Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_617.354154128230.0
YGR197C (SNG1)54751512321e-165
CAGL0G09273g54544211731e-156
Sklu_2316.348748410901e-144
YJR015W51051510601e-139
KLLA0E02134g53952110311e-134
Kwal_55.2210649546310161e-133
CAGL0B03971g54346910071e-131
CAGL0B03949g6324599991e-128
Scas_647.94494229631e-125
ADL193C4654266892e-84
Scas_434.13572864324e-48
Scas_617.0d46451792e-16
KLLA0E21989g54763674.6
CAGL0K08580g45340665.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_617.3
         (541 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_617.3                                                           1092   0.0  
YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable t...   479   e-165
CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces c...   456   e-156
Sklu_2316.3 , Contig c2316 10494-11957 reverse complement             424   e-144
YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with sim...   412   e-139
KLLA0E02134g complement(200436..202055) similar to sp|P46950 Sac...   401   e-134
Kwal_55.22106                                                         395   e-133
CAGL0B03971g complement(390700..392331) similar to sp|P47090 Sac...   392   e-131
CAGL0B03949g complement(387861..389759) similar to sp|P46950 Sac...   389   e-128
Scas_647.9                                                            375   e-125
ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH] (357909..3...   270   2e-84
Scas_434.1                                                            171   4e-48
Scas_617.0d                                                            74   2e-16
KLLA0E21989g 1954118..1955761 similar to sp|P40215 Saccharomyces...    30   4.6  
CAGL0K08580g complement(864641..866002) similar to sp|Q01802 Sac...    30   5.2  

>Scas_617.3
          Length = 541

 Score = 1092 bits (2823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/541 (97%), Positives = 529/541 (97%)

Query: 1   MNTDEETRYNLAHLQTVASSMAQQVAGTYEAEQQANMTSVTDEESQINDTNSEKDAAKGS 60
           MNTDEETRYNLAHLQTVASSMAQQVAGTYEAEQQANMTSVTDEESQINDTNSEKDAAKGS
Sbjct: 1   MNTDEETRYNLAHLQTVASSMAQQVAGTYEAEQQANMTSVTDEESQINDTNSEKDAAKGS 60

Query: 61  NSYAVNSFSSAAGSQPQAYNPDGQNTAKPAVTQPEENEENVPISPTKTRLYSPKLASQRK 120
           NSYAVNSFSSAAGSQPQAYNPDGQNTAKPAVTQPEENEENVPISPTKTRLYSPKLASQRK
Sbjct: 61  NSYAVNSFSSAAGSQPQAYNPDGQNTAKPAVTQPEENEENVPISPTKTRLYSPKLASQRK 120

Query: 121 KITVKFIISNLLLAGVCLSILSLYWGSLYQTTKHLERXXXXXXXXXXXXPPNDLNLTSVV 180
           KITVKFIISNLLLAGVCLSILSLYWGSLYQTTKHLER            PPNDLNLTSVV
Sbjct: 121 KITVKFIISNLLLAGVCLSILSLYWGSLYQTTKHLERISIIAIIQDDYIPPNDLNLTSVV 180

Query: 181 APVPSFIEQSTGKWHVYNQSYFQEKFNVQDPTMINERLNALIHDEKYWIALNIGANLTMR 240
           APVPSFIEQSTGKWHVYNQSYFQEKFNVQDPTMINERLNALIHDEKYWIALNIGANLTMR
Sbjct: 181 APVPSFIEQSTGKWHVYNQSYFQEKFNVQDPTMINERLNALIHDEKYWIALNIGANLTMR 240

Query: 241 IVNSLTTPNEPFFNSTQHIRVVYETSREPTTLEAYMLPIIQEIELAYQDFYHTEYLPELL 300
           IVNSLTTPNEPFFNSTQHIRVVYETSREPTTLEAYMLPIIQEIELAYQDFYHTEYLPELL
Sbjct: 241 IVNSLTTPNEPFFNSTQHIRVVYETSREPTTLEAYMLPIIQEIELAYQDFYHTEYLPELL 300

Query: 301 SKLQNSTTTPLSNTGAANLANIGKFQFDYDDILVFPDRILIAPLQVGLIYCLILTVFQLS 360
           SKLQNSTTTPLSNTGAANLANIGKFQFDYDDILVFPDRILIAPLQVGLIYCLILTVFQLS
Sbjct: 301 SKLQNSTTTPLSNTGAANLANIGKFQFDYDDILVFPDRILIAPLQVGLIYCLILTVFQLS 360

Query: 361 LFGPLHAEMAKYLKPKHIIIYRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIY 420
           LFGPLHAEMAKYLKPKHIIIYRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIY
Sbjct: 361 LFGPLHAEMAKYLKPKHIIIYRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIY 420

Query: 421 WMTTYLVMLALGGANENVLSLIILFIPEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGY 480
           WMTTYLVMLALGGANENVLSLIILFIPEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGY
Sbjct: 421 WMTTYLVMLALGGANENVLSLIILFIPEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGY 480

Query: 481 MMPLHQALDIFKVVFLNVSKRHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQKRMEAKK 540
           MMPLHQALDIFKVVFLNVSKRHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQKRMEAKK
Sbjct: 481 MMPLHQALDIFKVVFLNVSKRHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQKRMEAKK 540

