Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_615.8d58158127380.0
Kwal_55.21587464591174e-06
CAGL0M08580g197371082e-05
Scas_699.45450681103e-05
ACR083C375591051e-04
CAGL0L09933g408461051e-04
KLLA0F15994g427371051e-04
YOR042W (CUE5)411541041e-04
YDR273W (DON1)365521004e-04
YLR181C (VTA1)330141740.53
Sklu_1914.4501112721.2
ACR088W85085693.2
Scas_686.10*111347683.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_615.8d
         (581 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_615.8d                                                          1059   0.0  
Kwal_55.21587                                                          50   4e-06
CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08...    46   2e-05
Scas_699.45                                                            47   3e-05
ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -...    45   1e-04
CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces...    45   1e-04
KLLA0F15994g complement(1484383..1485666) weakly similar to sgd|...    45   1e-04
YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing ...    45   1e-04
YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the p...    43   4e-04
YLR181C (VTA1) [3585] chr12 complement(516680..517672) Protein o...    33   0.53 
Sklu_1914.4 YER021W, Contig c1914 5356-6861                            32   1.2  
ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH] complement(...    31   3.2  
Scas_686.10*                                                           31   3.6  

>Scas_615.8d
          Length = 581

 Score = 1059 bits (2738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/581 (91%), Positives = 534/581 (91%)

Query: 1   MGLFKKHQKAKRQEGXXXXXXXXXXXXSSMLNHENPFSALESNDEDVNTDLTXXXXXXXX 60
           MGLFKKHQKAKRQEG            SSMLNHENPFSALESNDEDVNTDLT        
Sbjct: 1   MGLFKKHQKAKRQEGKTNKKIKKKENTSSMLNHENPFSALESNDEDVNTDLTEEETLISE 60

Query: 61  XXXXXXXSNTPVSLSGENREETTAKTTMSNHERRSVSGVILISQKKSATEGPVTNSKKEL 120
                  SNTPVSLSGENREETTAKTTMSNHERRSVSGVILISQKKSATEGPVTNSKKEL
Sbjct: 61  EEEGKEESNTPVSLSGENREETTAKTTMSNHERRSVSGVILISQKKSATEGPVTNSKKEL 120

Query: 121 PELVQDSKQVIITESSKNQTKLETPSLREVLNINTLDDNSKFDTKGEAPSSNKETKDESS 180
           PELVQDSKQVIITESSKNQTKLETPSLREVLNINTLDDNSKFDTKGEAPSSNKETKDESS
Sbjct: 121 PELVQDSKQVIITESSKNQTKLETPSLREVLNINTLDDNSKFDTKGEAPSSNKETKDESS 180

Query: 181 KNNFKLEITSLDHGSKNGRIVENSNNEPNERTPFLKQTLNINPVDDVLNFDXXXXXXXXX 240
           KNNFKLEITSLDHGSKNGRIVENSNNEPNERTPFLKQTLNINPVDDVLNFD         
Sbjct: 181 KNNFKLEITSLDHGSKNGRIVENSNNEPNERTPFLKQTLNINPVDDVLNFDSKKESSPSN 240

Query: 241 XXLDTAIVIDETTGLKKEVSATFPKICSLTLAELSEILDTHSNIPELAKAFPSVDINVIK 300
             LDTAIVIDETTGLKKEVSATFPKICSLTLAELSEILDTHSNIPELAKAFPSVDINVIK
Sbjct: 241 SSLDTAIVIDETTGLKKEVSATFPKICSLTLAELSEILDTHSNIPELAKAFPSVDINVIK 300

Query: 301 SLLFASEGEVLPAFHALLFLTNQQNLETITITQVLPKKNILSELFDQKFSELRAMKKEAE 360
           SLLFASEGEVLPAFHALLFLTNQQNLETITITQVLPKKNILSELFDQKFSELRAMKKEAE
Sbjct: 301 SLLFASEGEVLPAFHALLFLTNQQNLETITITQVLPKKNILSELFDQKFSELRAMKKEAE 360

