Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_615.844744722790.0
YOR043W (WHI2)4864989971e-131
Kwal_55.216004424739811e-129
Scas_699.465125359711e-127
ACR082C4224528971e-117
KLLA0F15972g4584748961e-116
Sklu_1533.11921874936e-60
Scas_693.327965645.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_615.8
         (447 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_615.8                                                            882   0.0  
YOR043W (WHI2) [4854] chr15 (410869..412329) Protein involved in...   388   e-131
Kwal_55.21600                                                         382   e-129
Scas_699.46                                                           378   e-127
ACR082C [1129] [Homologous to ScYOR043W (WHI2) - SH] (503954..50...   350   e-117
KLLA0F15972g complement(1481761..1483137) similar to sp|P12611 S...   349   e-116
Sklu_1533.1 YOR043W, Contig c1533 830-1408 reverse complement         194   6e-60
Scas_693.3                                                             29   5.7  

>Scas_615.8
          Length = 447

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/447 (97%), Positives = 437/447 (97%)

Query: 1   MENIITQVPQNGAVPNGFINQSGLEQEDLSNYDNGNSLVHLNIQENHYFLTRDQLMTLPE 60
           MENIITQVPQNGAVPNGFINQSGLEQEDLSNYDNGNSLVHLNIQENHYFLTRDQLMTLPE
Sbjct: 1   MENIITQVPQNGAVPNGFINQSGLEQEDLSNYDNGNSLVHLNIQENHYFLTRDQLMTLPE 60

Query: 61  SLLLCLFPSGVFLDRADQVITNLTAEDEVFITNFPATCFEYIMEFYMKANDDLLNFPVLE 120
           SLLLCLFPSGVFLDRADQVITNLTAEDEVFITNFPATCFEYIMEFYMKANDDLLNFPVLE
Sbjct: 61  SLLLCLFPSGVFLDRADQVITNLTAEDEVFITNFPATCFEYIMEFYMKANDDLLNFPVLE 120

Query: 121 QFPSIRNANNHTRYQHPQTQQQFEQDAILHENPSIIVLREDLDYYCVPQXXXXXXXXXXG 180
           QFPSIRNANNHTRYQHPQTQQQFEQDAILHENPSIIVLREDLDYYCVPQ          G
Sbjct: 121 QFPSIRNANNHTRYQHPQTQQQFEQDAILHENPSIIVLREDLDYYCVPQLEFEFEPLPEG 180

Query: 181 RPPLDQYMKDDLLQHCMSQLKVAAGSYLLNQTSIFQGLYLSNKIHQHEVSQVPLHGSGKS 240
           RPPLDQYMKDDLLQHCMSQLKVAAGSYLLNQTSIFQGLYLSNKIHQHEVSQVPLHGSGKS
Sbjct: 181 RPPLDQYMKDDLLQHCMSQLKVAAGSYLLNQTSIFQGLYLSNKIHQHEVSQVPLHGSGKS 240

Query: 241 STLGPAEQHLMDMLCSSGFLPESQWGNRTQEFGKTIISSLSLCRLYNESTEDFRNAVTRE 300
           STLGPAEQHLMDMLCSSGFLPESQWGNRTQEFGKTIISSLSLCRLYNESTEDFRNAVTRE
Sbjct: 241 STLGPAEQHLMDMLCSSGFLPESQWGNRTQEFGKTIISSLSLCRLYNESTEDFRNAVTRE 300

Query: 301 MKNWKKNKDSNDGTKRFSMPIMEDGNSGRNIDDNVRNSVMIADDININSMPDDVYKLVPK 360
           MKNWKKNKDSNDGTKRFSMPIMEDGNSGRNIDDNVRNSVMIADDININSMPDDVYKLVPK
Sbjct: 301 MKNWKKNKDSNDGTKRFSMPIMEDGNSGRNIDDNVRNSVMIADDININSMPDDVYKLVPK 360

Query: 361 PTINNKLLLFWRKPARKSWWSAENVELEVEIYGSIVNVNGVNKVVLRVPQENANANDNEF 420
           PTINNKLLLFWRKPARKSWWSAENVELEVEIYGSIVNVNGVNKVVLRVPQENANANDNEF
Sbjct: 361 PTINNKLLLFWRKPARKSWWSAENVELEVEIYGSIVNVNGVNKVVLRVPQENANANDNEF 420