Query: 541 N 541
           N
Sbjct: 541 N 541

>YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable
           transport protein, confers resistance to MNNG and
           nitrosoguanidine [1644 bp, 547 aa]
          Length = 547

 Score =  479 bits (1232), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 237/515 (46%), Positives = 340/515 (66%), Gaps = 24/515 (4%)

Query: 39  SVTDEESQ-INDTNSEK----DAAKGSNSYAVNSFSSAAGSQPQAYN-------PDGQNT 86
           SV DEESQ I D +          +   SY+   F+  +G              PD + +
Sbjct: 4   SVGDEESQYIEDPSFAAAAAFTGGRDGVSYSNQRFAEGSGHSSDLAKSLEDYRPPDEKPS 63

Query: 87  AKPAVTQPEENEE------NVPISPTKTRLYSPKLASQRKKITVKFIISNLLLAGVCLSI 140
           +  +V +   NEE        P++  +T L+SP+L + RKKI  KF+++N  +A VC+S+
Sbjct: 64  SLSSVGEGGANEEEKGGNDGGPLARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVCVSL 123

Query: 141 LSLYWGSLYQTTKHLERXXXXXXXXXXXXPPNDLNLTSVVAPVPSFIEQSTGKWHVYNQS 200
           +S+YWG+ Y T ++  +             P++ ++ S+ A +PS +    G WH+YN +
Sbjct: 124 ISIYWGACYGTDRYFFKVKNIVVLQDA---PSNTSVQSISAIIPSLLASVPGTWHIYNAT 180

Query: 201 YFQEKFNVQDPTMINERLNALIHDEKYWIALNIGANLTMRIVNSLTTPN-EPFFNSTQHI 259
            F  KF   + T I+ ++  LI+DE+YW+ALN+  N T  + NSL + +    FNS+   
Sbjct: 181 SFHRKFGTTNSTEIDRKIVDLIYDERYWLALNVKPNATDTLYNSLISQDANSEFNSSIFF 240

Query: 260 RVVYETSREPTTLEAYMLPIIQEIELAYQDFYHTEYLPELLSKLQNSTTTPLSNTGAANL 319
             V+E+ R+P+++++ +LP++Q++E+  Q +Y  EYLP L+S + ++      N    N 
Sbjct: 241 ESVFESGRDPSSVKSTILPLMQQLEVRLQKYYVKEYLPSLMSNITSNDRD--LNINMENW 298

Query: 320 ANIGKFQFDYDDILVFPDRILIAPLQVGLIYCLILTVFQLSLFGPLHAEMAKYLKPKHII 379
           A  G+  F Y+D   F DRIL+APLQVGLIYC++LTV QLSL+G LH EMA+ LKPKHI+
Sbjct: 299 AIAGQLLFTYNDYRPFADRILMAPLQVGLIYCILLTVLQLSLYGKLHGEMARVLKPKHIL 358

Query: 380 IYRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIYWMTTYLVMLALGGANENVL 439
           IYRL +SWATYF LS+ FCTVSAIF+IDFT  FG+GGFV+YWM+T+LVM+A+GGANENVL
Sbjct: 359 IYRLLISWATYFLLSIGFCTVSAIFRIDFTPAFGRGGFVVYWMSTWLVMMAVGGANENVL 418

Query: 440 SLIILFIPEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGYMMPLHQALDIFKVVFLNVS 499
           SL+I + P YL +WL++WII+NIS +F PMVL+N FYRYGY+MP+H A+DI+KV+FLN++
Sbjct: 419 SLVIAYCPPYLSIWLMTWIILNISASFYPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLT 478

Query: 500 KRHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQK 534
           KR MGRNYGILVAW+ +NT L P  MK  GK +QK
Sbjct: 479 KRKMGRNYGILVAWVALNTSLMPFCMKFAGKKMQK 513

>CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces
           cerevisiae YGR197c SNG1 or sp|P47090 Saccharomyces
           cerevisiae YJR015w, hypothetical start
          Length = 545

 Score =  456 bits (1173), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 210/442 (47%), Positives = 309/442 (69%), Gaps = 17/442 (3%)

Query: 112 SPKLASQRKKITVKFIISNLLLAGVCLSILSLYWGSLYQTTKHLERXXXXXXXXXXXXPP 171
           +PKL S +  +  +F  +N+LLA VCLSI+ +YWG+ Y+T  +L +              
Sbjct: 107 NPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQDYN- 165

Query: 172 NDLNLTSVVAPVPSFIEQSTGKWHVYNQSYFQEKFNVQDPT-MINERLNALIHDEKYWIA 230
              N+ S+ + +P+ I+Q+ G WH+YN+S F EK+ +++ +  +++++  LI +EKYW++
Sbjct: 166 ---NIQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEKYWMS 222

Query: 231 LNIGANLTMRIVNSLTTPNEPFFNSTQHIRVVYETSREPTTLEAYMLPIIQEIELAYQDF 290
           LN+    T  + NSLT    P FNS+ +   ++E+ R+PT L++ +LPI+Q+++ AY  +
Sbjct: 223 LNVKTGATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAAYVQY 282

