Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_615.994294249090.0
YDR270W (CCC2)100494223160.0
KLLA0F07447g97594522560.0
Kwal_55.2157598993021880.0
CAGL0M08602g101295021760.0
ACR086C81077414230.0
KLLA0D04092g11529447852e-88
AGL041C12339607484e-83
YBR295W (PCA1)12169197299e-81
YGL008C (PMA1)9185542511e-21
AGL085C9095802403e-20
YPL036W (PMA2)9475242394e-20
KLLA0A09031g8996442342e-19
Scas_688.19135622314e-19
Kwal_47.175228995542162e-17
CAGL0A00495g9025561931e-14
YGL167C (PMR1)9502771742e-12
Scas_707.48*7412771732e-12
AEL301W9571501714e-12
CAGL0I04312g9511311706e-12
CAGL0J01870g9462071662e-11
Kwal_14.14989391481652e-11
KLLA0A03157g9381481634e-11
Kwal_47.1754712402821601e-10
Scas_710.419041991528e-10
CAGL0K12034g10871601482e-09
YGL006W (PMC1)11732621483e-09
Kwal_23.316011003041465e-09
KLLA0F20658g10821601447e-09
KLLA0E14630g10821601412e-08
CAGL0A00517g11222481412e-08
YDR038C (ENA5)10911511375e-08
KLLA0A08910g12802401375e-08
YDR039C (ENA2)10911511375e-08
YDR040C (ENA1)10911511322e-07
AGL097C10961601303e-07
Scas_297.1800691124e-05
AFL011W12422441125e-05
Scas_569.0d468631071e-04
AFR567W144950980.002
Scas_665.30143975900.017
KLLA0B08217g143949900.019
CAGL0M11308g145249880.031
Kwal_26.9207146951870.037
YOR291W147250790.37
Scas_583.14*87557770.58
AFR354C121076760.77
AFR206C44283731.4
KLLA0E22352g1206118741.5
YDR440W (DOT1)582105722.1
CAGL0G06270g132845722.1
YEL031W (SPF1)121552713.1
KLLA0C08393g114842713.1
CAGL0L01419g121452703.9
AFL191W157544694.8
KLLA0D02618g132838695.4
Scas_654.1336089677.2
Scas_89.127166659.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_615.9
         (942 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_615.9                                                           1895   0.0  
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...   896   0.0  
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...   873   0.0  
Kwal_55.21575                                                         847   0.0  
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...   842   0.0  
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...   552   0.0  
KLLA0D04092g complement(344666..348124) some similarities with s...   306   2e-88
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...   292   4e-83
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...   285   9e-81
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...   101   1e-21
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    97   3e-20
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    97   4e-20
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    95   2e-19
Scas_688.1                                                             94   4e-19
Kwal_47.17522                                                          88   2e-17
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    79   1e-14
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    72   2e-12
Scas_707.48*                                                           71   2e-12
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    70   4e-12
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    70   6e-12
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    69   2e-11
Kwal_14.1498                                                           68   2e-11
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    67   4e-11
Kwal_47.17547                                                          66   1e-10
Scas_710.41                                                            63   8e-10
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    62   2e-09
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    62   3e-09
Kwal_23.3160                                                           61   5e-09
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    60   7e-09
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    59   2e-08
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    59   2e-08
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    57   5e-08
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    57   5e-08
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    57   5e-08
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    55   2e-07
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    55   3e-07
Scas_297.1                                                             48   4e-05
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    48   5e-05
Scas_569.0d                                                            46   1e-04
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    42   0.002
Scas_665.30                                                            39   0.017
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    39   0.019
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    39   0.031
Kwal_26.9207                                                           38   0.037
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    35   0.37 
Scas_583.14*                                                           34   0.58 
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    34   0.77 
AFR206C [3398] [Homologous to ScYKL140W (TGL1) - SH] (807181..80...    33   1.4  
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    33   1.5  
YDR440W (DOT1) [1261] chr4 (1342481..1344229) Histone H3 methylt...    32   2.1  
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    32   2.1  
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    32   3.1  
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    32   3.1  
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    32   3.9  
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    31   4.8  
KLLA0D02618g complement(220267..224253) similar to sgd|S0004417 ...    31   5.4  
Scas_654.13                                                            30   7.2  
Scas_89.1                                                              30   9.5  

>Scas_615.9
          Length = 942

 Score = 1895 bits (4909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 925/942 (98%), Positives = 925/942 (98%)

Query: 1   MVDGLGSTTLYKGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKV 60
           MVDGLGSTTLYKGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKV
Sbjct: 1   MVDGLGSTTLYKGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKV 60

Query: 61  SLELIRETVEDCGFDAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSVSM 120
           SLELIRETVEDCGFDAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSVSM
Sbjct: 61  SLELIRETVEDCGFDAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSVSM 120

Query: 121 EDTEKVGKQDGILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVS 180
           EDTEKVGKQDGILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVS
Sbjct: 121 EDTEKVGKQDGILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVS 180

Query: 181 SATQLALLSKWDEIQFWKFTCLKACVCAIVAMALYMWIPMIFPNLIKNNHFPFKETFFVH 240
           SATQLALLSKWDEIQFWKFTCLKACVCAIVAMALYMWIPMIFPNLIKNNHFPFKETFFVH
Sbjct: 181 SATQLALLSKWDEIQFWKFTCLKACVCAIVAMALYMWIPMIFPNLIKNNHFPFKETFFVH 240

Query: 241 GLFYRDIIGWAIATYSQFRLGIYFYKAAWSSMKHGSGTMDTLIALSTSCAYLFSIFSIIH 300
           GLFYRDIIGWAIATYSQFRLGIYFYKAAWSSMKHGSGTMDTLIALSTSCAYLFSIFSIIH
Sbjct: 241 GLFYRDIIGWAIATYSQFRLGIYFYKAAWSSMKHGSGTMDTLIALSTSCAYLFSIFSIIH 300

Query: 301 TMVLSRGNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKLIQLTPSKCII 360
           TMVLSRGNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKLIQLTPSKCII
Sbjct: 301 TMVLSRGNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKLIQLTPSKCII 360

Query: 361 LQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHK 420
           LQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHK
Sbjct: 361 LQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHK 420

Query: 421 QKGSQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVP 480
           QKGSQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVP
Sbjct: 421 QKGSQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVP 480

Query: 481 TILCLSIITFITWITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPT 540
           TILCLSIITFITWITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPT
Sbjct: 481 TILCLSIITFITWITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPT 540

Query: 541 AIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYSNDDLPVL 600
           AIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYSNDDLPVL
Sbjct: 541 AIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYSNDDLPVL 600

Query: 601 PCIMAAQSISEHPVAKAIVNYCGESSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYTVT 660
           PCIMAAQSISEHPVAKAIVNYCGESSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYTVT
Sbjct: 601 PCIMAAQSISEHPVAKAIVNYCGESSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYTVT 660

Query: 661 VGHKALXXXXXXXXXXXXXXXXXTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHY 720
           VGHKAL                 TKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHY
Sbjct: 661 VGHKALMTDSMFDSNSDNTSDDFTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHY 720

Query: 721 DIYMVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGIND 780
           DIYMVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGIND
Sbjct: 721 DIYMVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGIND 780

Query: 781 SPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRVKWNL 840
           SPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRVKWNL
Sbjct: 781 SPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRVKWNL 840

Query: 841 FWALGYNIFMIPIAMGILVPWGITIHPMVAGLAMALSSVFVVLNSLRLKSWKPPVIGDEH 900
           FWALGYNIFMIPIAMGILVPWGITIHPMVAGLAMALSSVFVVLNSLRLKSWKPPVIGDEH
Sbjct: 841 FWALGYNIFMIPIAMGILVPWGITIHPMVAGLAMALSSVFVVLNSLRLKSWKPPVIGDEH 900

Query: 901 PLSSDYYHHKGTSWIRSGWRKLFGMSSEVVYQDLELQEGLVD 942
           PLSSDYYHHKGTSWIRSGWRKLFGMSSEVVYQDLELQEGLVD
Sbjct: 901 PLSSDYYHHKGTSWIRSGWRKLFGMSSEVVYQDLELQEGLVD 942

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/942 (52%), Positives = 648/942 (68%), Gaps = 36/942 (3%)

Query: 12  KGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRETVED 71
           +G L+VQGMTC +C S +  QV  ++GV SV VSLVT ECHV ++  K +LE  RE +ED
Sbjct: 81  EGLLSVQGMTCGSCVSTVTKQVEGIEGVESVVVSLVTEECHVIYEPSKTTLETAREMIED 140

Query: 72  CGFDAQVLTSTPMGSADADIV-RTVTFKVLRSNYDVSSGFSAESGDSVSMEDTEKVGKQD 130
           CGFD+ ++     G+ +AD+  +TV  KV ++  D S    +      S+ +  +     
Sbjct: 141 CGFDSNIIMD---GNGNADMTEKTVILKVTKAFEDESPLILS------SVSERFQFLLDL 191

Query: 131 GILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVSSATQLALLSK 190
           G+ S+E + +++T  I Y  N++GIRDL+      GY  TV S+    + + TQL LLSK
Sbjct: 192 GVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSN----LDNTTQLRLLSK 247

Query: 191 WDEIQFWKFTCLKACVCAIVAMALYMWIPMIFPNLIKNNHFPFKETFFVHGLFYRDIIGW 250
            DEI+FWK   +K+ + AI+ M LYM +PM++P ++++  FP+KET FV GLFYRDI+G 
Sbjct: 248 EDEIRFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSFVRGLFYRDILGV 307

Query: 251 AIATYSQFRLGIYFYKAAWSSMKHGSGTMDTLIALSTSCAYLFSIFSIIHTMVLSRGNEE 310
            +A+Y QF +G YFYKAAW+S+KHGSGTMDTL+ +ST+CAY FS+FS++H M       +
Sbjct: 308 ILASYIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSLVHNMFHPSSTGK 367

Query: 311 SPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKLIQLTPSKCIILQDKNNIQSS 370
              LP +VFDTS+M+I++IS GK LE  AK+QTS++LSKLIQLTPS C I+ D    ++ 
Sbjct: 368 ---LPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETK 424

Query: 371 HIEIETNLLQRNDIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHKQKGSQVIAGS 430
            I IE  LLQ NDI+EIKPGMKIPADGII +GESEIDESLMTGESILV K+ G  VIAGS
Sbjct: 425 EIPIE--LLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGFPVIAGS 482

Query: 431 LNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCLSIITF 490
           +NGPGHFYF+   +G++TKLA II+ MK AQL+KAPIQ  ADYLASIFVP IL L+++TF
Sbjct: 483 VNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTF 542

Query: 491 ITWITLSNLLTKPPVIFTNNNNG-KFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIG 549
             W  + N+   PPV FT N     F+   Q A SV++VACPCALGLATPTAIMVGTG+G
Sbjct: 543 FIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVG 602

Query: 550 AQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYSN-----DDLPVLPCIM 604
           AQ+GVLIKGG++LE+FN+IT  VFDKTGT+TTG M V++F+  SN     D+  VL CI 
Sbjct: 603 AQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVLACIK 662

Query: 605 AAQSISEHPVAKAIVNYCGESSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYTVTVGHK 664
           A +SIS+HPV+KAI+ YC   + +     +V +SE ++GKG+  +C+  G  Y + +G++
Sbjct: 663 ATESISDHPVSKAIIRYCDGLNCNKALNAVVLESEYVLGKGIVSKCQVNGNTYDICIGNE 722

Query: 665 ALXXXXXXXXX---XXXXXXXXTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYD 721
           AL                    T SYVS+N  + G FEI D VK D    +QYLQ   Y+
Sbjct: 723 ALILEDALKKSGFINSNVDQGNTVSYVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYE 782

Query: 722 IYMVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGG--VAFVGDGIN 779
            YM+TGD++ AA +VA++VGI+  NVYS V+P+GKC++V+ +Q D  G   VA VGDGIN
Sbjct: 783 TYMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQ-DKEGNNKVAVVGDGIN 841

Query: 780 DSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRVKWN 839
           D+P L  SD+G+A+STGT+IA+EAADIV+L  +     SL+GL  A+DIS  TF R+K N
Sbjct: 842 DAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKLN 901

Query: 840 LFWALGYNIFMIPIAMGILVPWGITIHPMVAGLAMALSSVFVVLNSLRLKSWKPPVIGDE 899
           LFWAL YNIFMIPIAMG+L+PWGIT+ PM+AGLAMA SSV VVL+SL LK W PP I + 
Sbjct: 902 LFWALCYNIFMIPIAMGVLIPWGITLPPMLAGLAMAFSSVSVVLSSLMLKKWTPPDI-ES 960

Query: 900 HPLSSDYYHHKGTSWIRSGWRKLFGMSSEVVYQDLELQEGLV 941
           H +S      K    I + W +LF   +    QD+E Q GL+
Sbjct: 961 HGISD----FKSKFSIGNFWSRLFSTRAIAGEQDIESQAGLM 998

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 81/157 (51%), Gaps = 15/157 (9%)

Query: 15  LAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRETVEDCGF 74
           LAV GMTCSACT+ I  Q+  L GV   ++SLVT+EC V +  E V+ + I+E +EDCGF
Sbjct: 6   LAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNE-VTADSIKEIIEDCGF 64

Query: 75  DAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSVSMEDTEKVGKQDGILS 134
           D ++L        D++I    T + L S   ++ G       S     T++V   +G+ S
Sbjct: 65  DCEIL-------RDSEITAISTKEGLLSVQGMTCG-------SCVSTVTKQVEGIEGVES 110

Query: 135 LEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATV 171
           +  +L     ++ Y+ +K  +          G+D+ +
Sbjct: 111 VVVSLVTEECHVIYEPSKTTLETAREMIEDCGFDSNI 147

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/945 (51%), Positives = 636/945 (67%), Gaps = 62/945 (6%)

Query: 7   STTLYKGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIR 66
           +T    G L V GMTC AC   +  QV KL GV   +VSLVT EC V+F     S+  I 
Sbjct: 83  TTEQISGILLVSGMTCGACVKTVTGQVLKLSGVLECDVSLVTEECKVKFDPHFTSMAEIA 142

Query: 67  ETVEDCGFDAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSVSMEDTEKV 126
           E ++DCGFDA+V++         +  + +  K+         G  +ES D   +E   KV
Sbjct: 143 ECIDDCGFDAKVISENSSSVPSNE--KRLCLKIF--------GMLSES-DRADIE--SKV 189

Query: 127 GKQDGILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVSSATQLA 186
            +  G++S++ +L+     + +D N+IG RD+I     +G+   + ++    + ++TQL+
Sbjct: 190 SELKGVISIDTSLQSEEATVIHDANEIGNRDIIDCIEEMGFQTFISNT----LDNSTQLS 245

Query: 187 LLSKWDEIQFWKFTCLKACVCAIVAMALYMWIPMIFPNLIKNNHFPFKETFFVHGLFYRD 246
           LLSK  EIQFWK  C++  + +I+ M LYM +PM+FP ++   HFPF +T  + GLFYRD
Sbjct: 246 LLSKTKEIQFWKKNCIRGGISSILIMGLYMCVPMLFPAVL--THFPFVQTPII-GLFYRD 302

Query: 247 IIGWAIATYSQFRLGIYFYKAAWSSMKHGSGTMDTLIALSTSCAYLFSIFSIIHTMVLSR 306
           IIG  I TY Q  +G YFYKAAW S+KHGSGTMDTLI LST CAY+FS +SII ++    
Sbjct: 303 IIGIIITTYVQIYVGSYFYKAAWISLKHGSGTMDTLIGLSTVCAYIFSCYSIISSIY--- 359

Query: 307 GNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKLIQLTPSKC-IILQDKN 365
              +S  +P V+FDT+VML+ FIS GKLLENKAK++TS+++SKLI LTPS C I+L D  
Sbjct: 360 --HKSTKMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIVLPD-- 415

Query: 366 NIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHKQKGSQ 425
               S  EI   LLQ NDI+E+ PGMKIPADG++I+ E+E+DESL+TGES+LV K  GSQ
Sbjct: 416 ---GSTREISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVGSQ 472

Query: 426 VIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCL 485
           VI GS+NGPGHFYF+AI +G+DTKLA II TMK AQL+KAPIQ  AD +A IFVP ++ L
Sbjct: 473 VIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISL 532

Query: 486 SIITFITWITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVG 545
           S ITFITW+ +S  +  PP+IF N+ NGKF+   Q++ISVI+VACPCALGLA PTAIMVG
Sbjct: 533 SAITFITWMLVSYTMKTPPLIF-NSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVG 591

Query: 546 TGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYSND--DLPVLPCI 603
           TG+GA HGVLIKGGD+LE+ + +   +FDKTGT+TTG+M+V+ FI Y++D  DL     I
Sbjct: 592 TGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVENFINYNSDVSDLH-WKMI 650

Query: 604 MAAQSISEHPVAKAIVNYCG-----ESSQDCDAGVIVTKSEIIIGKGVRCEC--EYQGRN 656
              +SI EHPVAKAIVNY        S  D D    ++  E++IGKG+ C    +   + 
Sbjct: 651 SLCESIGEHPVAKAIVNYADSHVNKSSIFDLD----LSNEEVLIGKGISCNITDKNTSKI 706

Query: 657 YTVTVGHKALXXXXXXXXXXXXXXXXXTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQ 716
           +T+T+G+K L                 T+SYVSI+ +LVGKFEI D VKED   +++YLQ
Sbjct: 707 HTITIGNKKL---FPDESLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQ 763

Query: 717 GLHYDIYMVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGVAFVGD 776
            L     MVTGD+H +A+KVAQQ+GI+AN+V+S VTP  K +IV  LQ +    VAFVGD
Sbjct: 764 NLGIKCCMVTGDAHQSALKVAQQLGISANDVFSEVTPEQKRDIVIQLQNNGTERVAFVGD 823

Query: 777 GINDSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRV 836
           GINDSP LV +D+G+++S+GTDIA+EAADIV+L +D ++  SLKGL+YALDI+  TF RV
Sbjct: 824 GINDSPALVEADLGISISSGTDIAIEAADIVILDSD-NKNNSLKGLVYALDIARKTFYRV 882

Query: 837 KWNLFWALGYNIFMIPIAMGILVPWGITIHPMVAGLAMALSSVFVVLNSLRLKSWKPPVI 896
           K N FWA+ YN FMIPIAMG+L PWGIT+HPM++  AMALSSV VV +SL LK W PP +
Sbjct: 883 KLNFFWAVCYNTFMIPIAMGLLAPWGITLHPMLSSAAMALSSVSVVCSSLMLKRWTPPSL 942

Query: 897 GDEHPLSSDYYHHKGTSWIRSGWRKLFGMSSEVVYQDLELQEGLV 941
             +   +S      G SW+R G     G        D+ELQE L+
Sbjct: 943 NIKSMEASG-----GLSWLRFGRNSNRG-------DDIELQERLM 975

>Kwal_55.21575
          Length = 989

 Score =  847 bits (2188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/930 (48%), Positives = 617/930 (66%), Gaps = 46/930 (4%)

Query: 15  LAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRETVEDCGF 74
           L+VQ MTC AC + I   +   +GV  V VSL T EC VEF    V+   ++  ++D GF
Sbjct: 92  LSVQHMTCGACVATITNNLEAQEGVLEVAVSLATEECRVEFDPAVVTAAELKGIIDDSGF 151

Query: 75  DAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSVSMEDTEKVGKQDGILS 134
           +A+++            VR  T KVL        G +   G  VS  ++  + ++ G++S
Sbjct: 152 EAEIINDDAERPTRGSTVRKATLKVL--------GMTC--GACVSTVES-ALSQEPGVVS 200

Query: 135 LEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVSSATQLALLSKWDEI 194
           ++ +L      + Y+   IG+R +      LG+    ES+ + S +S  Q+ LL+K  EI
Sbjct: 201 IQVSLATEEAQLEYNPAVIGVRAIASKIEDLGF----ESAPVNSFNSVAQVNLLAKVREI 256

Query: 195 QFWKFTCLKACVCAIVAMALYMWIPMIFPNLIKNNHFPFKETFFVHGLFYRDIIGWAIAT 254
            FWK TC+++C   ++ + LY   P+  P     N F +K+T  + GLFYRDIIG+ I  
Sbjct: 257 NFWKRTCVQSCCFMVLMLLLYKAGPLWIP---ARNLFFYKQTG-IPGLFYRDIIGFIITC 312

Query: 255 YSQFRLGIYFYKAAWSSMKHGSGTMDTLIALSTSCAYLFSIFSIIHTMVLSRGNEESPML 314
           Y QF +G +FY A W S++HGSG+MDT++ LST C++ FS++SI   +      ++S  +
Sbjct: 313 YVQFWVGWHFYPAGWKSIRHGSGSMDTVVLLSTLCSFAFSLYSIAMNVA-----KKSERM 367

Query: 315 PNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEI 374
           PNV+FD SVMLI FIS GKLLENKAK++T++SLSKL+ L PS C I++   N ++  I +
Sbjct: 368 PNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIE---NGKAREIPV 424

Query: 375 ETNLLQRNDIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHKQKGSQVIAGSLNGP 434
           E   LQ  D +EIKPG KIP DG+II+GESE+DESL+TGES++V + KG  VIAGS+NGP
Sbjct: 425 E--FLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPRYKGFPVIAGSINGP 482

Query: 435 GHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCLSIITFITWI 494
             F   A ++GDDTKLAQIIQTMK AQL+KAPIQ+ ADYLAS FVP++L L++ITF+TW 
Sbjct: 483 NRFLLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWT 542

Query: 495 TLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIGAQHGV 554
            LS +L+ PP IF ++ NGKF+   ++ ISVIVVACPCALGLA PTAIMVGTG+GA+HGV
Sbjct: 543 ILSRVLSNPPSIF-DSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGV 601

Query: 555 LIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYS-NDDLPV--LPCIMAAQSISE 611
           LIKGGDILE+ +++   +FDKTGT+TTG MTV++F+P    D+L    L CI A++++SE
Sbjct: 602 LIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLTTEELLCINASEAVSE 661

Query: 612 HPVAKAIVNYCGESSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYTVTVGHKALXXXXX 671
           HPV KAIV +     +DCD   +VTKS+ I+G G+ C+CE  G+ Y V +G++ +     
Sbjct: 662 HPVGKAIVEFTDSLIEDCDRTAVVTKSKTILGGGLICDCELDGKAYHVVIGNRNVMQDMS 721

Query: 672 XXXXXXXXXXXXTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHG 731
                       T +YV IN  LVG+FEI D +K+D A+++QYL    + + MVTGD+H 
Sbjct: 722 LSADASS-----TLAYVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHK 776

Query: 732 AAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGV 791
           +AMKVA ++GI ANNVYS +TP+ K ++V+ LQ      VAF+GDGINDSP LVTSD+GV
Sbjct: 777 SAMKVALELGIEANNVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGV 836

Query: 792 ALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRVKWNLFWALGYNIFMI 851
           ++STGTDIAMEAAD+++L   ++   SL+ LIYALDI+  TF RVK N FWA+ YN+FM+
Sbjct: 837 SISTGTDIAMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFML 896

Query: 852 PIAMGILVPWGITIHPMVAGLAMALSSVFVVLNSLRLKSWKPPVIGDEHPLSSDYYHHKG 911
           PIAMG+LVPW IT+ P+VA   MA SSV VV NSL L  WKPP + D  P S      K 
Sbjct: 897 PIAMGVLVPWEITMDPIVAVACMAASSVSVVGNSLLLNLWKPPKL-DVSPKS-----QKP 950

Query: 912 TSWIRSGWRKLFGMSSEVVYQDLELQEGLV 941
           ++W R     LF     V   D+ELQ GL+
Sbjct: 951 SAWSR--ISALFRREKSVRPDDIELQTGLI 978

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 71/157 (45%), Gaps = 10/157 (6%)

Query: 15  LAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRETVEDCGF 74
           L V+GMTC AC + I +Q+ ++ GV  V VSL+T EC V F+ E    E ++  + DCGF
Sbjct: 9   LLVEGMTCGACVATIESQLKRIKGVDEVTVSLITGECEVRFEKEDTDEETLKGAIIDCGF 68

Query: 75  DAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSVSMEDTEKVGKQDGILS 134
            A VL    + +    I R     VL   +       A          T  +  Q+G+L 
Sbjct: 69  SATVLRVQDVEA--GQIARQRKTAVLSVQHMTCGACVATI--------TNNLEAQEGVLE 118

Query: 135 LEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATV 171
           +  +L      + +D   +   +L    +  G++A +
Sbjct: 119 VAVSLATEECRVEFDPAVVTAAELKGIIDDSGFEAEI 155

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%)

Query: 8   TTLYKGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRE 67
           +T+ K TL V GMTC AC S + + + +  GV S++VSL T E  +E+    + +  I  
Sbjct: 167 STVRKATLKVLGMTCGACVSTVESALSQEPGVVSIQVSLATEEAQLEYNPAVIGVRAIAS 226

Query: 68  TVEDCGFDAQVLTS 81
            +ED GF++  + S
Sbjct: 227 KIEDLGFESAPVNS 240

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
            Saccharomyces cerevisiae YDR270w CCC2, start by
            similarity
          Length = 1012

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/950 (48%), Positives = 641/950 (67%), Gaps = 47/950 (4%)

Query: 10   LYKGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRETV 69
            L +G + ++GMTCS+C + +  Q+  ++GV  V+VSL+T EC V F  + V++E I+ET+
Sbjct: 78   LCRGFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMTEECTVVFDPQLVAIEDIKETI 137

Query: 70   EDCGFDAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSV-SMEDTEKVGK 128
            +DCGFD  V +S P+G AD+   + V  ++L        GF+++  + +  + D  +  K
Sbjct: 138  DDCGFDGTVSSSEPVGGADSR-AKYVDLRLL--------GFNSKDDNELDQLTDKLRGFK 188

Query: 129  QD--GILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVSSATQLA 186
            QD  GIL +    E    ++ +D   IGIR +I     LG +A V+    +S    TQL 
Sbjct: 189  QDNAGILDMALNTEDYCLSVHFDTQIIGIRKIIDILESLGINAVVD----VSFDKHTQLN 244

Query: 187  LLSKWDEIQFWKFTCLKACVCAIVAMALYMWIPMIFPNLIKNNHFPFKETFFVHGLFYRD 246
            LL+K  EI++WK  C+K+C+ A V M LYM +P +FP+L+K+  FP+     V+GL+YRD
Sbjct: 245  LLTKASEIRYWKSACVKSCIVAFVTMVLYMGLPALFPSLMKDKIFPYSSVGAVNGLYYRD 304

Query: 247  IIGWAIATYSQFRLGIYFYKAAWSSMKHGSGTMDTLIALSTSCAYLFSIFSIIHTMVLSR 306
            IIG+ +A+Y QF +G  FYK+AW+S+KH +GTMDTL+  ST+CAYLFS++S+   +V   
Sbjct: 305  IIGFFLASYVQFVIGATFYKSAWASLKHYAGTMDTLVCFSTTCAYLFSLYSMTECIV--- 361

Query: 307  GNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKLIQLTPSKCIILQDKNN 366
                S  LP V+FDTSVM++A+IS GK LENKAK++TS++LSKLI LTPS CII+   ++
Sbjct: 362  SPPASGKLPKVIFDTSVMIVAYISIGKYLENKAKSKTSTALSKLISLTPSSCIIVDKDDD 421

Query: 367  IQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHKQKGSQV 426
              +  I IE  LL+  DI  +KPG KIP+DGI+ +G SE+DESLMTGE+ LV K+ GS V
Sbjct: 422  SITQEIGIE--LLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVKEIGSVV 479

Query: 427  IAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCLS 486
              G++NG G  YF+  ++GDDTKLA II+ MK+AQL KA IQ   DY+ASIFVPT+L LS
Sbjct: 480  TGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILS 539

Query: 487  IITFITW--ITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMV 544
            ++TFI W  +T S  +     IF   +  +FY   QIA SV++VACPCALGLATPTAIMV
Sbjct: 540  LLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPTAIMV 599

Query: 545  GTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYSN--DDLPVLPC 602
            GTG+ +++GVLIKGGD+LE+FN +   VFDKTGT+TTG MTVQ+F+  +    +L  L C
Sbjct: 600  GTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQFVGNAEMIKNLFYLEC 659

Query: 603  IMAAQSISEHPVAKAIVNYC----GESSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYT 658
            I  A+++S+HPV+KA+V YC    GES +     +I+   ++I GKG++C  +   +   
Sbjct: 660  IERAEALSDHPVSKAVVKYCRDLLGESFEG--TSMIIEDEQLITGKGIKCTVKAADKTLR 717

Query: 659  VTVGHKALXXXXXXXX--XXXXXXXXXTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQ 716
            +TVG+K+L                   T +Y++I+D + G+FE+ D VK D  D+I+YL+
Sbjct: 718  ITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVCGRFELLDEVKSDAKDVIRYLR 777

Query: 717  GLHYDIYMVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGVAFVGD 776
              +Y+++MVTGD+H +AMKVA+ V I  NNVYS VTP GK + VE L+ +    +AF+GD
Sbjct: 778  NNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLREEG-RVIAFIGD 836

Query: 777  GINDSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRV 836
            GINDS  LVTSD+G+A+S+GT++A+EAA IV+L +   +  +LKG++ ALD+S  TF RV
Sbjct: 837  GINDSLALVTSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRV 896

Query: 837  KWNLFWALGYNIFMIPIAMGILVPWGITIHPMVAGLAMALSSVFVVLNSLRLKSWKPPVI 896
            K NLFWAL YN+FM+PIAMGILVPWGIT+HPMVAGLAMA SSV VV+NSL LK WK P +
Sbjct: 897  KLNLFWALCYNVFMLPIAMGILVPWGITLHPMVAGLAMAFSSVSVVVNSLMLKWWKAPEL 956

Query: 897  GDEHPLSSD--YYHHKGTSWIRSGWRKLFGMSS-------EVVYQDLELQ 937
              ++  SS    Y+ KGT  +     +L G +S       E+  QDLELQ
Sbjct: 957  TSKNSHSSKGYGYYTKGTEQL----NRLLGSASTGMSDDTEIEIQDLELQ 1002

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 82/164 (50%), Gaps = 22/164 (13%)

Query: 15  LAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRETVEDCGF 74
           L V+GMTC++C +A++ QV  L+GV S +VSLVTSEC V  + + V+ + I E VEDCGF
Sbjct: 6   LIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSE-DSVATDGIIEAVEDCGF 64

Query: 75  DAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSVS---MEDTEKVGKQDG 131
           D +++    M  A                  +  GF    G + S      T+++   +G
Sbjct: 65  DCELIREKSMAPA------------------LCRGFIGIKGMTCSSCVATVTKQLEAIEG 106

Query: 132 ILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSN 175
           +  ++ +L      + +D   + I D+    +  G+D TV SS 
Sbjct: 107 VSDVDVSLMTEECTVVFDPQLVAIEDIKETIDDCGFDGTVSSSE 150

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/774 (41%), Positives = 476/774 (61%), Gaps = 43/774 (5%)

Query: 124 EKVGKQDGILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVSSAT 183
           E V   DG+++ E +L      + Y+  ++G+R ++      G++A V        +   
Sbjct: 41  EAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIEDCGFEARVGGC-----AREE 95

Query: 184 QLALLSKWDEIQFWKFTCLKACVCAIVAMALYMWIPMIFPNLIKNNHFPFKETFFVHGLF 243
           Q+  L++ +E   W+    +A   A V M LYM  P+      +    P      + GLF
Sbjct: 96  QVRRLARAEETAQWRRRAAQAWAAAAVMMGLYMVAPL------EEALGPTP----LAGLF 145

Query: 244 YRDIIGWAIATYSQFRLGIYFYKAAWSSMKHGSGTMDTLIALSTSCAYLFSIFSIIHTMV 303
           +RD+ G A+A+      G  F +    +++HG GTMDTL+ALS+   YLFS+ +I   + 
Sbjct: 146 WRDVAGLAVASGVLATAGRPFLRG-LGALRHGRGTMDTLVALSSGVTYLFSVATICRGVW 204

Query: 304 LSRGNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKLIQLTPSKCIILQD 363
           L   +      P+   DT+VML+AFI  GKLLE++A+A+ + SL++++   PS C I + 
Sbjct: 205 LGSADP-----PSTFLDTTVMLVAFICVGKLLESRARARAADSLARMVSSAPSMCTIRE- 258

Query: 364 KNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHKQKG 423
                 S  E+E  LLQ  D++ ++PG K+PADG +++GE+E+DESLMTGES LV K  G
Sbjct: 259 ----SGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPKYPG 314

Query: 424 SQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTIL 483
           S+V+ GS+NG   F ++A  +G++T+LA I+  MK AQL KAPIQ  AD+LAS F+P++L
Sbjct: 315 SRVLCGSVNGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQRYADFLASWFIPSVL 374

Query: 484 CLSIITFITWITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIM 543
            L+++TF+ W+ +  LL  PP IF N+N  + Y   +IAI+VIVVACPC LGLA PTAIM
Sbjct: 375 ILALLTFVCWMLICTLLATPPSIFNNSN--RLYVCSRIAITVIVVACPCPLGLAAPTAIM 432

Query: 544 VGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYSNDDLP---VL 600
           VGTG+GA+ G+L KGGD++E    +  I+FDKTGT+TTG++TV  F   S    P    L
Sbjct: 433 VGTGLGAERGLLFKGGDVIETAAAVQAILFDKTGTLTTGKLTVHNFTSESKALTPDQWAL 492