Query: 421 VTNTVKIPIKLHIRRVWTLELSVVGIQ 447
           VTNTVKIPIKLHIRRVWTLELSVVGIQ
Sbjct: 421 VTNTVKIPIKLHIRRVWTLELSVVGIQ 447

>YOR043W (WHI2) [4854] chr15 (410869..412329) Protein involved in
           growth regulation and stress response [1461 bp, 486 aa]
          Length = 486

 Score =  388 bits (997), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 234/498 (46%), Positives = 294/498 (59%), Gaps = 63/498 (12%)

Query: 1   MENIITQVPQNGAVPNGFINQSGLEQE---DLSNYDNGNSLVHLNIQENHYFLTRDQLMT 57
           M++IITQV  + A     + +   +Q    + +  D G+SL+HLNIQENHYF+TRDQLM+
Sbjct: 1   MDDIITQVSPDNAESAPILQEQQQQQNSQYEGNEEDYGDSLIHLNIQENHYFITRDQLMS 60

Query: 58  LPESLLLCLFPSGVFLDRADQVITNLTAEDEVFITNFPATCFEYIMEFYMKANDDLLNFP 117
           LPESLLLCLFPSGVFLDR  QVITNLT +DEV+I NFP  CFEYIME Y KA+DDL N P
Sbjct: 61  LPESLLLCLFPSGVFLDRCGQVITNLTRDDEVYIVNFPPDCFEYIMEIYTKAHDDLYNHP 120

Query: 118 VLEQF--PS---IRNANNHTRYQHPQTQQQFEQDAILHENPSIIVLREDLDYYCVPQXXX 172
           V + F  PS   + NA          +     +  ILH+ P+IIVLREDLDYYCVPQ   
Sbjct: 121 VEKFFDRPSSSFVSNAKGFFGLSSNNSISSNNEQDILHQKPAIIVLREDLDYYCVPQEEF 180

Query: 173 XXXXXXXGRPPLDQYMKDDLLQHCMSQLKVAAGSYLLNQTSIFQGLYLSNKIHQHEVSQV 232
                       ++   +DLL+H M+Q+K+AAGSYL ++TSIFQGLY SN++ Q +  Q 
Sbjct: 181 QFDST-------NEENNEDLLRHFMAQVKMAAGSYLTSKTSIFQGLYSSNRLKQQQQQQK 233

Query: 233 PLHG-------SGKSSTLGPAEQHLMDMLCSSGFLPESQWGNRTQEFGKTIISSLSLCRL 285
              G          S  LGPAEQHLMDMLCSSGF  E+ WGNRTQE GKT+ISSLSLCRL
Sbjct: 234 IEKGSNSSSNTKSTSKKLGPAEQHLMDMLCSSGFTKETCWGNRTQETGKTVISSLSLCRL 293

Query: 286 YNESTEDFRNAVTREMKNWK-KNKDSNDG-----------------------------TK 315
            NE+TE FR         W+ ++K S D                              T 
Sbjct: 294 ANETTEGFRQKFNEAKAKWEAEHKPSQDNFITPMQSNISINSLSASKSNSTISTARNLTS 353

Query: 316 RFSMP-IMEDGNSGR--NIDDNVRNSVMIADDININSMPDD---VYKLVPKPTINNKLLL 369
             + P    D    R   + DNVR+           S P +   +Y LVPKP IN KLLL
Sbjct: 354 GSTAPATARDKRKSRLSKLADNVRSHSSSRHSSQTRSKPPELPKLYDLVPKPNINAKLLL 413

Query: 370 FWRKPARKSWWSAENVELEVEIYGSIVNVNGVNKVVLRVPQENANANDNEFVTNTVKIPI 429
           FWRKPARK WW  E++ELEVE++GS  + +   K++  +   N    D E   + + +P+
Sbjct: 414 FWRKPARKCWWGEEDIELEVEVFGSWKDES--KKIIELILPTNV---DPEAELHKIIVPV 468

Query: 430 KLHIRRVWTLELSVVGIQ 447
           +LHIRRVWTLELSV+G+Q
Sbjct: 469 RLHIRRVWTLELSVIGVQ 486

>Kwal_55.21600
          Length = 442

 Score =  382 bits (981), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 217/473 (45%), Positives = 295/473 (62%), Gaps = 57/473 (12%)