Query: 291 YHTEYLPELLSKLQNSTTTPLSNTGAANLANIGKFQFDYDDILVFPDRILIAPLQVGLIY 350
           Y + YLP +L  + ++T   + +    +LAN G F+F+Y D   F DR+L+APLQVGLI+
Sbjct: 283 YTSTYLPSMLRNV-SATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVGLIF 341

Query: 351 CLILTVFQLSLFGPLHAEMAKYLKPKHIIIYRLSVSWATYFFLSLFFCTVSAIFQIDFTV 410
            LILTV QLSL+GP+HA+M +  KPKH ++YR  +SW+TYF LSLFFCTVSAI+QIDFT+
Sbjct: 342 TLILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQIDFTL 401

Query: 411 TFGKGGFVIYWMTTYLVMLALGGANENVLSLIILFIPEYLPLWLLSWIIMNISPTFNPMV 470
            FG+GGFVIYW+TT+ VMLA+G  NENV+SLI+ + P+Y+P+WL+SWII+NISP+F PMV
Sbjct: 402 AFGRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMPIWLISWIILNISPSFYPMV 461

Query: 471 LDNVFYRYGYMMPLHQALDIFKVVFLNVSKRHMGRNYGILVAWIVVNTCLFPLVMKIVGK 530
           L+N FYRYGY MPLH A+DI++V+FL++S+  +GRNYGIL AW+ V   +FP VMKI G 
Sbjct: 462 LNNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKIAGT 521

Query: 531 TVQKRM-----------EAKKN 541
            ++              EAKKN
Sbjct: 522 KMKSNAMKQAQATIAAYEAKKN 543

>Sklu_2316.3 , Contig c2316 10494-11957 reverse complement
          Length = 487

 Score =  424 bits (1090), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 208/484 (42%), Positives = 308/484 (63%), Gaps = 22/484 (4%)

Query: 54  KDAAKGSNSYAVNSFSSAAGSQPQAYNPDGQNTAKPAVTQPEENEENVPISPTKTRLYSP 113
           K+ A G    ++N F      Q Q+      ++ + ++++   N+    +    T  +SP
Sbjct: 15  KEVAAGEQQ-SLNQFEQRCLDQAQS----EHDSVRTSLSEVASNDGG-SLQRMATSFFSP 68

Query: 114 KLASQRKKITVKFIISNLLLAGVCLSILSLYWGSLYQTTKHLERXXXXXXXXXXXXPPND 173
           +L +QRK +  +F+ + L LA + +S+ SLYWG+LY    HL +             P  
Sbjct: 69  RLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAVIQDDGSLPGA 128

Query: 174 LNLTSVVAPVPSFIEQSTGKWHVYNQSYFQEKFNVQDPTMINERLNALIHDEKYWIALNI 233
           L         P+ I+ + G WHVY    FQ K+++ + T I+ ++  L+H +K+W++LN+
Sbjct: 129 L---------PAIIDANPGGWHVYTSEQFQSKYHINE-TQIDSKIEHLVHTQKFWMSLNV 178

Query: 234 GANLTMRIVNSLTTPNEPFFNSTQHIRVVYETSREPTTLEAYMLPIIQEIELAYQDFYHT 293
             N T  +  SL  P+   F ++ +   +YE+ R+PT   + +LP++QE+EL++Q  Y +
Sbjct: 179 KPNATNALHESLQNPSADPFVASNYFEAIYESGRDPTNFRSSILPLLQEVELSFQKNYTS 238

Query: 294 EYLPELLSKLQNSTTTPLSNTGAANLANIGKFQFDYDDILVFPDRILIAPLQVGLIYCLI 353
            YLPELLS       T LSN   ANLA  G  +F  +D+  F + +L+ PLQVGLI+C++
Sbjct: 239 SYLPELLSH------TNLSNASPANLAAAGNLEFCSEDMRPFSNYVLLGPLQVGLIFCVL 292

Query: 354 LTVFQLSLFGPLHAEMAKYLKPKHIIIYRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFG 413
           LT FQL++FGPLH  ++  LKP HI+IYR  +S   YFFLSLFFCTVSAIFQ+DFT TFG
Sbjct: 293 LTFFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTVSAIFQVDFTPTFG 352

Query: 414 KGGFVIYWMTTYLVMLALGGANENVLSLIILFIPEYLPLWLLSWIIMNISPTFNPMVLDN 473
           + GF++YWM+T+L+M A+GGANENVLSLI+ +  +YL  WL+ WI+ NISP+F P+ L N
Sbjct: 353 RAGFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVSNISPSFFPLALMN 412

Query: 474 VFYRYGYMMPLHQALDIFKVVFLNVSKRHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQ 533
            FYRYGYMMP+H A+DI+KV+FLN  K  +GRNYGIL AW+V+N+ LF  V+KIVG  ++
Sbjct: 413 NFYRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINSILFVPVLKIVGNKMK 472

Query: 534 KRME 537
           +  +
Sbjct: 473 QNAQ 476

>YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with
           similarity to Sng1p and multidrug resistance proteins
           [1533 bp, 510 aa]
          Length = 510

 Score =  412 bits (1060), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 225/515 (43%), Positives = 324/515 (62%), Gaps = 18/515 (3%)

