDSEPNQGDDASLVSN---RVQQNNVNTDAESADDIAKDKMDDHASG 403

Query: 398 -------LQNSSDMES-FKVSESGYFEKLLEEDEMNPSTDQESHHEELD--KEENNSEGT 447
                  + NS+  +    V +SGYF+KL+ E         E   ++LD  K  NN   T
Sbjct: 404 MDFEEDEVLNSTLTDGDVHVHKSGYFKKLVAE---------ELGDKKLDDGKSLNNVAST 454

Query: 448 EDDILSIPASIESDKVEENPEGINKEADETSEKEKDRESENSKSGDDQETTITEGDSSRD 507
           +       AS E DKV  + E +                + SK+ +D         S+R 
Sbjct: 455 Q------TASTE-DKVASDTEDV----------------QESKADNDDTKNDAHVSSNRS 491

Query: 508 SINLGSWKPDTDAIRSGFVQDTNKRAPPGFVYDENGKLVDLTPSSMKPRVVSTYSEMEST 567
           S+    W+PDTDA+R GF+Q T    PPGFV DE G+LVDLTP+SMKPRVVSTYSE+EST
Sbjct: 492 SVTSEEWRPDTDALRDGFMQKTGDNPPPGFVRDEKGELVDLTPASMKPRVVSTYSEIEST 551

Query: 568 WAAFPSNGNPENNEDLETIKDTKTLYDNNTIFNVPGIMTNNENLPPLPKNVNIEQ----- 622
           W AFPS    E+ +DLETI+DTKTLYDN+T++NVPGIMTNN+ LPPLP++ ++ +     
Sbjct: 552 WNAFPS----EDADDLETIRDTKTLYDNSTLYNVPGIMTNNDALPPLPEDASLYRDSNQS 607

Query: 623 ---GSLPVARTLTAGSEVDKKSIKSIHSEGPSVHKPDSYEMAKLSDQDPLPELDLNELIS 679
              GS   AR  +   +V K        EG ++ +P S E+ KLS+Q+ +P  DLN++IS
Sbjct: 608 DAVGSQDRARAASVTRKVSK--------EGVNIAQPTSQEINKLSEQNTMPTRDLNKIIS 659

Query: 680 SKASHLSKIEQLQAYSQSLADYDSGIQTWINYTLKSSSKADRDYLFDEYKKNEHVREAYA 739
           S ++H  K+E L+ Y  +L ++DSG+QTWI YTLKSSSK DRD++F EYK N HVREAYA
Sbjct: 660 SNSTHAIKLENLRDYRNTLDNFDSGLQTWIAYTLKSSSKTDRDFIFQEYKSNSHVREAYA 719

Query: 740 NAEDLSRKNTVINTVASVNQNVSHLRKKVFSHSMKPRGLLSTIGKKII 787
           NA+DLSRKNTVINTV +VNQNV+HLRKKV  HS+KP+ L S+I KK +
Sbjct: 720 NADDLSRKNTVINTVTNVNQNVNHLRKKVLQHSLKPKTLFSSISKKKL 767

>Kwal_33.15455
          Length = 914

 Score =  282 bits (722), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 175/423 (41%), Positives = 250/423 (59%), Gaps = 31/423 (7%)

Query: 371 FKFSTKNRQSILQXXXXXXXXXNDDHSLQNSSDMESFKVSESGYFEKLLEEDEMNPSTDQ 430
           FKF  + R SIL+                   D    +V +SGY+ ++++E     S   
Sbjct: 513 FKFKDRIRDSILES-----------SDDDIDDDESVLRVPKSGYYAQMVKE----TSGPD 557

Query: 431 ESHHEELDKEENNSEGTEDDILSIPASIESDKVEENPEGINKEADETSEKEKDRESENSK 490
           ES  ++   +++ +  +  D+ SI  SI           I   +  ++EK+ +  +E+  
Sbjct: 558 ESDDQQTVTDDDYTSSSGTDVCSITKSINYSSARPR-SSIPPVSQSSTEKQGEAPAESPS 616