Query: 1   MENIITQVPQN-GAVPNGFINQSGLEQEDLSNYDNGNSLVHLNIQENHYFLTRDQLMTLP 59
           M+++ITQV  + G +P        + QE    + + +SL+HLNIQENHY++TRDQLM+LP
Sbjct: 1   MQSVITQVSADQGPIP--------VMQEQNQEFLDDDSLIHLNIQENHYYITRDQLMSLP 52

Query: 60  ESLLLCLFPSGVFLDRADQVITNLTAEDEVFITNFPATCFEYIMEFYMKANDDLLNFPVL 119
           ESLLLCLFPSGVF++R  QVITNLT++DEV+I NFP  CFEYIME Y++A +DLLNFPV 
Sbjct: 53  ESLLLCLFPSGVFMNRTGQVITNLTSQDEVYIGNFPPACFEYIMENYVRAQEDLLNFPVD 112

Query: 120 EQFP-SIRNANNHTRY------QHPQTQQQFEQDAILHENPSIIVLREDLDYYCVPQXXX 172
           E F   + +    +R+                +  ILHE PSIIVLREDLDYYCVPQ   
Sbjct: 113 EIFDRGLSSPKEQSRFFGFPSSHSSMQNSSGGEAEILHEKPSIIVLREDLDYYCVPQMKL 172

Query: 173 XXXXXXXGRPPLDQYMKDDLLQHCMSQLKVAAGSYLLNQTSIFQGLYLSNKIHQHEVSQV 232
                    P   Q ++++LL + M+++K+AAGSYL  QTS+FQGL  SN++ + + +  
Sbjct: 173 AYP------PDTPQELRNELLDNFMAEVKLAAGSYLSQQTSVFQGLCSSNRLKRPQKNS- 225

Query: 233 PLHGSGKSSTLGPAEQHLMDMLCSSGFLPESQWGNRTQEFGKTIISSLSLCRLYNESTED 292
             +G  K   LGPAEQHLMDMLCSSGF   S WGNR QE GKT+ISSLSLCRL NE+T+D
Sbjct: 226 --NGENKQK-LGPAEQHLMDMLCSSGFHDSSTWGNRAQEPGKTVISSLSLCRLANETTQD 282

Query: 293 FRNAVTREMKNWKKNKDSNDGTKRFSMPIMEDG--NSGRNIDDNVRNSVM--IADDI--- 345
           FR+ V    +  +    S  G +  +  +   G  +S     D  R S +  +AD++   
Sbjct: 283 FRDKVDAAKRKHEDELKSLRGAQDSTYSLTPKGSRSSPSAQPDPKRKSRLSSLADNVRSR 342

Query: 346 -----------NINSMPDDVYKLVPKPTINNKLLLFWRKPARKSWWSAENVELEVEIYGS 394
                       ++  P  +Y+LVP+P IN+KLLLFW+KPARK WW  E+  LE+++YG 
Sbjct: 343 SASRNRSSSRQRVDQAP-TLYELVPRPDINSKLLLFWKKPARKCWWGEEDTSLELKLYGE 401

Query: 395 IVNVNGVNKVVLRVPQENANANDNEFVTNTVKIPIKLHIRRVWTLELSVVGIQ 447
           + +  G  ++VLR                ++ +P+KLHIRRVWTLELS+VG++
Sbjct: 402 LDSSTG--ELVLR----------QSGPVVSLSVPVKLHIRRVWTLELSIVGVE 442

>Scas_699.46
          Length = 512

 Score =  378 bits (971), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 238/535 (44%), Positives = 311/535 (58%), Gaps = 111/535 (20%)

Query: 1   MENIITQVPQNGAV-----PNGFINQ-SGLEQEDLSNYDNGNSLVHLNIQENHYFLTRDQ 54
           M+NIITQVP+N +      P    +Q +     D ++ +NG+SL+HLNIQENHYF+TRDQ
Sbjct: 1   MQNIITQVPENNSTTTTGNPLTSSDQNTSFYDNDSNDKENGDSLIHLNIQENHYFITRDQ 60

Query: 55  LMTLPESLLLCLFPSGVFLDRADQVITNLTAEDEVFITNFPATCFEYIMEFYMKANDDLL 114
           LM+LPESLLLCLFPSGVFLDR+ QVI+NL+ +DEV+I NFP  CFEYIME Y KA DDLL
Sbjct: 61  LMSLPESLLLCLFPSGVFLDRSGQVISNLSPDDEVYIVNFPPDCFEYIMEVYTKAQDDLL 120