Query: 37  MTSVTD--EESQINDTNSEKDAAKGSNSYAVNSFSSAAGSQPQAYNPDGQNTAKPAVTQP 94
           MTS  D  E +  N+  ++++  + ++   ++  SS  G       PD       +   P
Sbjct: 1   MTSSLDDIEPTAYNNMEADEEYCRRND---IHDLSSVVGDAVSQGVPDMDGQTTDSSKDP 57

Query: 95  EEN-EENVPISPTKTRLYSPKLASQRKKITVKFIISNLLLAGVCLSILSLYWGSLYQTTK 153
           E N E+     P+    +SP L  QRKK+ +KF+ +N LLA +C ++  L+WG+LY T+K
Sbjct: 58  EPNSEDKKAFPPSSGSFFSPNLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSK 117

Query: 154 HLERXXXXXXXXXXXXPPNDL--NLTSVVAP-----VPSFIEQSTGKWHVYNQSYFQEKF 206
           +L +            PP  +  N +S+V P     +P+FI +    W +YN   FQ KF
Sbjct: 118 YLHKVKLLVVIQE---PPVVILDNNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKF 174

Query: 207 NVQDPTMINERLNALIHDEKYWIALNIGANLTMRIVNSLTTPNEPFFNSTQHIRVVYETS 266
           +V  P  +N+++  L++DEKYW A+NI  N T  +  SL     P FNST   +VVYET 
Sbjct: 175 DVNTPQQVNDKVVDLVYDEKYWFAINIKPNATETLFESLINDTAPLFNSTLFNQVVYETG 234

Query: 267 REPTTLEAYMLPIIQEIELAYQDFYHTEYLPELLSKLQNSTTTPLSNTGAANLANIGKFQ 326
           R+PT L++ +LP+ Q IE  Y  FY   YLP LL+ +       L+N  A  +A  GK+ 
Sbjct: 235 RDPTNLKSTILPVAQTIEEYYHTFYTLNYLPPLLTNITQVYRYALTN-NARYIAAAGKYN 293

Query: 327 FDYDDILVFPDRILIAPLQVGLIYCLILTVFQLSLFGPLHAEMAKYLKPKHIIIYRLSVS 386
           ++Y D   F DRIL+AP Q+G++YCL+LT FQ  L+GPLH EMAK L+P + +IYR+++S
Sbjct: 294 YEYYDHRPFTDRILLAPTQIGVVYCLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMS 353

Query: 387 WATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIYWMTTYLVMLALGGANENVLSLIILFI 446
           W T+FF SLFFCT +AIFQ+DFT +FG+GGFV+YWM+T+L MLA GGANEN + L+I   
Sbjct: 354 WFTFFFASLFFCTTTAIFQVDFTKSFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLG 413

Query: 447 PEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGYMMPLHQALDIFKVVFLNVSKRHMGRN 506
           P+YL  W+LS++I+NI+P+F P+ L+N  YRYGYMMP+H  +DI++V+F +V++R MGRN
Sbjct: 414 PQYLGFWILSFVILNIAPSFFPLALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRN 473

Query: 507 YGILVAWIVVNTCLFPLVMKIVGKTV-QKRMEAKK 540
           YGILVA I +NT L P V K   + + QK + A K
Sbjct: 474 YGILVALIALNTALLPFVGKYASRKLKQKALVAAK 508

>KLLA0E02134g complement(200436..202055) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 involved in
           nitroguanidine resistance, start by similarity
          Length = 539

 Score =  401 bits (1031), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 218/521 (41%), Positives = 317/521 (60%), Gaps = 37/521 (7%)

Query: 33  QQANMTSVTDEESQ-INDTNSEKDAAKGSNSYAVNSFSSAAGSQPQAYNPDGQNTAKPAV 91
           Q  N  S  DEESQ      S + +   S +         + S  QA + +  N  K + 
Sbjct: 38  QYMNAESSADEESQGFAGNESGRKSRTPSLAMVGEDNQDQSTSDEQAESVEEFN--KESA 95

Query: 92  TQPEENEENVPISPT----------KTRLYSPKLASQRKKITVKFIISNLLLAGVCLSIL 141
              ++NEE    SP           KTR +S KL++ R     +F ++  LL  + +++ 
Sbjct: 96  NIDDKNEEQNDGSPAEAGQPALGRVKTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMF 155

Query: 142 SLYWGSLYQTTKHLERXXXXXXXXXXXXPPNDLNLTSVVAPVPSFIEQSTGKWHVYNQSY 201
           SLYWG+LY  +                   +D ++ + V P+   ++ +  ++ VYN S 
Sbjct: 156 SLYWGALYNHSSDYHNVKFIAVV------EDDGDMGAGVIPI---MDSAIPQFFVYNTSS 206

Query: 202 FQEKFNVQDPTMINERLNALIHDEKYWIALNIGANLTMRIVNSLTTPNEPFFNSTQHIRV 261
           F++K+  QD   I+E+++ L+H +K+W +L +    T   V+SLTT + P FNST +   
Sbjct: 207 FRDKYG-QDVN-ISEKVHHLVHTKKFWGSLIVYPGTTDAFVDSLTTDDAPAFNSTDYFEF 264