Query: 361 RYSDDIENVNVCGKTESSDVIVGVSNGEMSNCPIKMSDLAKEVGEADSDTKSQQSSLTLN 420
           RYSDDIENVNVCGKTESSDVIVGVSNGEMSNCPIKMSDLAKEVGEADSDTKSQQSSLTLN
Sbjct: 361 RYSDDIENVNVCGKTESSDVIVGVSNGEMSNCPIKMSDLAKEVGEADSDTKSQQSSLTLN 420

Query: 421 KANTSVAPHSVLTNKEPKKPNQVSYKEWLVKRRNEMGTPNNPTQRDNNRTKENPQRSPRD 480
           KANTSVAPHSVLTNKEPKKPNQVSYKEWLVKRRNEMGTPNNPTQRDNNRTKENPQRSPRD
Sbjct: 421 KANTSVAPHSVLTNKEPKKPNQVSYKEWLVKRRNEMGTPNNPTQRDNNRTKENPQRSPRD 480

Query: 481 SKGNNTLEKGVEQLKENNINPDIKEEKGDNSEAPIPQDRESDEGQKGELHVSENNLAKKA 540
           SKGNNTLEKGVEQLKENNINPDIKEEKGDNSEAPIPQDRESDEGQKGELHVSENNLAKKA
Sbjct: 481 SKGNNTLEKGVEQLKENNINPDIKEEKGDNSEAPIPQDRESDEGQKGELHVSENNLAKKA 540

Query: 541 SQAIAIVSKVIGTPTISSSIGKSLHDQVNXXXXXXXXXAKT 581
           SQAIAIVSKVIGTPTISSSIGKSLHDQVN         AKT
Sbjct: 541 SQAIAIVSKVIGTPTISSSIGKSLHDQVNSTSSSSVFSAKT 581

>Kwal_55.21587
          Length = 464

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 281 HSN--IPELAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLTNQQNLETITITQVLPK 337
           H N  + +L +AFP +D   +K++L AS+G + PAF+ALLFL++       T+   +P+
Sbjct: 112 HENPILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSDPSFEAEATVPTAVPQ 170

>CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08412
           Saccharomyces cerevisiae YOR042w, hypothetical start
          Length = 197

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%)

Query: 287 LAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLTNQ 323
           L KAFP+VD  +I+++L A+ G++ PAF+ALL LT +
Sbjct: 34  LVKAFPTVDKLIIRAILLAARGDLAPAFNALLSLTGE 70

>Scas_699.45
          Length = 450

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 42/68 (61%), Gaps = 9/68 (13%)

Query: 286 ELAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLTNQQNLETITI---------TQVLP 336
           +L +AFP+++   +K++L AS+G + PAF ALLFL++  + + I +         T  LP
Sbjct: 117 QLKEAFPNIEEKYVKTVLIASQGALDPAFEALLFLSDPNSSKDIELPTKPIAANATPALP 176

Query: 337 KKNILSEL 344
           ++  L++L
Sbjct: 177 QRRKLTQL 184

>ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -
           SH] (505794..506921) [1128 bp, 375 aa]
          Length = 375

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 265 KICSLTLAELSEILDTHSNI-PELAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLTN 322
           K+ S   AE  + L   ++I  EL  AFP+V+  ++K+++ AS+G + PAF ALLFL++
Sbjct: 83  KLQSQPSAEREQTLPKENSILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSD 141

>CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces
           cerevisiae YOR042w, hypothetical start
          Length = 408

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 35/46 (76%)

Query: 286 ELAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLTNQQNLETITI 331
           +L +AFP+++   +K+++ AS+G + PAF+ALLFL++ ++ + I +
Sbjct: 82  QLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIEL 127

>KLLA0F15994g complement(1484383..1485666) weakly similar to
           sgd|S0005568 Saccharomyces cerevisiae YOR042w, start by
           similarity
          Length = 427

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 31/37 (83%)

Query: 286 ELAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLTN 322
           +L +AFP+++   +K++L AS+G++ PAF+ALLF+++
Sbjct: 97  QLKEAFPNIEEKYVKAVLIASQGQLDPAFNALLFISD 133

>YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing a
           CUE domain, has low similarity to uncharacterized C.
           albicans Orf6.1738p [1236 bp, 411 aa]
          Length = 411

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 37/54 (68%)

Query: 286 ELAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLTNQQNLETITITQVLPKKN 339
           EL  AFP+++   IK+++ AS+G + PAF+ALLFL++ ++ + I +     +KN
Sbjct: 104 ELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDPESGKDIELPTQPVRKN 157

>YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the
           prospore membrane [1098 bp, 365 aa]
          Length = 365

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 34/52 (65%)

Query: 270 TLAELSEILDTHSNIPELAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLT 321
           T+ +L   ++    + EL  AFP VD  +IK++L AS+G + PAF++LL+ +
Sbjct: 73  TIGDLVSSVEKLCVLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYS 124

>YLR181C (VTA1) [3585] chr12 complement(516680..517672) Protein of
           unknown function [993 bp, 330 aa]
          Length = 330

 Score = 33.1 bits (74), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 64/141 (45%), Gaps = 18/141 (12%)

Query: 164 TKGEAPSSNKETKDESSKNNFKLEITS--LDHGSKNGRIVENSNNEPNERTPFLKQTLNI 221
            KGE  SS+++T D +   +   EI    +DH + +   +EN+NN+  E      QT + 
Sbjct: 162 AKGEIGSSDEKTLDYADFADDSEEIKDEDVDHQTSD---LENNNNDKVEGLAPKDQTTSY 218

Query: 222 NPVDDVLNF-DXXXXXXXXXXXLDT---AIVIDETTGLKKEVSATFPKI---------CS 268
            PVD+V  F D           +D    AI  DE   +KKEV  T P            S
Sbjct: 219 EPVDEVPEFIDDADSVNEEEQTVDKNEDAITKDEQQVVKKEVDLTRPSAPSEPAAAEHKS 278

Query: 269 LTLAELSEILDTHSNIPELAK 289
            T  EL++I+D  S I ++ K
Sbjct: 279 YTKDELTKIMDRASKIEQIQK 299

>Sklu_1914.4 YER021W, Contig c1914 5356-6861
          Length = 501

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 122 ELVQDSKQVIITESSKNQTKLETPSLREVLNINTLDDNSKFDTKGEAPSSNKETKDESSK 181
           E+++  +   +   ++ +  L T  LR+ L+   ++    F  K E P SN+ +    ++
Sbjct: 195 EMIKFLRTATLKHDNETRAMLTTLILRDFLSCGEVEIACDFVGKAEFPVSNEVSSPLEAR 254

Query: 182 NNF---KLEITSLDHGSKNGRIVENSNNEPNE--RTPFLKQTLNINPVDDVL 228
             F   K+    LD+ + N  ++      PN      FL+Q   ++ V D+L
Sbjct: 255 YYFYLSKINAIQLDYSTANEYVIAAIRKAPNTTNSLGFLQQANKLHCVIDLL 306

>ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH]
           complement(515561..518113) [2553 bp, 850 aa]
          Length = 850

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 40/85 (47%), Gaps = 11/85 (12%)

Query: 361 RYSDDI----ENVNVCGKTESSDVIVGVSNGEMSNCPIKMSDLAKEVGEADSDTKSQQSS 416
           RYSDD+    EN+ +C  TE+   +V +SNG+       M D   E+    +D+     S
Sbjct: 609 RYSDDVLTRAENITMCTTTENGIPLVTLSNGDGY-----MFDPDMEIWLLINDSWWAYGS 663

Query: 417 LTLNKANTSVAPHSVLT--NKEPKK 439
              +  NTS A  S     +KE KK
Sbjct: 664 QYWDFTNTSHAGSSAAAGNDKEDKK 688

>Scas_686.10*
          Length = 1113

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 30/47 (63%), Gaps = 6/47 (12%)

Query: 522 DEGQKGEL-----HVSENNLAKKASQAIAIVSKVIGTPTISSSIGKS 563
           D+  KG+L     HVSE++L+  + + I   S ++GTPT SSS GKS
Sbjct: 347 DKSLKGKLTSSLNHVSESDLSGNSEEEIPGAS-MLGTPTNSSSTGKS 392

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.304    0.123    0.326 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,113,806
Number of extensions: 844534
Number of successful extensions: 3960
Number of sequences better than 10.0: 255
Number of HSP's gapped: 3876
Number of HSP's successfully gapped: 289
Length of query: 581
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 474
Effective length of database: 12,891,983
Effective search space: 6110799942
Effective search space used: 6110799942
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 64 (29.3 bits)