Query: 115 NFPVLEQFPSIRNANNHTRYQHPQTQQQF-------------------------EQDAIL 149
           N+PV + F     A+NH      +    F                         E D +L
Sbjct: 121 NYPVEKYFDK---ASNHKLINSAKGFFGFGSSNSLSNVNSNTSSGTAASTTTTSEHD-LL 176

Query: 150 HENPSIIVLREDLDYYCVPQXXXXXXXXXXGRPPLDQYMK-------DDLLQHCMSQLKV 202
           H+ P+IIVLREDLDYYCVPQ                Q+ K       DDLL + M+Q+K+
Sbjct: 177 HQKPAIIVLREDLDYYCVPQETF-------------QFAKNESFENNDDLLHYFMAQVKI 223

Query: 203 AAGSYLLNQTSIFQGLYLSNKIHQHEVSQVPLHGSGKSS------TLGPAEQHLMDMLCS 256
           AAGSYL  +TSIF+GL+ SN++      +     +GK+S       LGPAEQHLMDMLCS
Sbjct: 224 AAGSYLTKKTSIFEGLFSSNRLKDSH-RKTSQRNNGKNSHKSRRQKLGPAEQHLMDMLCS 282

Query: 257 SGFLPESQWGNRTQEFGKTIISSLSLCRLYNESTEDFRNAVTREMKNWKKNKDSN-DGTK 315
           SGF   S WGNRTQE GKT+ISSL+LCRL NEST++FR+   R    W+   + N D   
Sbjct: 283 SGFGDRSIWGNRTQESGKTVISSLALCRLANESTQEFRDMYHRAKTKWELEHNVNQDQID 342

Query: 316 RFSMPIMEDGNSGRNI-------------------------DDNVRNSV-MIADDININS 349
             S   +++ N+  +I                         +   +N +  +AD++  +S
Sbjct: 343 DVSSVSLQNNNTTNSIVPSRSSTSVNIASNSNSSSKQSGPRESRKKNRLATLADNVRSHS 402

Query: 350 MPDD----------------VYKLVPKPTINNKLLLFWRKPARKSWWSAENVELEVEIYG 393
              +                +Y LVPKP IN KLLLFWRKPARK WW  E++E+E+EIYG
Sbjct: 403 TSRNSSLTRLRSSKSLELPKLYDLVPKPDINAKLLLFWRKPARKCWWGEEDIEVEIEIYG 462

Query: 394 SIVNVNGVNKVV-LRVPQENANANDNEFVTNTVKIPIKLHIRRVWTLELSVVGIQ 447
             V+     K++ L++P E+    D E   N ++IP++LHIRRVWTLELSVVG+Q
Sbjct: 463 HWVDQE--KKIIKLQLPHEDK---DIEQQLNKIRIPVRLHIRRVWTLELSVVGVQ 512

>ACR082C [1129] [Homologous to ScYOR043W (WHI2) - SH]
           (503954..505222) [1269 bp, 422 aa]
          Length = 422

 Score =  350 bits (897), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/452 (44%), Positives = 263/452 (58%), Gaps = 40/452 (8%)

Query: 2   ENIITQVPQNGAVPNGFINQSGLEQEDLS-NYDNGNSLVHLNIQENHYFLTRDQLMTLPE 60
           ++IITQV      P   +  S L  E +  +Y + N+L+HLNIQ  HY++TR+QLM+LPE
Sbjct: 5   QSIITQV-----SPEQQLGGSQLMTEQIEPDYYDENTLIHLNIQGRHYYITREQLMSLPE 59

Query: 61  SLLLCLFPSGVFLDRADQVITNLTAEDEVFITNFPATCFEYIMEFYMKANDDLLNFPVLE 120
           SLLLC FPSGVF++R  QVITNLT EDEV+I NFP  CFE IME Y  A  DL NFPV E
Sbjct: 60  SLLLCFFPSGVFMNREGQVITNLTPEDEVYIANFPPKCFESIMETYTTAQRDLENFPVGE 119