Query: 262 VYETSREPTTLEAYMLPIIQEIELAYQD-FYHTEYLPELLSKLQNSTTTPLSNTGAANLA 320
            Y+T+R+ + + A ++P++  IE  Y+  F++ +Y P +++ + N +   LS  G  N  
Sbjct: 265 FYKTARDLSNMRASIVPLLTSIETTYKKTFFYNDYFPSVIANITNISGPNLSAAGDMNWK 324

Query: 321 NIGKFQFDYDDILVFPDRILIAPLQVGLIYCLILTVFQLSLFGPLHAEMAKYLKPKHIII 380
            I        D   F D  L+ P+QVGLIYC++LT FQL+LFGP HA ++  LKPKHII+
Sbjct: 325 QI--------DNRPFTDYTLLGPMQVGLIYCILLTFFQLALFGPFHAMLSPLLKPKHIIL 376

Query: 381 YRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIYWMTTYLVMLALGGANENVLS 440
           YRL  SWATYFFLSLFFCTVSAIF +DFT+ FG+GGFV+YWMTT+++M A+GGANENVLS
Sbjct: 377 YRLVTSWATYFFLSLFFCTVSAIFHVDFTLAFGRGGFVVYWMTTWILMGAVGGANENVLS 436

Query: 441 LIILFIPEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGYMMPLHQALDIFKVVFLNVSK 500
           +++ + P+YL  WL+SWII+NIS +F P+VL N FYRYGYM P++ A++I++V+F +  K
Sbjct: 437 ILLAYCPQYLGFWLISWIIINISASFVPLVLANRFYRYGYMTPIYNAMEIYRVIFTDTYK 496

Query: 501 RHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQKRM-EAKK 540
             MGRNYGIL AW V+NT LFP VMKIVG   QK M +AKK
Sbjct: 497 GDMGRNYGILAAWCVLNTLLFPFVMKIVG---QKFMNDAKK 534

>Kwal_55.22106
          Length = 495

 Score =  395 bits (1016), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 194/463 (41%), Positives = 295/463 (63%), Gaps = 18/463 (3%)

Query: 82  DGQNTAKPAVTQPEENEENVPISPTKTRLYSPKLASQRKKITVKFIISNLLLAGVCLSIL 141
           D +N A    T+ E       +S   T  +S ++  +R+K+ ++F++++ LLA + +S+ 
Sbjct: 44  DPENEA--GATEGELRRVESKLSRVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVF 101

Query: 142 SLYWGSLYQTTKHLERXXXXXXXXXXXXPPNDLNLTSVVAPVPSFIEQSTGKWHVYNQSY 201
           SLYWG+ YQ +KH+ +            P      T + + +P+  EQ+ G WHVYN S 
Sbjct: 102 SLYWGATYQRSKHMHKVKILAVVQDE--PGTG---TGIASSIPTLAEQAPGTWHVYNTSS 156

Query: 202 FQEKFNV-QDPTMINERLNALIHDEKYWIALNIGANLTMRIVNSLTTPNEPFFNSTQHIR 260
           FQ+K+ V QD   ++ ++  L+HD+KYW++LN+  N T  ++ SL       FNS+    
Sbjct: 157 FQQKYGVAQDE--VDAKIQQLVHDQKYWVSLNVKPNATSTLIESLQNSRASPFNSSAFFE 214

Query: 261 VVYETSREPTTLEAYMLPIIQEIELAYQDFYHTEYLPELLSKLQNSTTTPLSNTGAANLA 320
           + YE+ R+PT L++ +LPI   +E  YQ+ Y +  LP +LS +     T      + N+A
Sbjct: 215 LFYESGRDPTNLKSSILPIALSLESRYQNIYASTILPGILSNI-----TQRVGDVSRNVA 269

Query: 321 NIGKFQFDYDDILVFPDRILIAPLQVGLIYCLILTVFQLSLFGPLHAEMAKYLKPKHIII 380
             G   F   D   F D +L+ PLQVGLIYC++LT FQL+LFGP+HA + + LKP H+++
Sbjct: 270 MAGNMVFAQVDNRPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHALLGQKLKPVHMLL 329

Query: 381 YRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIYWMTTYLVMLALGGANENVLS 440
           YR  +++  YFFLSLFFC VS  FQ+DFT  FG+ GF++ WM+++L+M A+GGANEN+L+
Sbjct: 330 YRYVIAFVNYFFLSLFFCLVSLAFQVDFTKAFGRAGFMVAWMSSWLLMAAVGGANENMLT 389

Query: 441 LIILFIPEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGYMMPLHQALDIFKVVFLNVSK 500
           +I+ F P+YL  WL+ W+++NISP F PM L + FYRYGYM P++  + IF+V FL++ +
Sbjct: 390 IIMAFGPQYLGFWLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGVGIFRVTFLDLYR 449

Query: 501 RHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQKR--MEAKKN 541
            H+GRNYGIL AWIV+N  +FP VMK+    V+KR  M+A+ N
Sbjct: 450 GHLGRNYGILCAWIVLNMAIFPFVMKLF-VYVKKREAMKAQNN 491

>CAGL0B03971g complement(390700..392331) similar to sp|P47090
           Saccharomyces cerevisiae YJR015w or sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1, hypothetical
           start
          Length = 543

 Score =  392 bits (1007), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 196/469 (41%), Positives = 287/469 (61%), Gaps = 8/469 (1%)