Query: 601 PCIMAAQSISEHPVAKAIVNYCGE-SSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYTV 659
            C  AA+ +SEHP+A+AIV Y    +S +  A ++V   E+++G GVRC  +  G  + +
Sbjct: 493 VC--AAERLSEHPIARAIVTYAEPYASPEAVARIVVLNHEVLVGLGVRCVLQLDGVEHRI 550

Query: 660 TVGHKALXXXXXXXXXXXXXXXXXTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLH 719
           T+G   L                 T S+V++ND L+G+F++ DS++ED  +++Q L    
Sbjct: 551 TIGSARL------LPERPSKFSGSTASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRG 604

Query: 720 YDIYMVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGIN 779
           + + MVTGD+H AAM V+  +GI  NNV+S   P GKC+++  L+      VAF+GDGIN
Sbjct: 605 HYVGMVTGDNHEAAMHVSHALGIPLNNVFSERLPEGKCDVLRQLR-QKYDYVAFIGDGIN 663

Query: 780 DSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRVKWN 839
           DS  L  SD+G++LS  +DI  +AA IVVL  D      L  ++YA+D++  TF+RVK N
Sbjct: 664 DSVALAESDLGISLSGNSDIVADAAGIVVL--DHSSAPPLTRILYAIDLARATFNRVKLN 721

Query: 840 LFWALGYNIFMIPIAMGILVPWGITIHPMVAGLAMALSSVFVVLNSLRLKSWKP 893
           +FWA+ YN  M+P++MG+L+PWGI + PM A   MA+SSV VV +SL L  W+P
Sbjct: 722 IFWAVLYNSLMLPVSMGVLIPWGIQLPPMAAAAGMAMSSVSVVTSSLLLARWRP 775

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 50/75 (66%)

Query: 4  GLGSTTLYKGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLE 63
          G GS       L+V+GMTC+AC   +   V  +DGV + EVSLVT EC VE++ ++V L 
Sbjct: 14 GNGSMAGTTAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLR 73

Query: 64 LIRETVEDCGFDAQV 78
           I ET+EDCGF+A+V
Sbjct: 74 QIVETIEDCGFEARV 88

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score =  306 bits (785), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 272/944 (28%), Positives = 448/944 (47%), Gaps = 108/944 (11%)

Query: 11   YKGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTS-ECHVEFQLEKVSLELIRETV 69
            YK T ++ G+TC+AC S+I   V  LD V  V V++V+     +    ++  L+ ++ETV
Sbjct: 187  YKVTASIGGITCAACASSITNAVSDLDFVSDVAVNVVSKVGVFILDSDDQSKLDQLKETV 246

Query: 70   EDCGFDAQVLTSTPMGS--ADADIVRTVTFKV---LRSNYDVSSGFSAESGDSVSMEDTE 124
            EDCGF  + + S  + +  +     R VT K+     SN  V +  S      + + + E
Sbjct: 247  EDCGFVYEAVGSPTLTNHISVKSPARHVTVKIEGMFCSNCPVRTIKSL-----LDIANAE 301

Query: 125  KVGKQDGILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVSSATQ 184
             +      L+L+      T+ I   E  I IR++   F+ +  + T E    I V    +
Sbjct: 302  LIIDNTDELTLKHPYIKFTY-IPNVERGITIRNI---FSKITEELTTEEHKDIKVVIVKE 357

Query: 185  LALLSKWDEIQFWKFTCLKACVCAIVAMALYMWIPMIFPNLIKNNHFPFKE--------- 235
            + L     E+   +   +   + A+  MA+  +   I    +  +   F+E         
Sbjct: 358  VTLEEHLKEMAKKETWSIAKRLIAVTVMAIPTFAFGIVGMALLPSSNKFREWVDEPTWVG 417

Query: 236  ----------------TFFVHGLFYRDIIGWAIATYSQFRLGIYFYKAAWSSMKHGSGTM 279
                             FFV  +F+R  +      YS ++     +   W       G+M
Sbjct: 418  NVSRVVWILFIISTPVYFFVADIFHRKAVK---EIYSLWK-----HSNNWKRRLFRFGSM 469

Query: 280  DTLIALSTSCAYLFSIFSIIHTMVLSRGNEESPM---LPNVVFDTSVMLIAFISFGKLLE 336
            + L++L T+ AY  SI  +       R   +S M   L    FD+ V L  F+  G+LLE
Sbjct: 470  NLLMSLGTTVAYFASIALLGIAASRPRDTSDSRMHKGLSTTYFDSVVFLTFFLLIGRLLE 529

Query: 337  NKAKAQTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIET---NLLQRNDIIEIKPGMKI 393
            + AK +T+S++S L         ++Q    +   + E+ET     L+  D I+I PG   
Sbjct: 530  SLAKTKTASAISNLSSFKQETATLMQ---KVGDQYQEVETVQIQYLELGDYIKISPGQSP 586

Query: 394  PADGIIIQGESEIDESLMTGESILVHKQKGSQVIAGSLN-GPGHFYFKAINIGDDTKLAQ 452
            P D II++GE+E DES +TGESI + + +G Q+ AG++N G      K  +   ++ L Q
Sbjct: 587  PLDSIILEGETEFDESALTGESIPMVRLRGDQIFAGTVNVGSSSVIAKVSSFDGESLLDQ 646

Query: 453  IIQTMKSAQLNKAPIQNNADYLASIFVPTILCLSIITFITWITLSNLLTKPPVIFTNNNN 512
            I+ T++  QLN+API+  AD L   FVP I+ L+I+T++ W++L  L  K P  + + + 
Sbjct: 647  IVNTVRDGQLNRAPIERLADILTGYFVPIIIFLAILTWVVWLSLG-LSGKLPEHYLDTDI 705

Query: 513  GKFYT-SFQIAISVIVVACPCALGLATPTAIMVGTGIGAQHGVLIKGGD-ILERFNTITK 570
            G +   S + AISV V+ACPC +GLA PTA+ VG+G+ A+ G+L +GG    +    I  
Sbjct: 706  GGWPVWSLEFAISVFVIACPCGIGLAAPTALFVGSGMAAKFGILCRGGGAAFQEGCKIAI 765

Query: 571  IVFDKTGTITTG-QMTVQRFIPYSNDDLPV--LPCIMAAQSISEHPVAKAIVNYCGESSQ 627
            + FDKTGT+T G +M V  +  + ++ L    +      +S S HP+A  +  +   +  
Sbjct: 766  VCFDKTGTLTLGNEMKVTNYSLHGDEKLAKIGIEVTRDMESGSRHPLAIGVKKFIDNTFG 825

Query: 628  DCDAGVIVTKSEIIIGKGVRCEC--------------------------EYQGRNYT--V 659
                 V V     I G G++ E                           E   R+Y   +
Sbjct: 826  KKTGTVKVPDPVEITGGGLKGEIIIDNDLSLPDARIWKEVDPEMAIVGNERLLRDYKCHL 885

Query: 660  TVGHKALXXXXXXXXXXXXXXXXXTKSYVSINDTL--VGKFEIRDSVKEDVADIIQYLQG 717
            T     L                 ++SY   ND    V     +D ++ +  D+I+ L+ 
Sbjct: 886  TSEQLKLLAEWKARGKSLMVTAIKSRSYFG-NDNFYPVMMCAAKDEIRPEAKDVIKELRR 944

Query: 718  LHYDIYMVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGG------V 771
               + +M++GD+   A  VAQ++ I  +NV + V P  K   V+ +Q +++G       V
Sbjct: 945  SGIECWMISGDNEVTARAVAQELDI--DNVIAEVLPEEKAAKVKWIQHNNIGANGHHKVV 1002

Query: 772  AFVGDGINDSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAM 831
            A VGDGIND+P L  +D+G+AL++G+++AM + D V+L        +L  L+  L +S  
Sbjct: 1003 AMVGDGINDAPALAAADVGIALASGSELAMTSCDFVLLS----PINTLVSLLALLKLSKT 1058

Query: 832  TFSRVKWNLFWALGYNIFMIPIAMGILVPWGIT-IHPMVAGLAM 874
             F+R+K+N  WAL YN+  +PIA G++ P+  T + P+ A  AM
Sbjct: 1059 VFNRIKFNFTWALVYNMLALPIAAGVIYPYHNTRLSPVWASAAM 1102

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score =  292 bits (748), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 271/960 (28%), Positives = 463/960 (48%), Gaps = 107/960 (11%)

Query: 11   YKGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVT-SECHVEFQLEKVSLELIRETV 69
            YK T  + G+TC++C ++I A   KLD +  V V+ VT +   +     + ++  +R+ V
Sbjct: 283  YKITAIIGGITCASCCNSITAAASKLDFIADVAVNAVTKTAIFISDVNNERAINCLRDVV 342

Query: 70   EDCGFDAQVLTSTPMGSADADI---VRTVTFKVLRSNYDVSSGFSAESGDSVSMEDTEKV 126
            E+CGF+ + L   P  +  + +    R VT ++         G   +S     +   E  
Sbjct: 343  EECGFEFE-LVGVPQSTIHSSVQTERRVVTIEI--------DGMYCQSCPQRVVASLENY 393

Query: 127  GKQDGILSLEPALEVNTFNITY---DENKIGIRDLIYFFNYLGYDATVESSNIISVSSAT 183
             K +  ++  P L+      +Y     N   IR L+         A   SS  ISV    
Sbjct: 394  NKANIEVTQVPTLKSPHLTFSYVPNQSNGTTIRALVEHVRTSILPAN--SSYQISVKVVE 451

Query: 184  QLALLSKWDEIQFWKFTCLKACV--CAIVAMALYMWIPMIFPNLIKNNHFPFKETFFVHG 241
               L SK  ++   +   +  C+   AIVA+  +++  +I  +L+   H  F++ +    
Sbjct: 452  GSLLDSKLKDLNEREQKSIMRCLIFAAIVAIPTFVF-GIIGMSLLPGEH-RFRK-WLEKP 508

Query: 242  LFYRDI--IGWAIATYS---------QFRLG-------IYFYKAAWSSMKHGSGTMDTLI 283
            L+ +++  + W +   S         QF          ++ Y+ +W++     G+M+ L+
Sbjct: 509  LWVKNVPRVIWILLILSTPVYFSVAEQFHAKACRELHFLWAYQKSWTARLFKFGSMNLLV 568

Query: 284  ALSTSCAYLFSIFSIIHTMVLSRGNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQT 343
            +L TS AY  SI  +I + +    N      P+  FD+ V L  F+  G+LLE+ +K++ 
Sbjct: 569  SLGTSVAYFASILLLILSALKKDANHHKGS-PDTYFDSVVFLTLFLLIGRLLESLSKSKM 627

Query: 344  SSSLSKLIQLTPSKCIILQ-DKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQG 402
              +L  L  L     I++Q D          +   +L+  D I IKPG     D +I+QG
Sbjct: 628  VKTLESLTSLKQRTGILMQADGARDFKKETSVSAEMLELGDHILIKPGASPAVDALIVQG 687

Query: 403  ESEIDESLMTGESILVHKQKGSQVIAGSLN-GPGHFYFKAINIGDDTKLAQIIQTMKSAQ 461
            E+E DES +TGES  +    G Q+ AG++N G      K      ++ L  +I  ++  Q
Sbjct: 688  ETEFDESSLTGESRPITHFPGDQIFAGTVNVGQCAVIAKVSTAPGNSLLDHVISAVRDGQ 747

Query: 462  LNKAPIQNNADYLASIFVPTILCLSIITFITWITL--SNLLTKPPVIFTNNNNGKFYTSF 519
            L  API+  AD L   FVP I+ L+I+T+  W+ L  + +L++  +    +  G  + S 
Sbjct: 748  LRGAPIERIADVLTGYFVPFIVLLAILTWAIWLILGFAGVLSQEKL--DGSVGGWPFWSL 805

Query: 520  QIAISVIVVACPCALGLATPTAIMVGTGIGAQHGVLIKGGD-ILERFNTITKIVFDKTGT 578
            + AI+V V+ACPC +GLA PTA+ VG  I A++G+L +GG    +  + +T + FDKTGT
Sbjct: 806  EFAIAVFVIACPCGIGLAAPTALFVGANIAAKYGILARGGSAAFQMGSKVTTVCFDKTGT 865

Query: 579  ITTG-QMTVQRFIPYSNDDL-PVLPCIMAAQSI-SEHPVAKAIVNYC----GESSQDCD- 630
            +T G    V  +  Y +  +  +L  ++    + S+HP++ ++  +     GE   D + 
Sbjct: 866  LTKGCAPEVTDYAIYPDPRIHKILGKVLHEFGLASKHPLSHSMKCFALKTLGEDLSDINV 925

Query: 631  -----------AGVI-------------VTKSEIIIG-------KGVRCECEYQGRNYTV 659
                        GVI             +  SE+I+G        G +   + +   Y+ 
Sbjct: 926  LEIKEIPGKGMTGVIEPSPAQPSGFRDELVPSEVIVGNEKFMAENGCQLSPDQESLLYSW 985

Query: 660  TVGHKALXXXXXXXXXXXXXXXXXTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLH 719
             +  +++                    ++++ D      E+R   KE    ++Q L    
Sbjct: 986  KIEGRSIIIIGMNFPEGAATQCFIPTLFLAVRD------ELRPEAKE----VVQALHERG 1035

Query: 720  YDIYMVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGV--AFVGDG 777
             + +M++GD+  AA  VA +VGI   +V + V P GK E ++ ++  S  GV  A VGDG
Sbjct: 1036 IECWMISGDNSLAANAVALEVGI--KHVIADVLPEGKAEKIQWIRETSGQGVAIAMVGDG 1093

Query: 778  INDSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRVK 837
            +ND+P +  +D+G++L++G+D+AM + D V+L     ++  L G++  L +S   F RVK
Sbjct: 1094 MNDAPAIAAADVGISLASGSDLAMISCDFVLL----SKKNPLTGIVVLLQLSKKVFRRVK 1149

Query: 838  WNLFWALGYNIFMIPIAMGILVPWGIT-IHPMVAGLAMALSSVFVVLNSLRLKSWKPPVI 896
            +N  WAL YNI  +PIA G+L P+  T + P+ A +AMA SSV VVL+S  L+ ++P  I
Sbjct: 1150 FNFVWALVYNIICVPIAAGVLYPYKETRLSPVWASIAMAASSVSVVLSSNLLRFYRPSKI 1209

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score =  285 bits (729), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 261/919 (28%), Positives = 428/919 (46%), Gaps = 140/919 (15%)

Query: 6    GSTTLYKGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELI 65
            GST      L+V GM+C+ C S +    G L  V  ++ SL+ S+   EF     +L+L 
Sbjct: 405  GSTGTEHIVLSVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQ--AEF-----NLDLA 457

Query: 66   RETVEDCGFDAQVLTSTPMGSADADIVRTVTFKVLR-----SNYDVSSGFSAESGDSVSM 120
            + +V+D                   + +T  FK  +     S  DV   ++A+  D ++ 
Sbjct: 458  QGSVKD---------------VIKHLSKTTEFKYEQISNHGSTIDVVVPYAAK--DFINE 500

Query: 121  EDTEKVGKQDGILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVS 180
            E  +      G+  L+  +E N   I +D   IG RDL+      G+   V         
Sbjct: 501  EWPQ------GVTELK-IVERNIIRIYFDPKVIGARDLVN----EGWSVPV--------- 540

Query: 181  SATQLALLSKWDEIQFWKFTCLKACVCAIVAMALYMWIPMIF----PNLIKNNHFPFKET 236
                +A  S    I+  +   ++  V    A+++ + IP++     P L +      K +
Sbjct: 541  ---SIAPFSCHPTIEVGRKHLVR--VGCTTALSIILTIPILVMAWAPQLRE------KIS 589

Query: 237  FFVHGLFYRDIIGWAIATYSQFRLGIYFYKAAWSSMKHGSGTMDTLIALSTSCAYLFSIF 296
                 +    II + IA       G ++  A  S +      MD LI LSTS AY+FSI 
Sbjct: 590  TISASMVLATIIQFVIA-------GPFYLNALKSLIFSRLIEMDLLIVLSTSAAYIFSIV 642

Query: 297  SIIHTMVLSRGNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKLIQLTPS 356
            S  +  V+ R     P+     F+TS +L+  I  G+ +   A+ +   S+S  ++   +
Sbjct: 643  SFGY-FVVGR-----PLSTEQFFETSSLLVTLIMVGRFVSELARHRAVKSIS--VRSLQA 694

Query: 357  KCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQGESEIDESLMTGESI 416
               IL DK   ++   EI   LLQ  DI ++ P  +IP DG +I G SE+DE+L+TGES+
Sbjct: 695  SSAILVDKTGKET---EINIRLLQYGDIFKVLPDSRIPTDGTVISGSSEVDEALITGESM 751