Query: 121 QFPSIRNANNHTRYQ-HPQTQQQFEQDAILHENPSIIVLREDLDYYCVPQXXXXXXXXXX 179
                 +A         P   Q   +  ILHE P+IIVLREDLDYYCVP           
Sbjct: 120 FGRRAPHAGPKGFLGLTPSQSQPMSESQILHEKPAIIVLREDLDYYCVPSVSLALEDG-- 177

Query: 180 GRPPLDQYMKDDLLQHCMSQLKVAAGSYLLNQTSIFQGLYLSNKIHQHEVSQVPLHGSGK 239
                 +  +D LL+  M+Q+K AAGS+L  Q S+F+GLY SN++ + +    P      
Sbjct: 178 -----SREGQDILLEQLMAQVKNAAGSHLCQQRSVFKGLYSSNRVRRPDAQHQP------ 226

Query: 240 SSTLGPAEQHLMDMLCSSGFLPESQWGNRTQEFGKTIISSLSLCRLYNESTEDFRNAVTR 299
              LGPAEQHLMDMLC+SGF   S WGNR+QE GKT+ISSLSLCRL NE+ ++FR+ V  
Sbjct: 227 -DQLGPAEQHLMDMLCASGFREHSDWGNRSQEPGKTVISSLSLCRLMNETVQEFRDQVAA 285

Query: 300 EMKNWKKNKDSNDGTKRFSMPIMEDGNSGRNID---DNVRNSVMIADDININSMPD-DVY 355
             + + ++  + D     S P   D      +    DNVR+        +  +  +  +Y
Sbjct: 286 ARRRYDEDHVTPDAA---SAPPSRDQKRKSRLSTFTDNVRSRSSSRTRSSSRAPREPSLY 342

Query: 356 KLVPKPTINNKLLLFWRKPARKSWWSAENVELEVEIYGSIVNVNGVNKVVLRVPQENANA 415
            LVP+P IN KLLLFW+KPARK WW  E + ++V++ G   + +G   +    P      
Sbjct: 343 DLVPRPEINTKLLLFWKKPARKCWWGLETITVDVQLNGHYDSESGTLVLSRNSP------ 396

Query: 416 NDNEFVTNTVKIPIKLHIRRVWTLELSVVGIQ 447
                    + IP+ LHIRRVWTLELSVVG+Q
Sbjct: 397 ------LCVLTIPVNLHIRRVWTLELSVVGMQ 422

>KLLA0F15972g complement(1481761..1483137) similar to sp|P12611
           Saccharomyces cerevisiae YOR043w WHI2 growth regulation
           protein singleton, start by similarity
          Length = 458

 Score =  349 bits (896), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 221/474 (46%), Positives = 279/474 (58%), Gaps = 52/474 (10%)

Query: 2   ENIITQV-PQNGAVPNGFINQSGLEQEDLSNYDNGNSLVHLNIQENHYFLTRDQLMTLPE 60
           ++IITQV P  G      + Q G    D   Y+  ++L+HLNIQE HY++TR QLM+LPE
Sbjct: 9   QSIITQVTPDGGGASGALLGQDG-SYIDYEQYNEEDTLIHLNIQEKHYYITRTQLMSLPE 67

Query: 61  SLLLCLFPSGVFLDRADQVITNLTAEDEVFITNFPATCFEYIMEFYMKANDDLLNFPVLE 120
           SLLLCLFPSGVF+DR  Q+ITNLT +DEV+I NF   CFEYIM+ Y +A+ D LNFPV E
Sbjct: 68  SLLLCLFPSGVFMDRDGQIITNLTPDDEVYIPNFSTECFEYIMDVYNQAHTDYLNFPVNE 127

Query: 121 QF------PSIRNANNHTRYQHPQTQQQFEQDAILHENPSIIVLREDLDYYCVPQXXXXX 174
            F       S    NN   +         ++  ILHE P IIVLREDLDYYCVPQ     
Sbjct: 128 IFNRKGTNGSSSGGNNFFNFGSSNNSSSSQESEILHEKPGIIVLREDLDYYCVPQ---VS 184

Query: 175 XXXXXGRPPLDQYMKDDLLQHCMSQLKVAAGSYLLNQTSIFQGLYLSNKIHQHEVS-QVP 233
                G   ++   K++LL + M Q+K+AAGS+LL QTS+F GL  SN+  +   S QV 
Sbjct: 185 VEYPEGSSDME---KEELLHNLMVQIKLAAGSHLLKQTSVFLGLKSSNRAKKPTKSNQV- 240