Query: 491 SGDDQETTITEGDSSRDSINLGSWKPDTDAIRSGFVQDTNKRAPPGFVYDENGKLVDLTP 550
           S DDQ      G +SR S+NLG W+PDTDA R+ F+       P G+V D++G+LV++ P
Sbjct: 617 SDDDQNKV---GLNSRQSVNLGKWQPDTDAGRAEFLGQAKPEVPEGYVVDQDGQLVNVNP 673

Query: 551 SSMK-PRVVSTYSEMESTWAAFPSNGNPENNEDLETIKDTKTLYDNNTIFNVPGIMTNNE 609
           SSM+  RVVSTYSE ES W AFP++    N  DL+TI DTKT+YDN TI NVPG+ TNN+
Sbjct: 674 SSMRDARVVSTYSEAESAWNAFPASAG--NGGDLDTIYDTKTIYDNQTIHNVPGLATNND 731

Query: 610 NLPPLPKNVNIEQGSLPVARTLTAGSEVDKKSIKSIH----SEGPSVHKPDSYEMAKLSD 665
           +LPPLP+++     SL    T +         +K  H     E  SVH PD  E+A L  
Sbjct: 732 SLPPLPRDITAVDSSLSANVTDSDSILNHLNGVKRHHYSNLKESFSVHTPDQEEIA-LVK 790

Query: 666 QDPLPELDLNELISSK-ASHLSKIEQLQAYSQSLADYDSGIQTWINYTLKSSSKADRDYL 724
           Q  +P  DL+ LI+ K  +H +KI  L  +   L DYDSG+ TWI+Y LK+S+ +D+DY+
Sbjct: 791 QKAVPTADLDALITRKNTTHAAKINDLNKHFNELKDYDSGLHTWISYALKTST-SDKDYI 849

Query: 725 FDEYKKNEHVREAYANAEDLSRKNTVINTVASVNQNVSHLRKKVFSHSM--KPRGLLSTI 782
           F  YK + HV++AY++A+DLS+K TV NTVA+VNQNVSHL++KVFSH+M  K +GL S+I
Sbjct: 850 FQNYKVSTHVKDAYSHADDLSKKMTVSNTVANVNQNVSHLKRKVFSHTMKEKSKGLFSSI 909

Query: 783 GKK 785
            KK
Sbjct: 910 SKK 912

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 110/250 (44%), Gaps = 47/250 (18%)

Query: 3   SENVGRKKSHRWASASQATYDGADWNSSDSDEDH-AISNEEAQP--------NVTKLPSL 53
           S N+ RKKS RW S S+ TYDG +W+SS+ DE + A  N+E Q          V+KLP L
Sbjct: 2   SVNMERKKSQRWVSVSKGTYDGKEWDSSEEDEPYGAWENDEGQSRKSPERNGTVSKLPPL 61

Query: 54  PKLNYT-----SNEEEEEGKLTDNAEENGKLPNSEEEERPTLHITTEDETDRXXXXXXXX 108
           P L+Y      SNE E      D A  +     S     P L+     ++          
Sbjct: 62  PMLSYGKDSRRSNEVERTETGADEASGSQLDSTSTGAGSPRLY-----QSSSGAARVNSQ 116

Query: 109 XXXXRTRRNSPMRGVNTDLDNLMLQISKEMTPKLENEPVFPPRDSPTSASREGSTPFYNA 168
               R  R  P +  + +LD+LM Q+S+E+TP   +E  F   D   ++ R GS   Y  
Sbjct: 117 SSTGRITRG-PSQYKSENLDHLMTQLSQELTPVSISESRFSFNDDGLNSPR-GSADRYRD 174

Query: 169 SSVIQQPNDAREGEREVNEXXXXXXXXXXYELSKNGYFSDYMR--EGSDHEPEDNTPSHS 226
           S+         E E E              ++SK GYFS+ M+  +G+D   E       
Sbjct: 175 SNGFS----YSESEEEP-------------QVSKTGYFSNMMQSPDGADQSSE------- 210

Query: 227 HTESDVLDSP 236
           H+ES+   +P
Sbjct: 211 HSESEFFATP 220

>KLLA0D09603g 811234..813696 weakly similar to sp|P46949
           Saccharomyces cerevisiae YGR196c singleton, start by
           similarity
          Length = 820