Query: 417  LVHKQKGSQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLAS 476
             V K+  S V+AGS+NG G  + K   +  +  ++ I   +  A+L K  IQN AD +AS
Sbjct: 752  PVPKKCQSIVVAGSVNGTGTLFVKLSKLPGNNTISTIATMVDEAKLTKPKIQNIADKIAS 811

Query: 477  IFVPTILCLSIITFITWITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGL 536
             FVPTI+ ++++TF  WI +   + K       + +     +   AI+V++V+CPC +GL
Sbjct: 812  YFVPTIIGITVVTFCVWIAVGIRVEK------QSRSDAVIQAIIYAITVLIVSCPCVIGL 865

Query: 537  ATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYSNDD 596
            A P   ++ +G+ A+ GV+ K  + +E  +  + +VFDKTGT+T G++TV        D 
Sbjct: 866  AVPIVFVIASGVAAKRGVIFKSAESIEVAHNTSHVVFDKTGTLTEGKLTVVHET-VRGDR 924

Query: 597  LPVLPCIMAAQSISEHPVAKAIVNYCGE---SSQDCDAGVIVTKSEIIIGKGVR------ 647
                  ++      +HPV+ AI +Y  E   S+Q+      V+ ++ + GK V       
Sbjct: 925  HNSQSLLLGLTEGIKHPVSMAIASYLKEKGVSAQN------VSNTKAVTGKRVEGTSYSG 978

Query: 648  -----CECEYQGRNYTVTVGHKALXXXXXXXXXXXXXXXXXTKSYVSINDTLVGKFEIRD 702
                   C + G N    V  KAL                      S+N ++   + + D
Sbjct: 979  LKLQGGNCRWLGHNNDPDV-RKALEQGYSVFC-------------FSVNGSVTAVYALED 1024

Query: 703  SVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCE---- 758
            S++ D    I  L+     +++++GD  GA   +A ++GI ++N+ S  TP+ K E    
Sbjct: 1025 SLRADAVSTINLLRQRGISLHILSGDDDGAVRSMAARLGIESSNIRSHATPAEKSEYIKD 1084

Query: 759  IVESLQADSVGG-----VAFVGDGINDSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQ 813
            IVE    DS        V F GDG ND+  L  + IGV ++ G+++A  AAD+V+L    
Sbjct: 1085 IVEGRNCDSSSQSKRPVVVFCGDGTNDAIGLTQATIGVHINEGSEVAKLAADVVML---- 1140

Query: 814  DERESLKGLIYALDISAMTFSRVKWNLFWALGYNIFMIPIAMGILVPWGITIHPMVAGLA 873
              +  L  ++  + +S     RVK N  W+  YN+F I +A G  V + I   P  AGL 
Sbjct: 1141 --KPKLNNILTMITVSQKAMFRVKLNFLWSFTYNLFAILLAAGAFVDFHIP--PEYAGLG 1196

Query: 874  MALSSVFVVLNSLRLKSWK 892
              +S + V+  ++ L+  K
Sbjct: 1197 ELVSILPVIFVAILLRYAK 1215

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score =  101 bits (251), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 127/554 (22%), Positives = 219/554 (39%), Gaps = 88/554 (15%)

Query: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401
           Q  S + +L +   +  ++++D        +EI  N +   DI++++ G  IP DG I+ 
Sbjct: 164 QAGSIVDELKKTLANTAVVIRD-----GQLVEIPANEVVPGDILQLEDGTVIPTDGRIVT 218

Query: 402 GES--EIDESLMTGESILVHKQKGSQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKS 459
            +   +ID+S +TGES+ V K  G Q  + S    G  +      GD+T + +      +
Sbjct: 219 EDCFLQIDQSAITGESLAVDKHYGDQTFSSSTVKRGEGFMVVTATGDNTFVGR-----AA 273

Query: 460 AQLNKAPIQNNADYLASIFVPTILCLSIITFITWITLSNLLTKPPVIFTNNNNGKFYTSF 519
           A +NKA            F   +  + II  +  + ++ LL      F   N       +
Sbjct: 274 ALVNKAAGGQGH------FTEVLNGIGIILLV--LVIATLLLVWTACFYRTNGIVRILRY 325

Query: 520 QIAISVIVVACPCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTI 579
            + I++I V  P  L     T + VG    A+   +++    +E    +  +  DKTGT+
Sbjct: 326 TLGITIIGV--PVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTL 383

Query: 580 TTGQMTVQRFIPY-----SNDDLPVLPCIMAAQ--------------SISEHPVAK-AIV 619
           T  ++++    PY     S DDL +  C+ A++              S+ ++P AK A+ 
Sbjct: 384 TKNKLSLHE--PYTVEGVSPDDLMLTACLAASRKKKGLDAIDKAFLKSLKQYPKAKDALT 441

Query: 620 NYCGESSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYTV-TVGHKALXXXXXXXXXXXX 678
            Y        D       + +   +G R  C      + + TV                 
Sbjct: 442 KYKVLEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEEDHPIPEDVHENYENK 501

Query: 679 XXXXXTKSYVSINDT---------LVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDS 729
                ++ + ++            ++G     D  ++D A  +   + L   + M+TGD+
Sbjct: 502 VAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDA 561

Query: 730 HGAAMKVAQQVGIAAN---------------------------NVYSGVTPSGKCEIVES 762
            G A +  +Q+G+  N                           + ++ V P  K  +VE 
Sbjct: 562 VGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYRVVEI 621

Query: 763 LQADSVGGVAFVGDGINDSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGL 822
           LQ      VA  GDG+ND+P L  +D G+A+   TD A  AADIV L         L  +
Sbjct: 622 LQNRGY-LVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLA------PGLSAI 674

Query: 823 IYALDISAMTFSRV 836
           I AL  S   F R+
Sbjct: 675 IDALKTSRQIFHRM 688

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 131/580 (22%), Positives = 229/580 (39%), Gaps = 108/580 (18%)

Query: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401
           Q  S + +L +   +  ++++D      S +EI  N +   DI++++ G+ IPADG I+ 
Sbjct: 145 QAGSIVEELKKTLANSAVVIRD-----GSLVEIPANEVVPGDILQLEDGVIIPADGRIVT 199

Query: 402 GES--EIDESLMTGESILVHKQKGSQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKS 459
                +ID+S +TGES+ V K+ G    + S    G  +      GD T + +      +
Sbjct: 200 EGCFVQIDQSAITGESLAVDKRYGDATFSSSTVKRGEGFMIVTATGDSTFVGR-----AA 254

Query: 460 AQLNKAPIQNN--ADYLASIFVPTILCLSIITFITWITLSNLLTKPPVIFTNNNNGKFYT 517
           A +NKA   +    + L  I    ++ + +   + ++                    FY 
Sbjct: 255 ALVNKASAGSGHFTEVLNGIGTILLILVILTLLVVYVAC------------------FYR 296

Query: 518 SFQI------AISVIVVACPCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKI 571
           S  I       +++ VV  P  L     T + VG    A+   +++    +E    +  +
Sbjct: 297 SIDIVTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAKKKAIVQKLSAIESLAGVEIL 356

Query: 572 VFDKTGTITTGQMTVQRFIPYS-----NDDLPVLPCIMAAQSIS-----EHPVAKAIVNY 621
             DKTGT+T  ++++    PY+      DDL +  C+ A++        +    K+++NY
Sbjct: 357 CSDKTGTLTKNKLSLHE--PYTVEGVEADDLMLTACLAASRKKKGLDAIDKAFLKSLINY 414

Query: 622 CGESSQDCDAGVI-------VTKSEIII---GKGVRCECEYQGRNYTV-TVGHKALXXXX 670
               +      V+       V+K    I    +G R  C      + + TV    L    
Sbjct: 415 PRAKAALTKYKVLEFHPFDPVSKKVTAIVESPEGERIVCVKGAPLFVLKTVEENHLIPED 474

Query: 671 XXXXXXXXXXXXXTKSYVSINDT---------LVGKFEIRDSVKEDVADIIQYLQGLHYD 721
                        ++ Y ++            ++G     D  ++D A  +   + L   
Sbjct: 475 VKENYENKVAELASRGYRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLR 534

Query: 722 IYMVTGDSHGAAMKVAQQVGIAAN---------------------------NVYSGVTPS 754
           + M+TGD+ G A +  +Q+G+  N                           + ++ V P 
Sbjct: 535 VKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQ 594

Query: 755 GKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQD 814
            K  +VE LQ      VA  GDG+ND+P L  +D G+A+   TD A  AADIV L     
Sbjct: 595 HKYNVVEILQQRGY-LVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLA---- 649

Query: 815 ERESLKGLIYALDISAMTFSR----VKWNLFWALGYNIFM 850
               L  +I AL  S   F R    V + +  +L   IF+
Sbjct: 650 --PGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFL 687

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 96.7 bits (239), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 119/524 (22%), Positives = 203/524 (38%), Gaps = 83/524 (15%)

Query: 372 IEIETNLLQRNDIIEIKPGMKIPADGIIIQGES--EIDESLMTGESILVHKQKGSQVIAG 429
           IEI  N +   +I++++ G   PADG I+  +   +ID+S +TGES+   K  G +V + 
Sbjct: 218 IEIPANEVVPGEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLAAEKHYGDEVFSS 277

Query: 430 SLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCLSIIT 489
           S    G  +      GD+T + +            A +   A  +   F   +  + II 
Sbjct: 278 STVKTGEAFMVVTATGDNTFVGR-----------AAALVGQASGVEGHFTEVLNGIGIIL 326

Query: 490 FITWITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIG 549
            +  + ++ LL      F         +  +  + + ++  P  L     T + VG    
Sbjct: 327 LV--LVIATLLLVWTACFYRTVG--IVSILRYTLGITIIGVPVGLPAVVTTTMAVGAAYL 382

Query: 550 AQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPY-----SNDDLPVLPCIM 604
           A+   +++    +E    +  +  DKTGT+T  ++++    PY     S DDL +  C+ 
Sbjct: 383 AKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE--PYTVEGVSPDDLMLTACLA 440

Query: 605 AAQ--------------SISEHPVAK-AIVNYCGESSQDCDAGVIVTKSEIIIGKGVRCE 649
           A++              S+ E+P AK A+  Y        D       + +   +G R  
Sbjct: 441 ASRKKKGLDAIDKAFLKSLIEYPKAKDALTKYKVLEFHPFDPVSKKVTAVVESPEGERIV 500

Query: 650 CEYQGRNYTV-TVGHKALXXXXXXXXXXXXXXXXXTKSYVSINDT---------LVGKFE 699
           C      + + TV                      ++ + ++            ++G   
Sbjct: 501 CVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRGEGHWEILGVMP 560

Query: 700 IRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAAN-------------- 745
             D  ++D A  I   + L   I M+TGD+ G A +  +Q+G+  N              
Sbjct: 561 CMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGD 620

Query: 746 -------------NVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVA 792
                        + ++ V P  K  +VE LQ      VA  GDG+ND+P L  +D G+A
Sbjct: 621 MPGSELADFVENADGFAEVFPQHKYRVVEILQNRGY-LVAMTGDGVNDAPSLKKADTGIA 679

Query: 793 LSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRV 836
           +   TD A  AADIV L         L  +I AL  S   F R+
Sbjct: 680 VEGATDAARSAADIVFLA------PGLSAIIDALKTSRQIFHRM 717

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 138/644 (21%), Positives = 252/644 (39%), Gaps = 107/644 (16%)

Query: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401
           Q  S + +L +   +  ++++D N      +E+ +N +   DI++++ G+ IPADG ++ 
Sbjct: 145 QAGSIVDELKKTLANSAVVIRDGN-----LVEVPSNEVVPGDILQLEDGVVIPADGRLVT 199

Query: 402 GES--EIDESLMTGESILVHKQKGSQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKS 459
            +   +ID+S +TGES+ V K+ G    + S    G  +      GD T + +    +  
Sbjct: 200 EDCFIQIDQSAITGESLAVDKRFGDSTFSSSTVKRGEAFMIVTATGDSTFVGRAAALVNK 259

Query: 460 AQLNKAPIQNNADYLASIFVPTILCLSIITFITWITLSNLLTKPPVIFTNNNNGKFYTSF 519
           A        +  + L  I    ++ + +   + W+            F   N  K     
Sbjct: 260 AAAGSG---HFTEVLNGIGTILLILVIVTLLLVWVA----------SFYRTN--KIVRIL 304

Query: 520 QIAISVIVVACPCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTI 579
           +  +++ +V  P  L     T + VG    A+   +++    +E    +  +  DKTGT+
Sbjct: 305 RYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTL 364

Query: 580 TTGQMTVQRFIPYS-----NDDLPVLPCIMAA--------------QSISEHPVAKA-IV 619
           T  ++++    PY+      DDL +  C+ A+              +S+  +P AKA + 
Sbjct: 365 TKNKLSLHE--PYTVEGVDPDDLMLTACLAASRKKKGLDAIDKAFLKSLISYPRAKAALT 422

Query: 620 NYCGESSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYTV-TVGHKALXXXXXXXXXXXX 678
            Y        D       + +   +G R  C      + + TV  +              
Sbjct: 423 KYKLLEFHPFDPVSKKVTAIVESPEGERIICVKGAPLFVLKTVEEEHPIPEDVRENYENK 482

Query: 679 XXXXXTKSYVSINDT---------LVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDS 729
                ++ + ++            ++G     D  ++D A  +   + L   + M+TGD+
Sbjct: 483 VAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDA 542

Query: 730 HGAAMKVAQQVGIAAN---------------------------NVYSGVTPSGKCEIVES 762
            G A +  +Q+G+  N                           + ++ V P  K  +VE 
Sbjct: 543 VGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYNVVEI 602

Query: 763 LQADSVGGVAFVGDGINDSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGL 822
           LQ      VA  GDG+ND+P L  +D G+A+   TD A  AADIV L         L  +
Sbjct: 603 LQQRGYL-VAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLA------PGLSAI 655

Query: 823 IYALDISAMTFSRVKWNLFWALGYNIFMIPIAMGILVPWGITIHPMVAGLAMALSSVFVV 882
           I AL  S   F R+         Y ++ I +++ + +  G+ I    A L  +L+   VV
Sbjct: 656 IDALKTSRQIFHRM-------YSYVVYRIALSLHLEIFLGLWI----AILNRSLNIDLVV 704

Query: 883 LNSLRLKSWKPPVIGDEHPLSSDYYHHKGTSWIRSGWRKLFGMS 926
             ++        +  D  P     Y  K   W     R+L+GMS
Sbjct: 705 FIAIFADVATLAIAYDNAP-----YSPKPVKW---NLRRLWGMS 740

>Scas_688.1
          Length = 913

 Score = 93.6 bits (231), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 122/562 (21%), Positives = 219/562 (38%), Gaps = 104/562 (18%)

Query: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401
           Q  S + +L +   +  I+++D        +E+  N +   DI++++ G+ IPADG I+ 
Sbjct: 159 QAGSIVEELKKTLANSAIVIRD-----GQLVEVPANEVVPGDILQLEDGVIIPADGRIVT 213

Query: 402 GES--EIDESLMTGESILVHKQKGSQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKS 459
            +   +ID+S +TGES+   K  G Q  + S    G  +      GD+T + +      +
Sbjct: 214 EDCFVQIDQSAITGESLAADKHYGDQTFSSSTVKRGEAFMVITATGDNTFVGR-----AA 268

Query: 460 AQLNKAPIQNN--ADYLASIFVPTILCLSIITFITWITLSNLLTKPPVIFTNNNNGKFYT 517
           A +NKA        + L  I +  ++ + +   + W                     FY 
Sbjct: 269 ALVNKASGGQGHFTEVLNGIGIILLVLVIVTLLLVW------------------TASFYR 310

Query: 518 S------FQIAISVIVVACPCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKI 571
           +       +  + + +V  P  L     T + VG    A+   +++    +E    +  +
Sbjct: 311 TDGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEIL 370

Query: 572 VFDKTGTITTGQMTVQRFIPY-----SNDDLPVLPCIMAAQ--------------SISEH 612
             DKTGT+T  ++++    PY     S DDL +  C+ A++              S++++
Sbjct: 371 CSDKTGTLTKNKLSLHE--PYTVEGVSADDLMLTACLAASRKKKGLDAIDKAFLKSLAQY 428

Query: 613 PVAK-AIVNYCGESSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYTV-TVGHKALXXXX 670
           P AK A+  Y        D       + +   +G R  C      + + TV         
Sbjct: 429 PAAKNALTKYKVLEFHPFDPVSKKVTAVVESPEGERIICVKGAPLFVLKTVEEDHPIPED 488

Query: 671 XXXXXXXXXXXXXTKSYVSINDT---------LVGKFEIRDSVKEDVADIIQYLQGLHYD 721
                        ++ + ++            ++G     D  ++D  + +   + L   
Sbjct: 489 IHENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTGETVAEARRLGLR 548

Query: 722 IYMVTGDSHGAAMKVAQQVGIAAN---------------------------NVYSGVTPS 754
           + M+TGD+ G A +  +Q+G+  N                           + ++ V P 
Sbjct: 549 VKMLTGDAVGIAKETCRQLGLGTNVYNAERLGLSGGGDMPGSELADFVENADGFAEVFPQ 608