Query: 70  SAAGSQPQAYNPDGQNTAKPAVTQPEENEENVPISPTKTRLYSPKLASQRKKITVKFIIS 129
           S     PQAY P  +   K   TQ    E    ++ TKTR +SP    QRK++  +++++
Sbjct: 70  SEEAKDPQAYAPGPEGDEKGKPTQNNNPEPTNTLTKTKTRFFSPNFKDQRKRVAYRWLLA 129

Query: 130 NLLLAGVCLSILSLYWGSLYQTTKHLERXXXXXXXXXXXXPP-ND-LNLTSVVAPVPSFI 187
             LL   C +IL L WG LY+T  ++ R               ND +   SV +P+   I
Sbjct: 130 VFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQVYRFNDTVQFPSVSSPLYDII 189

Query: 188 EQSTGKWHVYNQSYFQEKFNVQDPTMINERLNALIHDEKYWIALNIGANLTMRIVNSLTT 247
            +    W +YN + FQ K+NV+    +N+++  L++ E++W+ALN+  N+T  +V SL +
Sbjct: 190 AEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEFWLALNVQGNVTDTLVRSLIS 249

Query: 248 PNEPF-FNSTQHIRVVYETSREPTTLEAYMLPIIQEIELAYQDFYHTEYLPELLSKLQNS 306
            +    FNST    VVYE+ R+ T L + +LP+ Q IE  +Q  Y  +YLP+LL  + N 
Sbjct: 250 ADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGVFQKVYTYQYLPQLLGNITNG 309

Query: 307 TTTPLSNTGAANLANIGKFQFDYDDILVFPDRILIAPLQVGLIYCLILTVFQLSLFGPLH 366
                 N   A +A  G+ +F+Y+D     DR+ +   Q+G +YCL+LTVFQ  +FGPLH
Sbjct: 310 -----DNFNPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGAVYCLLLTVFQFLVFGPLH 364

Query: 367 AEMAKYLKPKHIIIYRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIYWMTTYL 426
            EM++ +K  ++ IYRL V W+  FF+S+F+CTVSA++Q+DFT  FG+ GFV+YWM+TYL
Sbjct: 365 GEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDFTKAFGRAGFVVYWMSTYL 424

Query: 427 VMLALGGANENVLSLIILFIPEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGYMMPLHQ 486
            MLA+GG NENV+ LIIL  P Y+  W+LS++I+N++P F  +   NVFYRYGY MPLH 
Sbjct: 425 YMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFAIGYANVFYRYGYAMPLHC 484

Query: 487 ALDIFKVVFLNVSKRHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQKR 535
            + I +V+F ++SK  +GRNYGIL AW+ +NT   P V K V KT+ KR
Sbjct: 485 IVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFVLKTLHKR 533

>CAGL0B03949g complement(387861..389759) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 or sp|P47090
           Saccharomyces cerevisiae YJR015w, hypothetical start
          Length = 632

 Score =  389 bits (999), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 189/459 (41%), Positives = 287/459 (62%), Gaps = 9/459 (1%)

Query: 89  PAVTQPEENEENVPISPT------KTRLYSPKLASQRKKITVKFIISNLLLAGVCLSILS 142
           PAV   +E +    +S T      KT L+S ++   R++I  KFI +++LLA   +  LS
Sbjct: 144 PAVMADDEGDVISRVSSTASQWKKKTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALS 203

Query: 143 LYWGSLYQTTKHLERXXXXXXXXXX-XXPPNDLNLTSVVAPVPSFIEQSTGKWHVYNQSY 201
           LYWG++Y  + +L R              P+   + ++   V + I    G W + N + 
Sbjct: 204 LYWGAIYNYSGNLYRVHSIAVIQDEPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTE 263

Query: 202 FQEKFNVQDPTMINERLNALIHDEKYWIALNIGANLTMRIVNSLTTPNEPFFNSTQHIRV 261
           F+  +NV +   I+E++  LI DEK+W+A+N+    T     S+T    P FNST + + 
Sbjct: 264 FKVIYNVTNAQEIDEKVAELIFDEKFWLAVNVREGATEAFYKSVTEEGAPVFNSTNYFQS 323

Query: 262 VYETSREPTTLEAYMLPIIQEIELAYQDFYHTEYLPELLSKLQNSTTTPLSNTGAANLAN 321
           +YE+ R+PT L++ + PI+ + E  ++  Y   Y+PE +  + +       NT  ANL  
Sbjct: 324 IYESGRDPTNLKSSIYPILAKFESVFRSQYLKIYVPEFIKNITSPDFNETVNT--ANLYG 381

Query: 322 IGKFQFDYDDILVFPDRILIAPLQVGLIYCLILTVFQLSLFGPLHAEMAKYLKPKHIIIY 381
           +G F  +  D+  F DR+L+ PL +GL Y ++ +VF +S+FGP++ EMAKYLKP+ +  Y
Sbjct: 382 LGNFATNSYDLRPFTDRVLLGPLSMGLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFY 441

Query: 382 RLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIYWMTTYLVMLALGGANENVLSL 441
           R+ +SW+ +FFLSLF CTVSAIFQIDFT  FGK GFVIYWMT++LVM A+G ANEN+LS+
Sbjct: 442 RILISWSMFFFLSLFTCTVSAIFQIDFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSI 501