 Score =  233 bits (593), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 150/388 (38%), Positives = 242/388 (62%), Gaps = 21/388 (5%)

Query: 407 FKVSESGYFEKLLEEDEMNPSTDQESHHEELDKEENNSEGTEDDILSIPASIESDKVEEN 466
            +V++SGYF  +++ED+    +D+ +    L+  + +    + D+ SI  S+ + ++ ++
Sbjct: 446 LEVTKSGYFAAMVDEDKEIDDSDRHT----LNNNDTDGLTADSDVNSITESV-TKRLSQS 500

Query: 467 PEGINKEADETSEKEKDRESENSKSGDDQETTITEGDSSRDSINLGSWKPDTDAIRSGFV 526
               +   D+ SE +    S++S+  +D    +    S+R+SINLG WKPDTDA RSGFV
Sbjct: 501 SITQSDVPDQNSENDVGGYSDSSEDEEDGPQKLAF--STRESINLGKWKPDTDAFRSGFV 558

Query: 527 QDT-NKRAPP-GFVYDENGKLVDL---TPSSMKPRVVSTYSEMESTWAAFPSNGNPENNE 581
            +T +   PP G+  +E+G++V++   T S+++ R  S  S+ ES + AFP +    +++
Sbjct: 559 TETIDINNPPEGYTVNEDGEIVEVNKNTTSNIQ-RNSSVASDGESQFNAFPHDV-ASDDD 616

Query: 582 DLETIKDTKTLYDNNTIFNVPGIMTNNENLPPLPKNVNIEQGSLP-VARTLTAGSEVDKK 640
           DL+TI DTKT+YDN TI+NVP ++ NN + P LP N+ I   S   V+   T    V+ +
Sbjct: 617 DLKTIADTKTIYDNQTIYNVPALIANNASAPALPTNIQITNESTDYVSSNDTIFKHVNGE 676

Query: 641 SIKSIHSEGPSVHKPDSYEMAKLSDQDPLPELDLNELISSKASHLSKIEQLQAYSQSLAD 700
           + K   S+       +  E+  +  Q  +P LDL +L+SS   H  K+++L  Y + L +
Sbjct: 677 APKG-ESKLKEAFSSEGDEIPSVVHQSTVPNLDLVKLLSSNELHSQKLKKLNNYKEQLKE 735

Query: 701 YDSGIQTWINYTLKSSSKADRDYLFDEYKKNEHVREAYANAEDLSRKNTVINTVASVNQN 760
           YDSG+Q+WI Y LKSS+ +D+D++F +YK N+HV++AYA A+ LS+KN+V NT   VNQN
Sbjct: 736 YDSGLQSWIQYALKSSTTSDKDFIFKDYKVNKHVQDAYAQADILSKKNSVANT---VNQN 792

Query: 761 VSHLRKKVFSHSM--KPRGLLSTIGKKI 786
           V+HL+KK+FS SM  K +GL S+IGKK+
Sbjct: 793 VTHLKKKMFSSSMREKSKGLFSSIGKKL 820

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 66/143 (46%), Gaps = 38/143 (26%)

Query: 3   SENVGRKKSHRWASASQATYDGADWNS-SDSDEDHAISNEEAQPNVTKLPSLPKLNYTSN 61
           S+N+ R KS RW SAS+A YDGADW++ S + ED  ++N         +P LP++N    
Sbjct: 16  SDNITRHKSQRWVSASKANYDGADWDAYSSNSEDEGLTN--------NIPQLPQVNI--- 64

Query: 62  EEEEEGKLTDNAEENGKLPNSEEEERPTLHITTEDETDRXXXXXXXXXXXXRTRRNSPMR 121
                       E N    N  +   P   I T   +D              T   S  +
Sbjct: 65  -----------PESN----NIAKSSSPDPSIGTCLRSD-----------SLNTSVRSGNK 98