Query: 755 GKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQD 814
            K  +VE LQ      VA  GDG+ND+P L  +D G+A+   TD A  AADIV L     
Sbjct: 609 DKYRVVEILQTRGY-LVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLA---- 663

Query: 815 ERESLKGLIYALDISAMTFSRV 836
               L  +I AL  S   F R+
Sbjct: 664 --PGLSAIIDALKTSRQIFHRM 683

>Kwal_47.17522
          Length = 899

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 117/554 (21%), Positives = 217/554 (39%), Gaps = 88/554 (15%)

Query: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401
           Q  S + +L +   +  ++++D N      +EI  N +   DI++++ G+ I ADG ++ 
Sbjct: 145 QAGSIVDELKKSLANSAVVVRDGN-----LVEIPANEVVPGDIMQLEDGVVICADGRLVT 199

Query: 402 GES--EIDESLMTGESILVHKQKGSQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKS 459
            E   +ID+S +TGES+ V K  G    + S    G  +      GD+T + +    +  
Sbjct: 200 EECFLQIDQSAITGESLAVDKHYGDTTFSSSTVKRGEGFMIVTATGDNTFVGRAAALVNQ 259

Query: 460 AQLNKAPIQNNADYLASIFVPTILCLSIITFITWITLSNLLTKPPVIFTNNNNGKFYTSF 519
           A  ++    +  + L  I    ++ + +   + W             F   +  +     
Sbjct: 260 AAGDQG---HFTEVLNGIGTILLVLVIVTLLLVWTA----------CFYRTD--RIVRIL 304

Query: 520 QIAISVIVVACPCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTI 579
           +  + + ++  P  L     T + VG    A+   +++    +E    +  +  DKTGT+
Sbjct: 305 RYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTL 364

Query: 580 TTGQMTVQRFIPYS-----NDDLPVLPCIMAAQ--------------SISEHPVAK-AIV 619
           T  ++++    PY+      DDL +  C+ A++              S+ ++P AK A+ 
Sbjct: 365 TKNKLSLHE--PYTVEGVEPDDLMLTACLAASRKKKGLDAIDKAFLKSLIQYPRAKNALT 422

Query: 620 NYCGESSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYTV-TVGHKALXXXXXXXXXXXX 678
            Y        D       + +   +G R  C      + + TV                 
Sbjct: 423 KYKVLDFHPFDPVSKKVTAVVESPEGERIICVKGAPLFVLKTVEEDHPIPEDVHENYENK 482

Query: 679 XXXXXTKSYVSI---------NDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDS 729
                ++ + ++         +  ++G     D  ++D A  +   + L   + M+TGD+
Sbjct: 483 VAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVHEARRLGLRVKMLTGDA 542

Query: 730 HGAAMKVAQQVGIAAN---------------------------NVYSGVTPSGKCEIVES 762
            G A +  +Q+G+  N                           + ++ V P  K  +VE 
Sbjct: 543 VGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYSVVEI 602

Query: 763 LQADSVGGVAFVGDGINDSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGL 822
           LQ      VA  GDG+ND+P L  +D G+A+   TD A  AADIV L         L  +
Sbjct: 603 LQQRGY-LVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLA------PGLSAI 655

Query: 823 IYALDISAMTFSRV 836
           I AL  S   F R+
Sbjct: 656 IDALKTSRQIFHRM 669

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 122/556 (21%), Positives = 214/556 (38%), Gaps = 92/556 (16%)

Query: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401
           Q  S + +L +   +  ++++D        +E+  N +   DI++++ G  IPADG ++ 
Sbjct: 148 QAGSIVDELKKTLANVAVVIRD-----GQLVEVPANEVVPGDILQLEDGTIIPADGRLVT 202

Query: 402 GES--EIDESLMTGESILVHKQKGSQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKS 459
                ++D+S +TGES+ V K  G Q  + S    G  +      GD+T + +      +
Sbjct: 203 ENCFLQVDQSAITGESLAVDKGYGDQTFSSSTVKRGEAFMVVTATGDNTFVGR-----AA 257

Query: 460 AQLNKAPIQNN--ADYLASIFVPTILCLSIITFITWITLSNLLTKPPVIFTNNNNGKFYT 517
           A +NKA        + L  I +  ++ + +     W             F   +N     
Sbjct: 258 ALVNKASGGQGHFTEVLNGIGILLLVLVIVTLLGVW----------AACFYRTDNIVKIL 307

Query: 518 SFQIAISVIVVACPCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTG 577
            F + I++I V  P  L     T + VG    A+   +++    +E    +  +  DKTG
Sbjct: 308 RFTLGITIIGV--PVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTG 365

Query: 578 TITTGQMTVQRFIPY-----SNDDLPVLPCIMAAQSIS-----EHPVAKAIVNYCGESSQ 627
           T+T  ++++    PY     S DDL +  C+ A++        +    K+++NY      
Sbjct: 366 TLTKNKLSLHE--PYTVEGVSADDLMLTACLAASRKKKGLDAIDKAFLKSLINYPKAKDA 423

Query: 628 DCDAGVIVTKSEIIIGKGVRCECEY-QGRNYTVTVG-------------------HKALX 667
                VI       + K V    E  +G       G                   H+   
Sbjct: 424 LTKYKVIEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEEDHPIPEDVHENYE 483

Query: 668 XXXXXXXXXXXXXXXXTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTG 727
                            +     +  ++G     D  ++D A+ +   + L   + M+TG
Sbjct: 484 NKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAETVNEARRLGLRVKMLTG 543

Query: 728 DSHGAAMKVAQQVGIAAN---------------------------NVYSGVTPSGKCEIV 760
           D+ G A +  +Q+G+  N                           + ++ V P  K ++V
Sbjct: 544 DAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYKVV 603

Query: 761 ESLQADSVGGVAFVGDGINDSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLK 820
           E LQ      VA  GDG+ND+P L  +D G+A+   +D A  AADIV L         L 
Sbjct: 604 EILQNRGY-LVAMTGDGVNDAPSLKKADTGIAVEGASDAARSAADIVFLA------PGLS 656

Query: 821 GLIYALDISAMTFSRV 836
            +I AL  S   F R+
Sbjct: 657 AIIDALKTSRQIFHRM 672

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 117/277 (42%), Gaps = 56/277 (20%)

Query: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401
           ++  SL  L +L P++C +++     Q SH+   T  L   D++  + G +IPAD  II+
Sbjct: 137 RSEKSLEALNKLVPAECHLMRCG---QESHVLAST--LVPGDLVHFRIGDRIPADIRIIE 191

Query: 402 G-ESEIDESLMTGESILVHK---------------------QKGSQVIAGSLNGPGHFYF 439
             +  IDES +TGE+  VHK                     ++      G+L   GH   
Sbjct: 192 AIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKG 251

Query: 440 KAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLA------SIFVPTILCL-SIITFIT 492
             +  G +T    + + M + +  K P+Q   D L       S  V  ++CL  II   +
Sbjct: 252 IVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQGRS 311

Query: 493 WITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIGAQH 552
           W+ +                      FQI++S+ V A P  L +     + +G    A+ 
Sbjct: 312 WLEM----------------------FQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR 349

Query: 553 GVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRF 589
             +++    +E   ++  I  DKTGT+T+  MTV + 
Sbjct: 350 KAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKL 386

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 76/150 (50%), Gaps = 33/150 (22%)

Query: 693 TLVGKFEIRDSVKEDVA-DIIQYLQG-LHYDIYMVTGDSHGAAMKVAQQVGIA------- 743
           T  G   + D  + +V   I Q LQG +H  I M+TGDS   A+ +A+Q+GI        
Sbjct: 571 TFTGLIGMNDPPRPNVKFAIEQLLQGGVH--IIMITGDSENTAVNIAKQIGIPVIDPKLS 628

Query: 744 ---------------AN-----NVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPV 783
                          AN     N+++  TP  K  IV +L+      VA  GDG+ND+P 
Sbjct: 629 VLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRG-DVVAMTGDGVNDAPA 687

Query: 784 LVTSDIGVALST-GTDIAMEAADIVVLGND 812
           L  SDIGV++   GTD+A EA+D+V+  +D
Sbjct: 688 LKLSDIGVSMGRIGTDVAKEASDMVLTDDD 717

>Scas_707.48*
          Length = 741

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 122/277 (44%), Gaps = 56/277 (20%)

Query: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401
           ++  SL  L +L P++C +++     Q SH+ + + L+   D++  K G +IPAD  II+
Sbjct: 137 RSEKSLEALNKLVPAECHLIRCG---QESHV-LASGLVP-GDLVHFKIGDRIPADLRIIE 191

Query: 402 G-ESEIDESLMTGESILVHK-----------QKGSQVIA----------GSLNGPGHFYF 439
             +  IDES +TGE+  VHK            + + +I           G+L   GH   
Sbjct: 192 AVDLSIDESNLTGENEPVHKSAKEVNKDSFNDQPNSIIPISDRTCVAYMGTLVKEGHGKG 251

Query: 440 KAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLA------SIFVPTILCL-SIITFIT 492
             + IG +T    I + + + +  K P+QN  D L       S  V  ++CL  I+   +
Sbjct: 252 IVVGIGKNTSFGAIFEMLSNIEKPKTPLQNAMDKLGKDLSLFSFIVIGLICLVGILQGRS 311

Query: 493 WITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIGAQH 552
           W+ +                      FQI++S+ V A P  L +     + +G    A+ 
Sbjct: 312 WLEM----------------------FQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR 349

Query: 553 GVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRF 589
             +++    +E   ++  I  DKTGT+T+  MT  + 
Sbjct: 350 KAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTASKI 386

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 73/140 (52%), Gaps = 33/140 (23%)

Query: 701 RDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIA----------------- 743
           R +VK  +  ++Q   G+H  I M+TGDS   A+ +A+Q+GI                  
Sbjct: 576 RPTVKPAIEQLLQ--GGVH--IIMITGDSENTAVNIARQIGIPVLDPKLSVLSGDKLNEM 631

Query: 744 -----AN-----NVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVAL 793
                AN     N+++  TP  K  IV +L+      VA  GDG+ND+P L  +DIGV++
Sbjct: 632 SDDQLANVIDHVNIFARATPEHKLNIVRALRKRG-DVVAMTGDGVNDAPALKLADIGVSM 690

Query: 794 ST-GTDIAMEAADIVVLGND 812
              GTD+A EA+D+V+  +D
Sbjct: 691 GRMGTDVAKEASDMVLTDDD 710

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 72/150 (48%), Gaps = 29/150 (19%)

Query: 691 NDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAA------ 744
           N T VG   ++D  +  V   I+ L      + M+TGD+   A+ +A+Q+GI        
Sbjct: 576 NLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEIS 635

Query: 745 ---------------------NNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPV 783
                                 N+++  TP  K  IV +LQ      VA  GDG+ND+P 
Sbjct: 636 VLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRG-DIVAMTGDGVNDAPA 694

Query: 784 LVTSDIGVALS-TGTDIAMEAADIVVLGND 812
           L  +DIGVA+   GTD+A EA+D+V+  +D
Sbjct: 695 LKLADIGVAMGHMGTDVAKEASDMVLTDDD 724

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/276 (22%), Positives = 109/276 (39%), Gaps = 56/276 (20%)

Query: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401
           ++  SL  L +L P+ C +++       +   +  + L   D++  K G +IPAD  II+
Sbjct: 143 RSEKSLEALHKLVPASCHLIR-----FGAETHVLASCLVPGDLVYFKVGDRIPADVRIIE 197

Query: 402 G-ESEIDESLMTGESILVHK---------------------QKGSQVIAGSLNGPGHFYF 439
             +  +DES +TGE+  VHK                     ++ S    G+L   GH   
Sbjct: 198 STDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKG 257

Query: 440 KAINIGDDTKLAQIIQTMKSAQLNKAPIQNNAD-------YLASIFVPTILCLSIITFIT 492
             +  G  T    + + M S +  K P+Q   D       Y+  +    I  L +I   +
Sbjct: 258 IVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGIIFLLGVIQGRS 317

Query: 493 WITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIGAQH 552
           W+ +                      FQI++S+ V A P  L +     + +G    A  
Sbjct: 318 WLEM----------------------FQISVSLAVAAIPEGLPIIVTVTLALGVLRMANR 355

Query: 553 GVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQR 588
             +++    +E   ++  I  DKTGT+T   MT  +
Sbjct: 356 KAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASK 391

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 70/131 (53%), Gaps = 32/131 (24%)

Query: 711 IIQYLQG-LHYDIYMVTGDSHGAAMKVAQQVGIA----------------------AN-- 745
           I Q+LQG +H  I M+TGDS   A+ +A+Q+GI                       AN  
Sbjct: 591 IDQFLQGGIH--IIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVI 648

Query: 746 ---NVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVAL-STGTDIAM 801
              N+++  TP  K  IV +L+      VA  GDG+ND+P L  +DIGV++   GTD+A 
Sbjct: 649 DHVNIFARATPEHKLNIVRALRRRG-DVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAK 707

Query: 802 EAADIVVLGND 812
           EA+D+++  +D
Sbjct: 708 EASDMILTDDD 718

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 115/274 (41%), Gaps = 52/274 (18%)

Query: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRN----DIIEIKPGMKIPADG 397
           ++  SL  L +L P +C +++            E+N+L  N    D++  + G +IPAD 
Sbjct: 145 RSEKSLEALNKLVPQECHLIRGGR---------ESNVLATNLVPGDLVRFRIGDRIPADI 195

Query: 398 IIIQ-GESEIDESLMTGESILVHK---------------------QKGSQVIAGSLNGPG 435
            II+  +  IDES +TGE+  VHK                     ++ +    G+L   G
Sbjct: 196 RIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEG 255

Query: 436 HFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCLSIITFITWIT 495
           +     +  G +T    + + M S +  K P+Q   D L                   ++
Sbjct: 256 NGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGK----------------DLS 299

Query: 496 LSNLLTKPPVIFTNNNNGKFYTS-FQIAISVIVVACPCALGLATPTAIMVGTGIGAQHGV 554
           L++ +    +       G+ +   FQI++S+ V A P  L +     + +G    A+   
Sbjct: 300 LASFVVIGIICVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKA 359

Query: 555 LIKGGDILERFNTITKIVFDKTGTITTGQMTVQR 588
           +++    +E   ++  I  DKTGT+T+  MTV +
Sbjct: 360 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSK 393

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 99/207 (47%), Gaps = 40/207 (19%)

Query: 693 TLVGKFEIRDSVKEDVADIIQYLQ--GLHYDIYMVTGDSHGAAMKVAQQVGIAAN----- 745
           T  G F + D  + +V   I+ L   G+H  I M+TGDS   A+ +A+++G++       
Sbjct: 567 TFTGLFGLADPPRPNVKASIEKLHRGGVH--IIMITGDSVNTAVSIAEKIGLSVQDRESS 624

Query: 746 ----------------------NVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPV 783
                                 N+++  TP  K  IV++L+      VA  GDG+ND+P 
Sbjct: 625 VMTGDKVSELTEDELSKVIDKVNIFARATPENKLNIVKALRKRG-DIVAMTGDGVNDAPA 683

Query: 784 LVTSDIGVALS-TGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRVKWNLFW 842
           L  +DIG+A+  +GTD+A E +D+++  +D         ++ A++     F+ ++  L +
Sbjct: 684 LKLADIGIAMGISGTDVAKEVSDMILTDDD------FSSILTAIEEGKGIFNNIRNFLTF 737

Query: 843 ALGYNIFMIP-IAMGILVPWGITIHPM 868
            L  ++  +  IA+  +      ++PM
Sbjct: 738 QLSISVATLSLIAITTIAKLPAPLNPM 764

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 113/270 (41%), Gaps = 45/270 (16%)

Query: 342 QTSSSLSKLIQLTPSKCIILQ---DKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGI 398
           ++  SL  L +L P+KC +++   + N + S         L   D++  K G +IPAD  
Sbjct: 147 RSEKSLEALNKLVPTKCHLIRYGRESNTLASE--------LVPGDLVRFKIGDRIPADVR 198

Query: 399 IIQG-ESEIDESLMTGESILVHK------------------QKGSQVIAGSLNGPGHFYF 439
           II+  +  IDES +TGE+  +HK                  ++      G+L   GH   
Sbjct: 199 IIEAVDLSIDESNLTGETEPLHKDAQTIDPEEYDNRNVPVSERSCIAYMGTLVKEGHGKG 258

Query: 440 KAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCLSIITFITWITLSNL 499
             I  G +T    I + + S +  K P+Q   D L              T +++I+   +
Sbjct: 259 IVIGTGTNTSYGAIFEMVNSIEKPKTPLQETMDRLG-------------TELSYISFFII 305