Query: 442 IILFIPEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGYMMPLHQALDIFKVVFLNVSKR 501
           I+ F P+Y+  W++ W I+NI+P+  P+VL + FYR+GY MP+H  + I++V+FL++S+ 
Sbjct: 502 ILTFCPQYMSYWMIIWTILNIAPSLYPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRH 561

Query: 502 HMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQKRMEAKK 540
            M RNYGIL AW+ VNT + P V K + K V+KR E K+
Sbjct: 562 QMSRNYGILAAWVAVNTAINPFVNKFISKVVKKREERKE 600

>Scas_647.9
          Length = 449

 Score =  375 bits (963), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 175/422 (41%), Positives = 263/422 (62%), Gaps = 4/422 (0%)

Query: 115 LASQRKKITVKFIISNLLLAGVCLSILSLYWGSLYQTTKHLERXXXXXXXXXXXXPPNDL 174
           +  +RK + + F  +N +LA  C +I  L+WG  Y+ T    R              N+ 
Sbjct: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGI--NNS 58

Query: 175 NLTSVVAPVPSFIEQSTGKWHVYNQSYFQEKFNVQDPTMINERLNALIHDEKYWIALNIG 234
            +  + + +P+ ++++   WH+YN + F EKF       I++ +   +  E YW+ALN+ 
Sbjct: 59  TVLPMASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVK 118

Query: 235 ANLTMRIVNSLTTPNEPFFNSTQHIRVVYETSREPTTLEAYMLPIIQEIELAYQDFYHTE 294
            N T  +  +   PN P FNST++ + V+ ++R+P+     +LP+I+ +E AY+++Y   
Sbjct: 119 PNATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINT 178

Query: 295 YLPELLSKLQNSTTTPLSNTGAANLANIGKFQFDYDDILVFPDRILIAPLQVGLIYCLIL 354
           Y P+ +S +  S    L+     N+A  G   FDY D   F +R LIAP+ +G+ YCL+L
Sbjct: 179 YFPQFMSNV--SIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLL 236

Query: 355 TVFQLSLFGPLHAEMAKYLKPKHIIIYRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGK 414
           T FQ  ++  LHAE ++ LKP  +I YR+ + W T F  SLFFCT SAIFQ+DFT  FGK
Sbjct: 237 TFFQFLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGK 296

Query: 415 GGFVIYWMTTYLVMLALGGANENVLSLIILFIPEYLPLWLLSWIIMNISPTFNPMVLDNV 474
           GGFV+YWMTT+L M+A GG NEN +SL+ L  P +L +W+LS+II+NI+PTF P++L N 
Sbjct: 297 GGFVVYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANP 356

Query: 475 FYRYGYMMPLHQALDIFKVVFLNVSKRHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQK 534
            YRYGYMMP+H A+DI++V+FL++SK  MGRN+G+L+AWI +NT   P V K V K +  
Sbjct: 357 VYRYGYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKILTN 416

Query: 535 RM 536
           R+
Sbjct: 417 RV 418

>ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH]
           (357909..359306) [1398 bp, 465 aa]
          Length = 465

 Score =  270 bits (689), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 149/426 (34%), Positives = 246/426 (57%), Gaps = 12/426 (2%)

Query: 103 ISPTKTRLYSPKLASQRKKITVKFIISNLLLAGVCLSILSLYWGSLYQTTKHLERXXXXX 162
           ++  KTR  SP++   RK++ V F+ + L LA + L + SL+ G L    ++L R     
Sbjct: 44  LARLKTRFMSPRVYLARKRLLVLFLSNKLFLACLVLVVFSLHVGVLVNQQQYLGRLPMLM 103

Query: 163 XXXXXXXPPNDLNLTSVVAPVPSFIEQSTGKWHVYNQSYFQEKFNVQDPTMINERLNALI 222
                     D  ++   A +    E + G+W   + +     F +++   ++E L +LI
Sbjct: 104 VV-----QDEDAGMS---AELLRAAEHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLI 155

Query: 223 HDEKYWIALNIGANLTMRIVNSLTTPNEPFFNSTQHIRVVYETSREPTTLEAYMLPIIQE 282
              +YW+AL++    T  +  SL  P  P FNS++  +V YET R+   + + +  +++ 
Sbjct: 156 RKHRYWMALHVRPGATEALRRSLDDPGAPVFNSSEFFKVYYETVRDFNAMGS-VRKLMET 214

Query: 283 IELAYQDFYHTEYLPELLSKLQNSTTTPLSNTGAANLANIGKFQFDYDDILVFPDRILIA 342
           +E  ++ +Y   +LP  L +  N  T  LS+TG+ N+   G  ++ Y D+  F D  L  
Sbjct: 215 LEANFRAYYLDTWLPGELRERAN--TIDLSSTGS-NIVAAGSMRWSYVDLGPFYDPSLYG 271

Query: 343 PLQVGLIYCLILTVFQLSLFGPLHAEMAKYLKPKHIIIYRLSVSWATYFFLSLFFCTVSA 402
            LQVG+I CL+LT FQL++   LH E++  L+  H+++YR  VS+A+Y  LSLF+  V  
Sbjct: 272 ILQVGMIICLLLTFFQLAMISALHTELSLLLRTSHLLLYRYIVSYASYLLLSLFYSIVPI 331