Query: 122 GVNTDLDNLMLQISKEMTPKLEN 144
            VN DLD+LM QIS+EMT K E+
Sbjct: 99  SVNDDLDSLMHQISQEMTAKDED 121

>ACR036C [1084] [Homologous to ScYGR196C (FYV8) - SH]
           (423030..425294) [2265 bp, 754 aa]
          Length = 754

 Score =  177 bits (450), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/296 (37%), Positives = 172/296 (58%), Gaps = 33/296 (11%)

Query: 508 SINLGSWKPDTDAIRSGFV-----QDTNKRAPPGFVYDENGKLVDLTPSSMKPRVVSTYS 562
           S++LG+W PDT+  R  F+       TNK    G    ++ +         +P       
Sbjct: 469 SVHLGAWNPDTEGKRGAFLTQASPMSTNK----GMCGSQDEETTGDDQQLAEP----CND 520

Query: 563 EMESTWAAFPSNGNPENNEDLETIKDTKTLYDNNTIFNVPGIMTNNENLPPLPKNVN--I 620
           + +S W  FPS G     EDL+++ D KT+YDN T++NVPGI+T++ ++PPLP +++   
Sbjct: 521 DSDSVWEGFPSVGE---YEDLQSVADIKTIYDNQTLYNVPGIITSSTSVPPLPSSMSELT 577

Query: 621 EQGSLPVARTLTAGSEVDKKSIKSI-----HSEGPSVHKPDSYEMAKLSDQ----DPLPE 671
            +    +    T+GS +D  S+  +     H+  PS+ K +  +  ++  +     P+P 
Sbjct: 578 SRQDTSILSESTSGSGLDSDSLMRVVEGQRHAPKPSMFKENFGQTPEVQVEHLVNSPVPS 637

Query: 672 LDLNELISSKASHLSKIEQLQAYSQSLADYDSGIQTWINYTLKSSSKADRDYLFDEYKKN 731
           LD+  LI    SH  K ++L ++ + L  Y SG QTWI Y LK S+++  +  FDEY  +
Sbjct: 638 LDICALIEGPQSHSFKRDKLNSHIEDLNAYSSGAQTWIKYALK-STQSSSNITFDEYVIS 696

Query: 732 EHVREAYANAEDLSRKNTVINTVASVNQNVSHLRKKVFSHSMK--PRGLLSTIGKK 785
           +HV++AYA AE++S+K++V N   +VNQNVS LRKKVFSHSMK   +GLLS+IGKK
Sbjct: 697 KHVQDAYAQAEEVSKKHSVTN---AVNQNVSQLRKKVFSHSMKEGAKGLLSSIGKK 749

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 71/164 (43%), Gaps = 13/164 (7%)

Query: 4   ENVGRKKSHRWASASQATYDGADWNSSDSDEDHAISNEEAQPNVTKLPSLPKLNYTSNEE 63
           + V R+KS RW S S+  YDGADW+S  S E+   S       + KLP LPKLN      
Sbjct: 3   DKVNRRKSQRWVSVSKGNYDGADWDSDYSGEELESSPTRQHETICKLPELPKLNL-GGST 61

Query: 64  EEEGKLTDNAEENGKLPNSEEEE------RPTLHITTEDETDRXXXXXXXXXXXXRTRRN 117
           EE G+       +G  P    EE      R       E +T R             +R  
Sbjct: 62  EERGR---PGSGDGLAPRGAAEEEAASSGRGAATPAHEVQTPRSGAAAQKFSLTSSSRSV 118

Query: 118 SPMRGVNTDLDNLMLQISKEMTPKLENEPVFPPRDSPTSASREG 161
           S M   N +LD LM +ISKEMT      P+   R SP   +R G
Sbjct: 119 SSM---NKELDTLMDEISKEMTAGGSEPPLVETRQSPVDFNRVG 159

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.302    0.122    0.333 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,285,139
Number of extensions: 1400979
Number of successful extensions: 10681
Number of sequences better than 10.0: 679
Number of HSP's gapped: 9559
Number of HSP's successfully gapped: 997
Length of query: 791
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 681
Effective length of database: 12,788,129
Effective search space: 8708715849
Effective search space used: 8708715849
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.8 bits)
S2: 66 (30.0 bits)