Query: 500 LTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIGAQHGVLIKGG 559
                V     N+      FQ+++S+ V A P  L +     + +G     +   +++  
Sbjct: 306 AIISIVGIIRGNS--LLMMFQVSVSLAVAAIPEGLPIIVTVTLALGVLRMTKQNAIVRRL 363

Query: 560 DILERFNTITKIVFDKTGTITTGQMTVQRF 589
             +E   ++  I  DKTGT+TT  MTV + 
Sbjct: 364 PSVETLGSVNVICTDKTGTLTTNHMTVSKL 393

>Kwal_14.1498
          Length = 939

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 69/148 (46%), Gaps = 29/148 (19%)

Query: 693 TLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAA-------- 744
           T  G   + D  +  V   ++ L      I M+TGD+   A+ +A+Q+GI          
Sbjct: 560 TFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTAVSIARQIGIPVVNPETAVL 619

Query: 745 -------------------NNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLV 785
                               N+++  TP  K  IV +LQ      VA  GDG+ND+P L 
Sbjct: 620 TGDKLDHMSEDQLASIIDHVNIFARATPEHKLNIVRALQKRG-DIVAMTGDGVNDAPALK 678

Query: 786 TSDIGVAL-STGTDIAMEAADIVVLGND 812
            +DIGV++   GTD+A EA+D+V+  +D
Sbjct: 679 LADIGVSMGKMGTDVAKEASDMVLTDDD 706

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 114/276 (41%), Gaps = 56/276 (20%)

Query: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401
           ++  SL  L +L P +C +++          ++  ++L   D++  + G +IPAD  II+
Sbjct: 132 RSEKSLEALNRLVPDQCHLIR-----CGQESKLLASVLVPGDVVRFRVGDRIPADLRIIE 186

Query: 402 G-ESEIDESLMTGESILVHK---------------------QKGSQVIAGSLNGPGHFYF 439
             +  I+ES +TGE+  VHK                     ++      G+L   GH   
Sbjct: 187 AVDLSIEESNLTGENEPVHKSTATVNKEFYKENLGSIVPVSERSCIAFMGTLVREGHGRG 246

Query: 440 KAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLA------SIFVPTILCL-SIITFIT 492
             I    +T   ++ + M + +  K P+Q   D L       S  V  I+CL  +I   +
Sbjct: 247 IVIGTAKNTAFGKVFEMMNAIEKPKTPLQTAMDKLGKDLSFMSFIVIGIICLIGVIQGRS 306

Query: 493 WITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIGAQH 552
           W+ +                      FQI++S+ V A P  L +     + +G    A+ 
Sbjct: 307 WLEM----------------------FQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR 344

Query: 553 GVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQR 588
             +I+    +E   ++  I  DKTGT+T   M+V +
Sbjct: 345 RAIIRRLPSVETLGSVNVICSDKTGTLTANHMSVNK 380

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 69/148 (46%), Gaps = 29/148 (19%)

Query: 693 TLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAA-------- 744
           T  G   + D  +  V   I+ L      + M+TGD+   A+ +A+Q+GI          
Sbjct: 559 TFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPEYSVL 618

Query: 745 -------------------NNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLV 785
                               NV++  TP  K  IV +LQ      VA  GDG+ND+P L 
Sbjct: 619 SGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRG-DIVAMTGDGVNDAPALK 677

Query: 786 TSDIGVAL-STGTDIAMEAADIVVLGND 812
            +DIGV++   GTD+A EA+D+V+  +D
Sbjct: 678 LADIGVSMGKMGTDVAKEASDMVLTDDD 705

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 114/269 (42%), Gaps = 42/269 (15%)

Query: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401
           ++  SL  L +L P++C + +     Q SH+ + +NL+   D++  K G +IPAD  I++
Sbjct: 132 KSEKSLEALNKLVPAECHLTRSG---QLSHV-LASNLVP-GDLVRFKVGDRIPADLRIVE 186

Query: 402 G-ESEIDESLMTGESILVHKQKGS-----------QVIA----------GSLNGPGHFYF 439
             +  +DES +TGE+  VHK  G+            +I           G+L   GH   
Sbjct: 187 SIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKG 246

Query: 440 KAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCLSIITFITWITLSNL 499
             I  G  T    + + M      K P+Q   D L          LS ++F+    +  +
Sbjct: 247 IVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQ-------DLSYMSFVLIGIICLI 299

Query: 500 LTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIGAQHGVLIKGG 559
                          +   FQIA+S+ V A P  L +     + +G    A+   +++  
Sbjct: 300 GII--------QGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRL 351

Query: 560 DILERFNTITKIVFDKTGTITTGQMTVQR 588
             +E   ++  I  DKTGT+T   MTV +
Sbjct: 352 PSVETLGSVNVICSDKTGTLTANHMTVSK 380

>Kwal_47.17547
          Length = 1240

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 82/282 (29%), Positives = 125/282 (44%), Gaps = 51/282 (18%)

Query: 383 DIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHK-------QKGSQV--------- 426
           DI+ ++ G  +PAD I+++G  E DES +TGES  + K       +K  Q+         
Sbjct: 208 DILSLQTGDVVPADCILVKGSCECDESALTGESATIKKAAIDVCYEKYKQLSATDAAIDI 267

Query: 427 -------------IAGS--LNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNA 471
                        I+GS  L+G G       ++G ++   + +  +K  +    P+Q   
Sbjct: 268 GTPGAEKVPDPMLISGSKLLSGLGRAV--VTSVGVNSMHGRTLMALK-VEAETTPLQERL 324

Query: 472 DYLA-SIFV---PTILCLSIITFITWITLSNLLTKPPV--IFTNNNNGKFYTSFQIAISV 525
           D LA SI V      L L  I F+ +  L+NL     +  +       +F   F + I+V
Sbjct: 325 DSLANSISVYGSAAALLLFFILFMRF--LANLKKGGELHDLTPAQKGSRFMNIFIVGITV 382

Query: 526 IVVACPCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMT 585
           IVVA P  L LA   A+   T   A+ G L++     E   + T +  DKTGT+T  +MT
Sbjct: 383 IVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLRACETMGSATAVCSDKTGTLTENRMT 442

Query: 586 VQR-FI--PYSNDDLPVLPCIMAAQSISEHPVAKAIVNYCGE 624
           V + F+   + ++   V P      S SE  V  AI N C E
Sbjct: 443 VVKGFLGSTFFDEAESVGP------SDSETDVDLAIANECSE 478

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 72/153 (47%), Gaps = 37/153 (24%)

Query: 692 DTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAAN------ 745
           D +VG   I+D +++ V   ++  Q     + MVTGD+   A  +A++  I +       
Sbjct: 718 DGIVG---IQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEEQAENP 774

Query: 746 ------------------------NVYSGVTPSGKCEIVESLQADSVGGV-AFVGDGIND 780
                                    V +  +P  K  +VE+L+   +G V A  GDG ND
Sbjct: 775 ESSMEGPRFRKLSNKERVRILPNLRVLARSSPEDKRILVETLK--KMGDVVAVTGDGTND 832

Query: 781 SPVLVTSDIGVALS-TGTDIAMEAADIVVLGND 812
           +P L  +D+G ++   GT++A EA+DI+++ +D
Sbjct: 833 APALKLADVGFSMGIAGTEVAREASDIILMTDD 865

>Scas_710.41
          Length = 904

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 87/199 (43%), Gaps = 41/199 (20%)

Query: 694 LVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAAN-------- 745
           ++G     D  ++D A  I   + L   + M+TGD+ G A + ++Q+G+  N        
Sbjct: 513 ILGVMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGLGVNIYNAEKLG 572

Query: 746 -------------------NVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVT 786
                              + ++ V P  K ++VE LQ      VA  GDG+ND+P L  
Sbjct: 573 LGGGGDMPGSELADFVENADGFAEVFPQHKYKVVEILQNRGYL-VAMTGDGVNDAPSLKK 631

Query: 787 SDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRVKWNLFWALGY 846
           +D G+A+   TD A  AADIV L         L  +I  L  S   F R+         Y
Sbjct: 632 ADTGIAVEGATDAARSAADIVFLA------PGLSAIIDGLKTSRQIFHRM-------YSY 678

Query: 847 NIFMIPIAMGILVPWGITI 865
            ++ I +++ + + +G+ I
Sbjct: 679 VVYRIALSLHLEIFFGLWI 697

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 99/242 (40%), Gaps = 24/242 (9%)

Query: 373 EIETNLLQRNDIIEIKPGMKIPADGIIIQGES--EIDESLMTGESILVHKQKGSQVIAGS 430
           EI  N +   DI+E+  G  IPADG ++      ++D+S +TGES+ V K  G    + S
Sbjct: 177 EIPANEIVPGDILELDEGTIIPADGRLVTENRFLQVDQSAITGESLAVDKNYGDVTFSSS 236

Query: 431 LNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCLSIITF 490
               G         GD+T + +    +  A   +    +  D L  I    ++ + I   
Sbjct: 237 TVKTGTSVMVVTATGDNTFVGRAAALVGEASGGQG---HFTDILNDIGTILLVLVIITLL 293

Query: 491 ITWITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIGA 550
           + W             F   +       F + I++I V  P  L     T + VG    A
Sbjct: 294 LVWTAC----------FYRTDGIVMILRFTLGITIIGV--PVGLPAVVTTTMAVGAAYLA 341

Query: 551 QHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPY-----SNDDLPVLPCIMA 605
           +   +++    +E    +  +  DKTGT+T  ++++    PY     S DDL +  C+ A
Sbjct: 342 KKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE--PYTVEGVSADDLMLTACLAA 399

Query: 606 AQ 607
            +
Sbjct: 400 TR 401

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 70/160 (43%), Gaps = 37/160 (23%)

Query: 685 KSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAA 744
           + Y     T +G   I D  +E+ A  ++       ++ M+TGD  G A  +AQ+VGI  
Sbjct: 627 RDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILP 686

Query: 745 NNVY-----------------------------------SGVTPSGKCEIVESLQADSVG 769
            N+Y                                   +  +P  K  ++E+L      
Sbjct: 687 TNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRRE-K 745

Query: 770 GVAFVGDGINDSPVLVTSDIGVALS-TGTDIAMEAADIVV 808
             A  GDG+NDSP L  +++G+A+   G+D+A +A+DIV+
Sbjct: 746 FCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVL 785

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 79/354 (22%), Positives = 144/354 (40%), Gaps = 62/354 (17%)

Query: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPAD-GIII 400
           + S +++ L  L+     ++++ N    S +   T+++   D++ +K G  IPAD  ++ 
Sbjct: 110 KASKTMNALRALSSPNAHVIRNGN----SEVVDSTDVVP-GDLVVVKVGDTIPADLRLVS 164

Query: 401 QGESEIDESLMTGESILVHKQ-------------------KGSQVIAGSLNGPGHFYFKA 441
           Q   E DE+L+TGES+ V K                      S V+ G   G       A
Sbjct: 165 QQNFETDEALLTGESLPVSKDANEIFDDETPVGDRINLAFSSSTVVKGRAQG------IA 218

Query: 442 INIGDDTKLAQIIQTMKSAQ--LNKAPIQNNADYLASIFVPTILCLSIITFITWIT---- 495
           I  G +T++ +I ++++     +++ P +    +  + ++ T   +      T  T    
Sbjct: 219 IKTGLNTEIGKIAKSLRGGNELISRDPAKT---WYQNAWISTKRTVGAFLGTTQGTPLHR 275

Query: 496 ----LSNLLTKPPVIFT--NNNNGKFYTSFQIAISVIVVAC---PCALGLATPTAIMVGT 546
               L+ LL    V+F      + KF     +AI  + VA    P +L +     + VG 
Sbjct: 276 KLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGA 335

Query: 547 GIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYSNDDLPVLPCIMAA 606
            + A   V+I+  D LE    +  I  DKTGT+T G+M  ++        +P    +   
Sbjct: 336 AVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIW------VPKFGTLQVV 389

Query: 607 QSISEHPVAKAIVNYCGESS-------QDCDAGVIVTKSEIIIGKGVRCECEYQ 653
            S       K  +N+    S       +  D G++    +   GK +   C+YQ
Sbjct: 390 GSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQNFKDKYEGKSIPGNCQYQ 443

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 75/262 (28%), Positives = 108/262 (41%), Gaps = 44/262 (16%)

Query: 383 DIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHKQKGSQVIAG--SLNG-PGHFYF 439
           D+I ++ G  +PAD ++I G+ E DES +TGES  + K      +      N    H + 
Sbjct: 214 DVISLQTGDVVPADCVMISGKCEADESSITGESNTIQKFPVDNSLRDFKKFNSIDSHNHS 273

Query: 440 KAINIGD----DTKLAQII--------------------------QTMKS--AQLNKAPI 467
           K ++IGD      K+A  +                          QTM S  A+    P+
Sbjct: 274 KPLDIGDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPL 333

Query: 468 QNNADYLASIFVPTILCLS-IITFITWITLSNLLTKPPV-----IFTNNNNGKFYTSFQI 521
           Q +   LA   +    C+S II F+   T       P       +       KF   F  
Sbjct: 334 QLHLSQLAD-NISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFIT 392

Query: 522 AISVIVVACPCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITT 581
           +I+VIVVA P  L LA   A+   T    + G L++     E   + T +  DKTGT+T 
Sbjct: 393 SITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTE 452

Query: 582 GQMTVQRFIPYSN--DDLPVLP 601
             MTV R  P ++  DD   LP
Sbjct: 453 NVMTVVRGFPGNSKFDDSKSLP 474

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 73/151 (48%), Gaps = 34/151 (22%)

Query: 694 LVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAANNV----YS 749
           L G   I+D ++  V + +Q  Q     + MVTGD+   A  +A+   I + ++    YS
Sbjct: 730 LDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSEAYS 789

Query: 750 GV--------------------------TPSGKCEIVESLQADSVGG-VAFVGDGINDSP 782
            +                          +P  K  +VE+L+   +G  VA  GDG ND+P
Sbjct: 790 AMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKG--MGDVVAVTGDGTNDAP 847

Query: 783 VLVTSDIGVALS-TGTDIAMEAADIVVLGND 812
            L  +D+G ++  +GT++A EA+DI+++ +D
Sbjct: 848 ALKLADVGFSMGISGTEVAREASDIILMTDD 878

>Kwal_23.3160
          Length = 1100

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 87/304 (28%), Positives = 138/304 (45%), Gaps = 49/304 (16%)

Query: 325 LIAFISF-----GKLLENKAKAQTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLL 379
           +IAF+ F     G   E KA ++T +SL  L   TPS  +I +D N+       I +  L
Sbjct: 102 VIAFVVFINVAIGSYQEYKA-SKTMNSLKSLS--TPSAHVI-RDGNDET-----IPSKQL 152

Query: 380 QRNDIIEIKPGMKIPADGIIIQGES-EIDESLMTGESILVHKQKGSQVIAGSLNGP---- 434
              D+  +K G  +PAD  +I+  + E DE+L+TGES+ + K+  SQV   + + P    
Sbjct: 153 VPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKE-ASQVYPATEDTPVGDR 211

Query: 435 ------------GHFYFKAINIGDDTKLAQIIQTMK------SAQLNKAPIQNNADYLAS 476
                       G      +  G +T++ +I Q++K      S   NK    N    LA+
Sbjct: 212 LNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAA 271

Query: 477 I---FVPTILCLSIITFITWITLSNLLTKPPVIFT--NNNNGKFYTSFQIAISVIVVAC- 530
               F+ T     +   ++   L+ LL    V+F        KF  + ++AI  I VA  
Sbjct: 272 TIGSFLGTTTGTPLHRKLS--KLAVLLFFIAVVFAIVVMATQKFVVNKEVAIYAICVAVS 329

Query: 531 --PCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTV-Q 587
             P +L +     + VG  I A   V+++  D LE    +  +  DKTGT+T G+M V Q
Sbjct: 330 MIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQ 389

Query: 588 RFIP 591
            ++P
Sbjct: 390 AWVP 393

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 70/160 (43%), Gaps = 37/160 (23%)

Query: 685 KSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAA 744
           + +V  +    G   I D  +++ A  ++       +++M+TGD  G A  +AQ+VGI  
Sbjct: 638 RDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILP 697

Query: 745 NNVY-----------------------------------SGVTPSGKCEIVESLQADSVG 769
            N+Y                                   +   P  K  ++++L      
Sbjct: 698 RNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRRE-K 756

Query: 770 GVAFVGDGINDSPVLVTSDIGVALS-TGTDIAMEAADIVV 808
             A  GDG+NDSP L  +++G+A+   G+D+A +A+DIV+
Sbjct: 757 FCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVL 796

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 72/160 (45%), Gaps = 37/160 (23%)

Query: 685 KSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAA 744
           + +V    T +G   I D  +++    ++       +++M+TGD  G A  +AQ+VGI  
Sbjct: 621 RDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILP 680

Query: 745 NNVY-----------------------------------SGVTPSGKCEIVESLQADSVG 769
           +N+Y                                   +   P  K  ++E+L   S  
Sbjct: 681 HNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRS-K 739