Query: 234 LHGSGKSST----LGPAEQHLMDMLCSSGFLPESQWGNRTQEFGKTIISSLSLCRLYNES 289
                KSST    LG AEQHLMDMLCSSGF  ES WGNR+QE  KT+ISSLSLCRL NE+
Sbjct: 241 --DGTKSSTGTVKLGSAEQHLMDMLCSSGFKTESVWGNRSQEMDKTVISSLSLCRLANET 298

Query: 290 TEDFRNAVTREMKNWKKNK---------DSNDGTKRFSMPIMEDGNS-------GRNIDD 333
           T++FR+AV      +  ++         D++   K    P   D            N+  
Sbjct: 299 TQEFRDAVAVAKAKYDDDQKSIASTMTNDTSSNMKLTPTPSRTDVKRKSRLSVFSENVRS 358

Query: 334 NVRNSVMIADDININSMPDDVYKLVPKPTINNKLLLFWRKPARKSWWSAENVELEVEIYG 393
             R+    A     N  P  +Y+LVPKP IN KLLLFW+KPARK WW  E V+LEV+ + 
Sbjct: 359 RSRSRNRSASRQRANESP-TLYELVPKPDINTKLLLFWKKPARKCWWGQELVDLEVD-FP 416

Query: 394 SIVNVNGVNKVVLRVPQENANANDNEFVTNTVKIPIKLHIRRVWTLELSVVGIQ 447
           +I      N  +   P       DN  +   +K+P+K+HIRRVWTLELSV+GIQ
Sbjct: 417 AIFE----NDTLTIFP-------DNSKI-QKLKVPVKIHIRRVWTLELSVIGIQ 458

>Sklu_1533.1 YOR043W, Contig c1533 830-1408 reverse complement
          Length = 192

 Score =  194 bits (493), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 102/187 (54%), Positives = 121/187 (64%), Gaps = 12/187 (6%)

Query: 32  YDNGNSLVHLNIQENHYFLTRDQLMTLPESLLLCLFPSGVFLDRADQVITNLTAEDEVFI 91
           Y + +SL+HLNIQENHY++TRD LM+LPESLLLCLFPSGVF+DR  QVITNLT++DEV+I
Sbjct: 8   YSDDDSLIHLNIQENHYYITRDHLMSLPESLLLCLFPSGVFMDRMGQVITNLTSDDEVYI 67

Query: 92  TNFPATCFEYIMEFYMKANDDLLNFPVLEQFPSIRNANNHTR---YQHPQTQQQFEQDAI 148
            NFP  CFEYIME Y  A +DL+ +   E F    N   H R   +          +  I
Sbjct: 68  GNFPPDCFEYIMETYSAAQEDLVKYTFDETFNKNPNDKEHGRFFGFSCSSAPSSSNEADI 127

Query: 149 LHENPSIIVLREDLDYYCVPQXXXXXXXXXXGRPPLDQYMKDDLLQHCMSQLKVAAGSYL 208
           LHE PSIIVLREDLDYYCV Q                   KD LL H M+++K+AAGSYL
Sbjct: 128 LHEKPSIIVLREDLDYYCVRQPEVTFASEEE---------KDTLLTHLMAEVKIAAGSYL 178

Query: 209 LNQTSIF 215
            NQ SIF
Sbjct: 179 SNQCSIF 185

>Scas_693.3
          Length = 279

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 298 TREMKNWKKNKDSNDGTKRFSMPIMEDGNSGRNIDDNVRNSVMIADDININSMPDDVYKL 357
           T   K W  ++ S++ +        EDG     I D++   ++ AD+ +INS+  +V ++
Sbjct: 139 TSRAKKWLLSRGSSEAS--------EDGLHSIFISDDMEVPIVDADEKSINSLIKEVLRI 190

Query: 358 VPKPT 362
           VP  T
Sbjct: 191 VPIDT 195

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,901,215
Number of extensions: 738748
Number of successful extensions: 2216
Number of sequences better than 10.0: 21
Number of HSP's gapped: 2224
Number of HSP's successfully gapped: 23
Length of query: 447
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 342
Effective length of database: 12,961,219
Effective search space: 4432736898
Effective search space used: 4432736898
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)