Query: 403 IFQIDFTVTFGKGGFVIYWMTTYLVMLALGGANENVLSLIILFIPEYLPLWLLSWIIMNI 462
           I+ +D    +G+ GF+++WMTT+L M ALGGANENV+S+I  + P ++  WL+ WI+ NI
Sbjct: 332 IYHLDMEKAYGRAGFLVFWMTTWLFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNI 391

Query: 463 SPTFNPMVLDNVFYRYGYMMPLHQALDIFKVVFLNVSKRHMGRNYGILVAWIVVNTCLFP 522
           +PTF  + L N FY+YGY+ P++ A + +KV+  +  + ++   Y +LVAW V+N  LFP
Sbjct: 392 TPTFYSLHLANDFYKYGYITPIYNARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALFP 451

Query: 523 LVMKIV 528
           L +KIV
Sbjct: 452 LALKIV 457

>Scas_434.1
          Length = 357

 Score =  171 bits (432), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 93/286 (32%), Positives = 156/286 (54%), Gaps = 13/286 (4%)

Query: 83  GQNTAKPAVTQPEENEENVPISPTKTRLYSPKLASQRKKITVKFIISNLLLAGVCLSILS 142
           G++ A    + PE       ++P KT L+SP L   RKKI  KFI  N ++   C ++L 
Sbjct: 81  GEDEAITIASLPE-------LAPAKTTLFSPHLTQHRKKIFWKFISINAIIGLFCCTVLP 133

Query: 143 LYWGSLYQTTKHLERXXXXXXXXXXXXPPNDLNLTSVVAPVPSFIEQSTGKWHVYNQSYF 202
           ++WG LY T ++  +                L++ S+ + +P  +    G WHVYN S F
Sbjct: 134 IFWGCLYGTNQYFHKVHYLMVVQDEPLQLGGLSVPSMASFLPEIVPSLPGTWHVYNTSTF 193

Query: 203 QEKFNVQDPTMINERLNALIHDEKYWIALNIGANLTMRIVNSLTTPN----EPFFNSTQH 258
            + +++ + + IN ++  LI  E++W+A+N+  N T  ++ SL  P     E  FN+T  
Sbjct: 194 MDHYHLTNASDINNKVVDLIFQERFWVAVNVKPNATASLMQSLVQPQSTTPETLFNATNF 253

Query: 259 IRVVYETSREPTTLEAYMLPIIQEIELAYQDFYHTEYLPELLSKLQNSTTTPLSNTGAAN 318
            +V+YET+R+ T+++A M+ ++QE+E AY++ Y  +YLP +L+++    T  +S+    +
Sbjct: 254 FQVIYETARDVTSVQAAMVLVVQEMESAYREIYMEQYLPTILAQM--DPTNQISSLAPTS 311

Query: 319 LANIGKFQFDYDDILVFPDRILIAPLQVGLIYCLILTVFQLSLFGP 364
           L+      F Y D   F +R L+ PL  G IY L +TVFQ  +F P
Sbjct: 312 LSRATNINFQYWDYRSFYNRALMGPLLAGTIYSLTITVFQFLIFTP 357

>Scas_617.0d
          Length = 46

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 39/45 (86%)

Query: 490 IFKVVFLNVSKRHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQK 534
           ++KV+F ++ +  MGRNYGILVAWIV+NTCLFP +MK VGKT+Q+
Sbjct: 2   VYKVIFCDLERSKMGRNYGILVAWIVLNTCLFPFIMKFVGKTLQE 46

>KLLA0E21989g 1954118..1955761 similar to sp|P40215 Saccharomyces
           cerevisiae YMR145c NDH1 mitochondrial cytosolically
           directed NADH dehydrogenase, start by similarity
          Length = 547

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 5/63 (7%)

Query: 170 PPNDLNLTSVVAPVPSFIEQSTGKWHVYNQSYFQEKFNVQDPTMINERLNALIHDEKYWI 229
           P   + L S+V PV S    S G+ H     Y++ +    DP     R+ +   D  Y +
Sbjct: 145 PVGTVELKSIVEPVRSITRSSPGEVH-----YYEAEAKDIDPVAKTVRIKSATKDHDYEL 199

Query: 230 ALN 232
            LN
Sbjct: 200 DLN 202

>CAGL0K08580g complement(864641..866002) similar to sp|Q01802
           Saccharomyces cerevisiae YKL106w Aspartate
           aminotransferase, hypothetical start
          Length = 453

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 290 FYHTEYLPELLSKLQNSTTTPLSNTGAANLANIGKFQFDY 329
           FY T+  P+++ KL+   +  L+N G  +L+ + K   DY
Sbjct: 399 FYFTKLGPDIVKKLREQYSIYLTNDGRMSLSGVNKSNVDY 438

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,767,669
Number of extensions: 787454
Number of successful extensions: 3180
Number of sequences better than 10.0: 53
Number of HSP's gapped: 3262
Number of HSP's successfully gapped: 53
Length of query: 541
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 435
Effective length of database: 12,926,601
Effective search space: 5623071435
Effective search space used: 5623071435
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)