Query: 770 GVAFVGDGINDSPVLVTSDIGVALS-TGTDIAMEAADIVV 808
             A  GDG+NDSP L  +++G+A+   G+D+A +A+DIV+
Sbjct: 740 FCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVL 779

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 119/275 (43%), Gaps = 32/275 (11%)

Query: 344 SSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQG- 402
           S +++ L  L+     +++D N+I      I++  L   DI  IK G  +PAD  +++  
Sbjct: 118 SKTMNSLKSLSTPSAHVIRDGNDIT-----IQSKELVPGDICIIKVGDTVPADLRLLESI 172

Query: 403 ESEIDESLMTGESILVHK------QKGSQV-------IAGSLNGPGHFYFKAINIGDDTK 449
             E DE+L+TGES+ V K      +K + V        A S    G      I    +T+
Sbjct: 173 NLETDEALLTGESLPVAKSHSEVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTE 232

Query: 450 LAQIIQTMKS------AQLNKAPIQNNADYLASI---FVPTILCLSIITFITWITLSNLL 500
           + +I +++KS         NK+  QN    L      F+ T +   +   ++ + +   +
Sbjct: 233 IGKIAKSLKSETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQLAILLFV 292

Query: 501 TKPPVIFTNNNNGKFYTSFQIAISVIVVAC---PCALGLATPTAIMVGTGIGAQHGVLIK 557
                        K+  + Q+AI  I VA    P +L +     +  G  + A   V+++
Sbjct: 293 VAVIFAIVVMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVR 352

Query: 558 GGDILERFNTITKIVFDKTGTITTGQMTV-QRFIP 591
             D LE    +  I  DKTGT+T G+M   Q +IP
Sbjct: 353 KLDSLEALGAVNDICSDKTGTLTQGKMIAKQVWIP 387

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 72/160 (45%), Gaps = 37/160 (23%)

Query: 685 KSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAA 744
           + +V  N T +G   I D  + +    ++       +++M+TGD  G A  +AQ+VGI  
Sbjct: 621 RDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGTAKSIAQEVGILP 680

Query: 745 NNVY-----------------------------------SGVTPSGKCEIVESLQADSVG 769
           +N+Y                                   +   P  K  ++E+L   +  
Sbjct: 681 HNLYHYPKEVVNFMVMTATDFDALSDKEIDELPVLPLVIARCAPQTKVRMIEALHRRN-R 739

Query: 770 GVAFVGDGINDSPVLVTSDIGVALS-TGTDIAMEAADIVV 808
             A  GDG+NDSP L  +++G+A+   G+D+A +A+DIV+
Sbjct: 740 FCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVL 779

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 86/328 (26%), Positives = 137/328 (41%), Gaps = 53/328 (16%)

Query: 325 LIAFISF-----GKLLENKAKAQTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLL 379
           +IAF+ F     G   E  A ++T +SL  L   TPS  +I         + + IE+  L
Sbjct: 98  VIAFVVFINVVIGAYQEYNA-SKTMNSLKSLS--TPSAHVIRA------GNDLTIESKEL 148

Query: 380 QRNDIIEIKPGMKIPADGIIIQG-ESEIDESLMTGESILVHKQKG-------------SQ 425
              DI  I+ G  +PAD  + +    E DE+L+TGES+ V K  G             + 
Sbjct: 149 VPGDICIIRVGDTVPADLRLFEAINLETDEALLTGESLPVAKSHGEVYEQDTPVGDRLNL 208

Query: 426 VIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCL 485
             A S    G      I    +T++ +I +++KS + +      +  +  ++++   L  
Sbjct: 209 AFAASTVTKGRATGIVIKTALNTEIGKIAKSLKS-EASLISRDKSKSFGRNLWI--TLRE 265

Query: 486 SIITFI---TWITLSNLLTKPPVIFTNN---------NNGKFYTSFQIAISVIVVAC--- 530
           SI TF+       L   L++  ++                KF  + Q+AI  I VA    
Sbjct: 266 SIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKFKVNKQVAIYAICVALSMI 325

Query: 531 PCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTV-QRF 589
           P +L +     +  G  + A   V+I+  D LE    +  I  DKTGT+T G+M   Q +
Sbjct: 326 PSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQVW 385

Query: 590 IPY------SNDDLPVLPCIMAAQSISE 611
           IP        N + P  P I   Q I +
Sbjct: 386 IPQFGTINVQNSNEPFNPTIGEIQLIPK 413

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 102/248 (41%), Gaps = 46/248 (18%)

Query: 383 DIIEIKPGMKIPADGIIIQGESEIDESLMTGESILV-----------HKQKGSQ------ 425
           D+++++ G  +PAD ++++GE E DES +TGES  +           H   G +      
Sbjct: 179 DLLKLQTGDVVPADCVLVRGECETDESALTGESNTIKKLPLADALEYHSAHGGRDIGDTS 238

Query: 426 -----------------VIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKS------AQL 462
                            +I+GS    G       N+G ++   + + ++K        Q+
Sbjct: 239 ASGASGAADDSRCPDCMLISGSRVLSGLASAIVTNVGVNSVHGKTMASLKEDSEDTPLQM 298

Query: 463 NKAPIQNNADYLASIFVPTILCLSIITFITWITLS--NLLTKPPVIFTNNNNGKFYTSFQ 520
             + + +N      +   T+  +    ++++I  S       PP         KF   F 
Sbjct: 299 RLSQLTDNISVYGCVAAITLFVVLFARYLSYILPSGGKYHDLPPA----EKGSKFMDIFI 354

Query: 521 IAISVIVVACPCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTIT 580
            AI+VIVVA P  L LA   A+   T    + G L++     E   + T +  DKTGT+T
Sbjct: 355 TAITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLT 414

Query: 581 TGQMTVQR 588
              MTV R
Sbjct: 415 ENIMTVVR 422

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 74/153 (48%), Gaps = 37/153 (24%)

Query: 692 DTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAAN------ 745
           D +VG   I+D ++E+V + +   Q     + MVTGD+   A  +A+  GI ++      
Sbjct: 686 DAIVG---IQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSSKSLNDS 742

Query: 746 ------------------------NVYSGVTPSGKCEIVESLQADSVGGV-AFVGDGIND 780
                                    V +  +P  K  +V +L+   +G V A  GDG ND
Sbjct: 743 ACAMEGPAFRKLSDSERKRILPKLRVLARSSPEDKKILVRALK--EMGEVVAVTGDGTND 800

Query: 781 SPVLVTSDIGVALS-TGTDIAMEAADIVVLGND 812
           +P L  +D+G ++  TGT++A EA+DI+++ +D
Sbjct: 801 APALKLADVGFSMGITGTEVAREASDIILMTDD 833

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 67/151 (44%), Gaps = 37/151 (24%)

Query: 694 LVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAANNVY----- 748
            +G   I D  + + A  ++       +++M+TGD  G A  +AQ+VGI   N+Y     
Sbjct: 641 FLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQE 700

Query: 749 ------------------------------SGVTPSGKCEIVESLQADSVGGVAFVGDGI 778
                                         +  +P  K  ++E+L        A  GDG+
Sbjct: 701 IVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRK-KFCAMTGDGV 759

Query: 779 NDSPVLVTSDIGVALS-TGTDIAMEAADIVV 808
           NDSP L  +++G+A+   G+D++ EA+DIV+
Sbjct: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIVL 790

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 109/258 (42%), Gaps = 43/258 (16%)

Query: 383 DIIEIKPGMKIPADGIIIQGES-EIDESLMTGESILVHKQ-------------------- 421
           DI  +K G  IPAD  +I+ ++ + DESL+TGES+ V K                     
Sbjct: 150 DICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLA 209

Query: 422 -KGSQVIAGSLNGPGHFYFKAIN--IGDDTKLAQIIQTMKSAQLNKAPIQN---NADYLA 475
              S V+ G     G     A+N  IG   K  Q    + S   +K+ +QN   +   + 
Sbjct: 210 FSSSAVVKG--RAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVT 267

Query: 476 SIFVPTILCLSIITFITWITLSNLLTKPPVIFT--NNNNGKFYTSFQIAISVIVVAC--- 530
             F+ T +   +   ++   L+ LL    V+F      + KF    ++AI  I VA    
Sbjct: 268 GAFLGTNVGTPLHRKLS--KLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMI 325

Query: 531 PCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQ--- 587
           P +L +     + VG  +     V+++  D LE    +  I  DKTGT+T G+M  +   
Sbjct: 326 PSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIW 385

Query: 588 --RF--IPYSNDDLPVLP 601
             RF  I  SN D P  P
Sbjct: 386 IPRFGTITISNSDDPFNP 403

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 108/240 (45%), Gaps = 39/240 (16%)

Query: 383 DIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHK-------QKGSQV--------- 426
           D+I ++ G  +PAD ++I G  E DES +TGES  + K       +K  Q+         
Sbjct: 261 DVISLQTGDVVPADAVLISGSCECDESALTGESDTIKKVALKPALEKYKQIFEKDPTIDI 320

Query: 427 --------------IAGS--LNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQ-- 468
                         I+GS  L+G G+    ++  G+++   +I+  +K+ +    P+Q  
Sbjct: 321 GSHGVGEKVPDPLLISGSKLLSGIGNAVITSV--GENSVNGRIMMALKT-ESESTPLQER 377

Query: 469 --NNADYLASIFVPTILCLSIITFITWITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVI 526
             N AD ++       L L II FI ++T      K   +       KF   F  A++VI
Sbjct: 378 LSNLADNISIYGCMAALVLFIILFIRFLTYLPNGKKYHDLPPAQKGSKFMNIFITAVTVI 437

Query: 527 VVACPCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTV 586
           VVA P  L LA   A+   T    + G L++     E   + T I  DKTGT+T  +MTV
Sbjct: 438 VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGSATAICSDKTGTLTENRMTV 497

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 73/153 (47%), Gaps = 37/153 (24%)

Query: 692 DTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAANNVYSG- 750
           D +VG   ++D ++E V + ++  Q     + MVTGD+   A  +++   I +   Y+  
Sbjct: 755 DAMVG---LQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGYNDP 811

Query: 751 -----------------------------VTPSGKCEIVESLQADSVGGV-AFVGDGIND 780
                                         +P  K  +VE+L+   +G V A  GDG ND
Sbjct: 812 ECAMEGPTFRKLPYKKMLRVIPKLRVLARSSPEDKRILVETLK--KMGEVVAVTGDGTND 869

Query: 781 SPVLVTSDIGVALS-TGTDIAMEAADIVVLGND 812
           +P L  +D+G ++  +GT++A EA+DI+++ +D
Sbjct: 870 APALKLADVGFSMGISGTEVAREASDIILMTDD 902

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 67/151 (44%), Gaps = 37/151 (24%)

Query: 694 LVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAANNVY----- 748
            +G   I D  + + A  ++       +++M+TGD  G A  +AQ+VGI   N+Y     
Sbjct: 641 FLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQE 700

Query: 749 ------------------------------SGVTPSGKCEIVESLQADSVGGVAFVGDGI 778
                                         +  +P  K  ++E+L        A  GDG+
Sbjct: 701 IVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRK-KFCAMTGDGV 759

Query: 779 NDSPVLVTSDIGVALS-TGTDIAMEAADIVV 808
           NDSP L  +++G+A+   G+D++ EA+DIV+
Sbjct: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIVL 790

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 109/258 (42%), Gaps = 43/258 (16%)

Query: 383 DIIEIKPGMKIPADGIIIQGES-EIDESLMTGESILVHKQ-------------------- 421
           DI  +K G  IPAD  +I+ ++ + DESL+TGES+ V K                     
Sbjct: 150 DICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLA 209

Query: 422 -KGSQVIAGSLNGPGHFYFKAIN--IGDDTKLAQIIQTMKSAQLNKAPIQN---NADYLA 475
              S V+ G     G     A+N  IG   K  Q    + S   +K+ +QN   +   + 
Sbjct: 210 FSSSAVVKG--RAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVT 267

Query: 476 SIFVPTILCLSIITFITWITLSNLLTKPPVIFT--NNNNGKFYTSFQIAISVIVVAC--- 530
             F+ T +   +   ++   L+ LL    V+F      + KF    ++AI  I VA    
Sbjct: 268 GAFLGTNVGTPLHRKLS--KLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMI 325

Query: 531 PCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQ--- 587
           P +L +     + VG  +     V+++  D LE    +  I  DKTGT+T G+M  +   
Sbjct: 326 PSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIW 385

Query: 588 --RF--IPYSNDDLPVLP 601
             RF  I  SN D P  P
Sbjct: 386 IPRFGTITISNSDDPFNP 403

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 66/151 (43%), Gaps = 37/151 (24%)

Query: 694 LVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAANNVY----- 748
            +G   I D  + + A  ++       +++M+TGD  G A  +AQ+VGI   N+Y     
Sbjct: 641 FLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQE 700

Query: 749 ------------------------------SGVTPSGKCEIVESLQADSVGGVAFVGDGI 778
                                         +  +P  K  ++E+L           GDG+
Sbjct: 701 IVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRK-KFCTMTGDGV 759

Query: 779 NDSPVLVTSDIGVALS-TGTDIAMEAADIVV 808
           NDSP L  +++G+A+   G+D++ EA+DIV+
Sbjct: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIVL 790

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 109/258 (42%), Gaps = 43/258 (16%)

Query: 383 DIIEIKPGMKIPADGIIIQGES-EIDESLMTGESILVHKQ-------------------- 421
           DI  +K G  IPAD  +I+ ++ + DESL+TGES+ V K                     
Sbjct: 150 DICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLA 209

Query: 422 -KGSQVIAGSLNGPGHFYFKAIN--IGDDTKLAQIIQTMKSAQLNKAPIQN---NADYLA 475
              S V+ G     G     A+N  IG   K  Q    + S   +K+ +QN   +   + 
Sbjct: 210 FSSSAVVKG--RAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVT 267

Query: 476 SIFVPTILCLSIITFITWITLSNLLTKPPVIFT--NNNNGKFYTSFQIAISVIVVAC--- 530
             F+ T +   +   ++   L+ LL    V+F      + KF    ++AI  I VA    
Sbjct: 268 GAFLGTNVGTPLHRKLS--KLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMI 325

Query: 531 PCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQ--- 587
           P +L +     + VG  +     V+++  D LE    +  I  DKTGT+T G+M  +   
Sbjct: 326 PSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIW 385

Query: 588 --RF--IPYSNDDLPVLP 601
             RF  I  SN D P  P
Sbjct: 386 IPRFGTITISNSDDPFNP 403

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 70/160 (43%), Gaps = 37/160 (23%)

Query: 685 KSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAA 744
           + +V  +    G   I D  + + A  ++       +++M+TGD  G A  +AQ+VGI  
Sbjct: 627 RDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILP 686

Query: 745 NNVY-----------------------------------SGVTPSGKCEIVESLQADSVG 769
           +N+Y                                   +   P  K  ++++L      
Sbjct: 687 HNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRRE-K 745

Query: 770 GVAFVGDGINDSPVLVTSDIGVALS-TGTDIAMEAADIVV 808
             A  GDG+NDSP L  +++G+A+   G+D+A +A+DIV+
Sbjct: 746 FCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVL 785

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 68/288 (23%), Positives = 126/288 (43%), Gaps = 37/288 (12%)

Query: 329 ISFGKLLENKAKAQTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIK 388
           +S G   E  A  +T +SL  L   TPS  +I   ++ + +S   +        DI++++
Sbjct: 109 VSIGAYQEYNA-CKTMNSLKDLS--TPSARVIRNGEDVVMASAQVVP------GDIVQVR 159

Query: 389 PGMKIPADGIIIQGES-EIDESLMTGESILVHKQKGS-------------QVIAGSLNGP 434
            G  +PAD  +++  + E DE+L+TGE++ V K   +                A S    
Sbjct: 160 VGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSK 219

Query: 435 GHFYFKAINIGDDTKLAQIIQTMKSAQ------LNKAPIQNNADYLASIFVPTILCLSII 488
           G      +  G  +++ +I ++++  Q       NK+ +QN         V + L  ++ 
Sbjct: 220 GRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTV-LTVKASVGSFLGTNVG 278

Query: 489 TFI--TWITLSNLLTKPPVIFT--NNNNGKFYTSFQIAISVIVVAC---PCALGLATPTA 541
           T +      L+ +L    V+F        KF  + ++AI  I VA    P +L +     
Sbjct: 279 TPLHRKLAKLALILFAIAVLFALIVMATQKFIVNREVAIYAICVALSMIPSSLVVVLTIT 338

Query: 542 IMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRF 589
           +  G  + +   V+++  D LE    +  I  DKTGT+T G+M +++ 
Sbjct: 339 MSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQL 386

>Scas_297.1
          Length = 800

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 45/69 (65%), Gaps = 4/69 (5%)

Query: 746 NVYSGVTPSGKCEIVESLQADSVGGV-AFVGDGINDSPVLVTSDIGVALS-TGTDIAMEA 803
            V +  +P  K  +VE+L+   +G V A  GDG ND+P L  +D+G ++  +GT++A EA
Sbjct: 50  RVMARSSPEDKRLLVETLKG--MGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREA 107

Query: 804 ADIVVLGND 812
           +DI+++ +D
Sbjct: 108 SDIILMTDD 116

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%)

Query: 383 DIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHKQK 422
           DII ++ G  IPADG++++G+ E+DES +TGES  + K K
Sbjct: 620 DIITLQTGDVIPADGVLVEGQCEVDESSITGESDTIKKVK 659

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 105/244 (43%), Gaps = 46/244 (18%)

Query: 383 DIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHKQK-------------------- 422
           D++ ++ G  +P D I+++G+ E DES +TGES  + K                      
Sbjct: 205 DLLSLQTGDVVPVDCILVEGKCECDESGITGESDTIKKVSLAMSLQVYRTVAADNPSADI 264

Query: 423 GSQ-----------VIAGS--LNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQN 469
           GS            +I+GS  L+G GH    A+  G  +   +++  +KS +    P+Q 
Sbjct: 265 GSSDNGHSLVPDPMLISGSKLLSGIGHAVVTAV--GPHSVHGKMMLALKS-EPETTPLQE 321

Query: 470 NADYLA-------SIFVPTILCLSIITFITWITLSNLLTKPPVIFTNNNNGKFYTSFQIA 522
             + LA       S+    +  +  + F++++    L    P   +     +F   F  A
Sbjct: 322 RLNTLADDISIYGSVAAFLLFVVLFLRFLSYLPKGRLYHDLP---SARKGSRFMDIFITA 378

Query: 523 ISVIVVACPCALGLATPTAIMVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTG 582
           ++VIVVA P  L LA   A+   T    + G L++     E   + T +  DKTGT+T  
Sbjct: 379 VTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGSATTVCSDKTGTLTQN 438

Query: 583 QMTV 586
           +M V
Sbjct: 439 KMVV 442

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 70/155 (45%), Gaps = 37/155 (23%)

Query: 690 INDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAANNVYS 749
           I D +VG   I D ++  V + ++  Q     + M+TGD+      +A+  GI + + Y+
Sbjct: 705 ILDGVVG---IHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILSESEYA 761

Query: 750 G------------------------------VTPSGKCEIVESLQA-DSVGGVAFVGDGI 778
                                           +P  K   V+ L+  + V  VA  GDG 
Sbjct: 762 DHECAMEGPVFRKLSRRQMMDAAPKLKVLARSSPEDKRIFVDILKKMNEV--VAVTGDGT 819

Query: 779 NDSPVLVTSDIGVALS-TGTDIAMEAADIVVLGND 812
           ND+P L  +D+G ++  +GT +A EA+DI+++ +D
Sbjct: 820 NDAPALTLADVGFSMGISGTGVAREASDIILMTDD 854

>Scas_569.0d
          Length = 468

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 747 VYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALS-TGTDIAMEAAD 805
           V +  +P  K  ++E+L        A  GDG+NDSP L  +++G+A+   G+D+A +A+D
Sbjct: 104 VIARCSPQTKVRMIEALHRRD-KFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASD 162

Query: 806 IVV 808
           IV+
Sbjct: 163 IVL 165

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 3/50 (6%)

Query: 746  NVYSGVTPSGKCEIVESLQADSVG-GVAFVGDGINDSPVLVTSDIGVALS 794
            ++Y+ ++P  K E+VE LQ  S+G  V F GDG ND   L  +DIG++LS
Sbjct: 1135 SIYARMSPDEKHELVERLQ--SIGYQVGFCGDGANDCGALKAADIGISLS 1182

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 67/133 (50%), Gaps = 22/133 (16%)

Query: 291 YLFSIFSIIHTMVLSRGNEESPMLPNVVFDTSVMLIAFIS-FGKLLENKAKAQTSSSLSK 349
           Y+F IFSII  M  +             + T + +I+ +S    L+E K   Q+S  LS+
Sbjct: 487 YIFQIFSIILWMFDAY----------YYYATCIFIISVLSVIDTLVETK---QSSERLSE 533

Query: 350 LIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEI-KPGMKI-PADGIIIQGESEID 407
           L Q     C +   ++   S   ++ ++ L   DI E+  P + + P D I+I G+  ++
Sbjct: 534 LSQFY---CDVRVYRDGFWS---QVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVN 587

Query: 408 ESLMTGESILVHK 420
           ES++TGES+ V K
Sbjct: 588 ESMLTGESVPVSK 600

>Scas_665.30
          Length = 1439

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 721 DIY-MVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGIN 779
           DI+ ++ GD + +  +      +    +Y+ ++P  K E++E LQ  +   V F GDG N
Sbjct: 902 DIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYT-VGFCGDGAN 960

Query: 780 DSPVLVTSDIGVALS 794
           D   L  +D+G++LS
Sbjct: 961 DCGALKAADVGISLS 975

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 383 DIIEIK-PGMKI-PADGIIIQGESEIDESLMTGESILVHK 420
           DI EI  P + + P D +++ G+  ++ES++TGES+ V K
Sbjct: 349 DIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVSK 388

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 746  NVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALS 794
            ++Y+ ++P  K E+VE LQ      V F GDG ND   L  ++IG++LS
Sbjct: 1125 SIYARMSPDEKHELVEQLQKLDYN-VGFCGDGANDCGALKAANIGISLS 1172

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 78/175 (44%), Gaps = 42/175 (24%)

Query: 291 YLFSIFSIIHTMVLSRGNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKL 350
           Y+F IFSII  +      ++       +F  SV+ I       ++E K  ++      KL
Sbjct: 486 YVFQIFSIILWLA-----DDYYYYAGCIFLISVLSI----IDTVIETKKNSE------KL 530

Query: 351 IQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIK-PGMKI-PADGIIIQGESEIDE 408
             ++   C +   K+   +   ++ ++ L   D+ EI  P + + P D ++I G+  ++E
Sbjct: 531 ADISHFNCEVRVYKDRFWT---QVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNE 587

Query: 409 SLMTGESILVHKQKGSQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLN 463
           S++TGES+ V K   ++                        +AQ++Q  KS+Q++
Sbjct: 588 SMLTGESVPVSKYAATEAT----------------------MAQLLQDFKSSQVS 620

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 746  NVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALS 794
            ++++ ++P  K E+VE LQ      V F GDG ND   L  +D+G++LS
Sbjct: 1138 SIFARMSPDEKHELVEQLQKMDYT-VGFCGDGANDCGALKAADVGISLS 1185

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (50%), Gaps = 12/106 (11%)

Query: 323 VMLIAFIS-FGKLLENKAKAQTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQR 381
           + LI+ +S    L+E K  ++T + +S         C +   +    SS   I ++ L  
Sbjct: 509 IFLISLLSILDTLIETKKISRTLAEMSHF------NCEVRVLREGFWSS---IHSSELVP 559

Query: 382 NDIIEIK-PGMKI-PADGIIIQGESEIDESLMTGESILVHKQKGSQ 425
            DI EI  P + + P D I++ G+  ++ES++TGES+ V K   S+
Sbjct: 560 GDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSKYPASE 605

>Kwal_26.9207
          Length = 1469

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 745  NNVYSGVTPSGKCEIVESLQA-DSVGGVAFVGDGINDSPVLVTSDIGVALS 794
            +++Y+ ++P  K E+V  LQ  D V  V F GDG ND   L  +D+GV+LS
Sbjct: 1154 SSIYARMSPDEKHELVGQLQGLDYV--VGFCGDGANDCGALKAADVGVSLS 1202

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 65/133 (48%), Gaps = 22/133 (16%)

Query: 291 YLFSIFSIIHTMVLSRGNEESPMLPNVVFDTSVMLIAFISF-GKLLENKAKAQTSSSLSK 349
           Y+F IFSI+  +  +             +   + +I+ +S    L+E K  +Q      +
Sbjct: 505 YVFQIFSILLWLADNY----------YYYAACIFIISMLSIIDTLVETKKTSQ------R 548

Query: 350 LIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIK-PGMK-IPADGIIIQGESEID 407
           L +++ S C +   ++      +++ ++ L   D+ EI  P +   P D +++ G+  ++
Sbjct: 549 LAEVSHSHCEVRVYRDGFW---VQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVN 605

Query: 408 ESLMTGESILVHK 420
           ES++TGES+ V K
Sbjct: 606 ESMLTGESVPVSK 618

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 745  NNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALS 794
            +++Y+ ++P  K E++  LQ      V F GDG ND   L  +D+G++LS
Sbjct: 1157 SSIYARMSPDEKHELMIQLQKLDYT-VGFCGDGANDCGALKAADVGISLS 1205

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 129/334 (38%), Gaps = 77/334 (23%)

Query: 291 YLFSIFSIIHTMVLSRGNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKL 350
           Y+F +FSII       G +E       +F  SV+ I    F  L E K  ++  + +S  
Sbjct: 499 YVFQVFSIILW-----GIDEYYYYAACIFLISVLSI----FDSLNEQKKVSRNLAEMSHF 549

Query: 351 IQLTPSKCIILQDK--NNIQSSHIEIETNLLQRNDIIEIK-PGMKI-PADGIIIQGESEI 406
                    +L+DK    I SS        L   DI E+  P + I P D I++  +  +
Sbjct: 550 ----HCDVRVLRDKFWTTISSSE-------LVPGDIYEVSDPNITILPCDSILLSSDCIV 598

Query: 407 DESLMTGESILVHKQKGSQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAP 466
           +ES++TGES+ V K   ++     L              DD +  QI     S+ ++K+ 
Sbjct: 599 NESMLTGESVPVSKFPATEETMYQL-------------CDDFQSTQI-----SSFVSKSF 640

Query: 467 IQNNADYLASIFVP-TILCLSIITFITWITLSNLLTKPPVIFTNNNNGKFYT-SFQ---- 520
           + N  + + +   P     L+++    + T    L +  ++F      KFY  SF+    
Sbjct: 641 LYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVR-SMVFPKPTGFKFYRDSFKYIGF 699

Query: 521 ---IAISVIVVACP--CALGL-------------------ATPTAIMVGTGIG----AQH 552
              IAI    V+C     LGL                   A P  + +GT        + 
Sbjct: 700 MSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEK 759

Query: 553 GVLIKGGDILERFNTITKIVFDKTGTITTGQMTV 586
           G+       L     I  + FDKTGT+T   + V
Sbjct: 760 GIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDV 793

>Scas_583.14*
          Length = 875

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 747 VYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALSTGTDIAMEA 803
           VY+ V+PS K  I+ +L+      +   GDG ND   L  + +GVAL  GT+ +M A
Sbjct: 442 VYARVSPSQKEFILNNLKEMGYQTL-MCGDGTNDVGALKQAHVGVALLNGTEESMTA 497

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query: 747 VYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALSTGTDIAMEAADI 806
           VY+ V+P+ K  I+ SL+ D        GDG ND   L  + +G+AL  GT+  ++    
Sbjct: 789 VYARVSPAQKEFIMNSLK-DMGYQTLMCGDGTNDVGALKQAHVGIALLNGTEEGLKKL-- 845

Query: 807 VVLGNDQDERESLKGL 822
                +Q   E+LK +
Sbjct: 846 ----QEQRRIENLKAM 857

>AFR206C [3398] [Homologous to ScYKL140W (TGL1) - SH]
           (807181..808509) [1329 bp, 442 aa]
          Length = 442

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 6/83 (7%)

Query: 279 MDTLIALSTSCAYL-FSIFSIIHTMVLSRGNEESPMLPNVVFDTSVMLIAFISFGKLLEN 337
           +D+LI  + +  YL F   +++ + VL +      +LP+ VFD  +     + FG    N
Sbjct: 244 LDSLIKFTPNLTYLLFGRKALLSSTVLWQR-----LLPHGVFDALIDRALCLLFGWRSAN 298

Query: 338 KAKAQTSSSLSKLIQLTPSKCII 360
            A  Q   S SKL   T  KCI+
Sbjct: 299 IAPEQKHVSYSKLYSTTSVKCIV 321

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 57/118 (48%), Gaps = 17/118 (14%)

Query: 690 INDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQ-----QVGIAA 744
           +N+T+V  F   D+   D  +I Q      YD+ +      G A+K+ Q     +  I  
Sbjct: 735 VNETIVKPFN-PDADTFDEKEIFQ-----KYDLAVT-----GHALKLLQGHKQLRDVIRH 783

Query: 745 NNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALSTGTDIAME 802
             +Y+ V+PS K  I+ +L+ D        GDG ND   L  + +G+AL  GT+ +++
Sbjct: 784 TWIYARVSPSQKEFILITLK-DMGYQTLMCGDGTNDVGALKQAHVGIALLNGTEDSLK 840

>YDR440W (DOT1) [1261] chr4 (1342481..1344229) Histone H3
           methyltransferase specific for lysine 79 that is
           involved in silencing at telomeres and other repressed
           loci, required for meiotic arrest checkpoint [1749 bp,
           582 aa]
          Length = 582

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 47/105 (44%), Gaps = 4/105 (3%)

Query: 730 HGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDI 789
           H  A K+      + N VY  + P+   ++ +  Q         +G G+ +  V    + 
Sbjct: 355 HPQANKLKHYKAFS-NYVYGELLPNFLSDVYQQCQLKKGDTFMDLGSGVGNCVVQAALEC 413

Query: 790 GVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFS 834
           G ALS G +I  +A+D+ +L   Q E    +  +Y + ++ + FS
Sbjct: 414 GCALSFGCEIMDDASDLTIL---QYEELKKRCKLYGMRLNNVEFS 455

>CAGL0G06270g 598357..602343 highly similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2, start by
           similarity
          Length = 1328

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%)

Query: 693 TLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVA 737
           TL+G   I D ++E V D I+ LQ     I+++TGD    A+ + 
Sbjct: 783 TLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIG 827

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 747 VYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALSTGTD 798
           VY+ V+PS K  ++ +L+ D        GDG ND   L  + +G+AL  GT+
Sbjct: 788 VYARVSPSQKEFLLNTLK-DMGYQTLMCGDGTNDVGALKQAHVGIALLNGTE 838

>KLLA0C08393g 734655..738101 highly similar to sp|P40527
           Saccharomyces cerevisiae YIL048w NEO1 ATPase whose
           overproduction confers neomycin resistance, start by
           similarity
          Length = 1148

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 5/42 (11%)

Query: 379 LQRNDIIEIKPGMKIPADGIIIQ-----GESEIDESLMTGES 415
           L+  DII++K G ++PAD +++Q     GES I    + GE+
Sbjct: 273 LKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGET 314

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 747 VYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALSTGTD 798
           +Y+ V+P+ K  I+ +L+ D        GDG ND   L  + +GVAL  GT+
Sbjct: 786 IYARVSPAQKEFILNNLK-DMGYQTLMCGDGTNDVGALKQAHVGVALLNGTE 836

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 693  TLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKV 736
            TL+G   I D ++E V D I  L+     ++M+TGD    A+ +
Sbjct: 1001 TLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINI 1044

>KLLA0D02618g complement(220267..224253) similar to sgd|S0004417
            Saccharomyces cerevisiae YLR425w TUS1, hypothetical start
          Length = 1328

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 308  NEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSS 345
            NEE   LP  + DTS + +  +SF K  E+K+K  +S+
Sbjct: 1152 NEEGAFLPTTLTDTSKLKLNHLSFRKQTESKSKNNSST 1189

>Scas_654.13
          Length = 360

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 43/89 (48%), Gaps = 11/89 (12%)

Query: 407 DESLMTGESILVHKQKGSQVIAGS--LNGPGHFYF------KAINIGDDTKLAQIIQTMK 458
           D ++   ++I  +  KG+ VI  S  L G G F        K I I +D KLA I+   K
Sbjct: 123 DVAVSVNKTINKNTTKGAVVITNSKSLEGLGFFSSVVFNDSKPIVISEDNKLATIVANDK 182

Query: 459 SAQLNKAPIQNNADYL--ASIFVPTILCL 485
           SA  ++ P+    D L  + +F P+  CL
Sbjct: 183 SAA-SRGPLVVTKDGLIYSGVFAPSSACL 210

>Scas_89.1
          Length = 271

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 685 KSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAA 744
           K ++  N  L+G   + D ++ DV   I+ L+     I+M+TGD     ++ A+ V I+A
Sbjct: 28  KKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDK----VETARCVSISA 83

Query: 745 NNVYSG 750
             +  G
Sbjct: 84  KLISRG 89

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,566,759
Number of extensions: 1185958
Number of successful extensions: 3358
Number of sequences better than 10.0: 67
Number of HSP's gapped: 3278
Number of HSP's successfully gapped: 133
Length of query: 942
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 831
Effective length of database: 12,753,511
Effective search space: 10598167641
Effective search space used: 10598167641
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)