Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_615.1333033015670.0
YDR265W (PEX10)3373417444e-97
CAGL0M08690g3283207103e-92
AER390W3163206938e-90
KLLA0E16720g3053196267e-80
Kwal_55.199991521583867e-46
Sklu_1676.31011073085e-35
CAGL0B05049g1470671262e-07
CAGL0J03586g411461181e-06
YLR247C1556471154e-06
Kwal_14.12871518511154e-06
Scas_573.91502481137e-06
Sklu_2432.91475511102e-05
Scas_713.45570341092e-05
YDR143C (SAN1)610361064e-05
Scas_720.89469421064e-05
YCR066W (RAD18)487391055e-05
AFR499C2501311011e-04
KLLA0E03960g704251012e-04
KLLA0F12166g1528511022e-04
CAGL0E01441g717351002e-04
AAL030C1539511003e-04
Kwal_23.628545842974e-04
Scas_665.139262940.001
KLLA0C08756g42739940.001
YOL054W40645940.001
Scas_477.724470920.001
Sklu_2317.249335940.001
AAR049C44342930.001
KLLA0B08679g36399900.003
AGL217W41443890.004
KLLA0C18260g22942870.005
Sklu_2423.864743880.006
Scas_551.371243870.009
Kwal_56.2390058935870.009
Kwal_47.1777197262870.009
Sklu_2102.175127870.010
Scas_672.226354850.011
Kwal_23.413966843860.012
YLR323C (CWC24)25955840.014
AER074W64343850.014
YOL013C (HRD1)55156840.018
KLLA0F25674g75726840.021
CAGL0I09988g38748830.024
Scas_644.651064830.024
AER113W66568830.025
CAGL0G03553g21054800.032
CAGL0E02299g54557820.033
CAGL0D00638g69345820.034
CAGL0A00935g22651800.036
Scas_625.476127820.038
Kwal_26.809975030820.038
KLLA0C05874g553107810.043
Kwal_56.2252251353810.046
YKL034W (TUL1)75827810.053
YDL074C (BRE1)70043810.053
Sklu_1785.333144790.067
Scas_625.1127457780.074
KLLA0B02981g66343790.089
YLR427W (MAG2)67080780.11
ACL019C57525770.14
Kwal_27.1072322954760.14
CAGL0M08668g65781770.14
YER116C (SLX8)274144760.15
CAGL0H10274g11434720.16
AGL191W58232770.16
Kwal_27.1054610452710.16
AGL289C24154750.16
AFR275W75334760.17
Kwal_47.1763824844740.21
Scas_585.5*10964710.22
CAGL0L01947g75726750.23
Scas_719.5164775740.30
Sklu_2411.239361730.37
KLLA0D02552g61977730.39
Scas_705.4142857720.45
Kwal_47.1709960571720.51
YHL010C58544720.57
CAGL0J04796g59970710.65
KLLA0E07007g279107700.68
Kwal_55.2000061746710.75
Kwal_26.824738660700.80
CAGL0K02563g58643710.81
Sklu_2412.7112762701.1
Kwal_27.1041930033691.1
AGR034W15931671.2
CAGL0A03432g115158701.2
Scas_674.12d132346681.9
KLLA0D00979g56156672.2
KLLA0E16698g65645672.5
YML076C (WAR1)94478672.6
Scas_615.1267443672.6
CAGL0K08052g30548662.6
KLLA0F18458g14032642.7
ABR067C35343653.2
Sklu_2204.2237653663.8
Scas_591.1077245654.0
Scas_721.100113769654.3
Kwal_23.366076844645.2
AFR220W108561645.3
CAGL0K10384g210441646.7
Scas_697.3252157637.2
Kwal_33.15326104450637.9
Kwal_55.2120627534628.3
YBR114W (RAD16)790103629.0
YBR062C11533599.3
YLR032W (RAD5)116943629.8
KLLA0F25740g51743629.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_615.13
         (330 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_615.13                                                           608   0.0  
YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogene...   291   4e-97
CAGL0M08690g complement(865182..866168) similar to sp|Q05568 Sac...   278   3e-92
AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH] complement...   271   8e-90
KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568 S...   245   7e-80
Kwal_55.19999                                                         153   7e-46
Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement        123   5e-35
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    53   2e-07
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    50   1e-06
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    49   4e-06
Kwal_14.1287                                                           49   4e-06
Scas_573.9                                                             48   7e-06
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              47   2e-05
Scas_713.45                                                            47   2e-05
YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein tha...    45   4e-05
Scas_720.89                                                            45   4e-05
YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA ...    45   5e-05
AFR499C [3691] [Homologous to ScYLR323C (CWC24) - SH] (1339549.....    44   1e-04
KLLA0E03960g 369201..371315 some similarities with sp|P22470 Sac...    44   2e-04
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    44   2e-04
CAGL0E01441g 135075..137228 weakly similar to sp|P22470 Saccharo...    43   2e-04
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    43   3e-04
Kwal_23.6285                                                           42   4e-04
Scas_665.1                                                             41   0.001
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    41   0.001
YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required...    41   0.001
Scas_477.7                                                             40   0.001
Sklu_2317.2 YDR143C, Contig c2317 4002-5483                            41   0.001
AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH] (428904..43...    40   0.001
KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415 Sacch...    39   0.003
AGL217W [4095] [Homologous to ScYOL054W - SH] complement(290043....    39   0.004
KLLA0C18260g 1613311..1614000 similar to sp|P53769 Saccharomyces...    38   0.005
Sklu_2423.8 YDL074C, Contig c2423 13513-15456 reverse complement       39   0.006
Scas_551.3                                                             38   0.009
Kwal_56.23900                                                          38   0.009
Kwal_47.17771                                                          38   0.009
Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement          38   0.010
Scas_672.2                                                             37   0.011
Kwal_23.4139                                                           38   0.012
YLR323C (CWC24) [3710] chr12 complement(778173..778952) Protein ...    37   0.014
AER074W [2579] [Homologous to ScYDL074C (BRE1) - SH] complement(...    37   0.014
YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiqui...    37   0.018
KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces...    37   0.021
CAGL0I09988g complement(951368..952531) similar to tr|Q12161 Sac...    37   0.024
Scas_644.6                                                             37   0.024
AER113W [2618] [Homologous to ScYLR427W - SH] complement(848584....    37   0.025
CAGL0G03553g complement(345057..345689) weakly similar to sp|P40...    35   0.032
CAGL0E02299g complement(219009..220646) similar to tr|Q08109 Sac...    36   0.033
CAGL0D00638g complement(80947..83028) similar to tr|Q07457 Sacch...    36   0.034
CAGL0A00935g complement(97372..98052) some similarities with sp|...    35   0.036
Scas_625.4                                                             36   0.038
Kwal_26.8099                                                           36   0.038
KLLA0C05874g complement(520079..521740) weakly similar to sgd|S0...    36   0.043
Kwal_56.22522                                                          36   0.046
YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing ...    36   0.053
YDL074C (BRE1) [794] chr4 complement(324047..326149) Ubiquitin l...    36   0.053
Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement         35   0.067
Scas_625.11                                                            35   0.074
KLLA0B02981g complement(267798..269789) similar to sgd|S0002232 ...    35   0.089
YLR427W (MAG2) [3803] chr12 (988424..990436) Protein containing ...    35   0.11 
ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH] (328044..32...    34   0.14 
Kwal_27.10723                                                          34   0.14 
CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces c...    34   0.14 
YER116C (SLX8) [1547] chr5 complement(395344..396168) Subunit of...    34   0.15 
CAGL0H10274g complement(1003801..1004145) similar to sp|P38239 S...    32   0.16 
AGL191W [4121] [Homologous to ScYDR143C (SAN1) - SH] complement(...    34   0.16 
Kwal_27.10546                                                          32   0.16 
AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH] (164204..16...    33   0.16 
AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH] complement...    34   0.17 
Kwal_47.17638                                                          33   0.21 
Scas_585.5*                                                            32   0.22 
CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces c...    33   0.23 
Scas_719.51                                                            33   0.30 
Sklu_2411.2 YMR026C, Contig c2411 3617-4798                            33   0.37 
KLLA0D02552g complement(215290..217149) similar to sgd|S0004419 ...    33   0.39 
Scas_705.41                                                            32   0.45 
Kwal_47.17099                                                          32   0.51 
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    32   0.57 
CAGL0J04796g 453697..455496 similar to tr|Q06436 Saccharomyces c...    32   0.65 
KLLA0E07007g 641391..642230 some similarities with sp|P40072 Sac...    32   0.68 
Kwal_55.20000                                                          32   0.75 
Kwal_26.8247                                                           32   0.80 
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    32   0.81 
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          32   1.1  
Kwal_27.10419                                                          31   1.1  
AGR034W [4344] [Homologous to ScYBR062C - SH] complement(772772....    30   1.2  
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    32   1.2  
Scas_674.12d                                                           31   1.9  
KLLA0D00979g 86703..88388 similar to sp|P09232 Saccharomyces cer...    30   2.2  
KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674 Sac...    30   2.5  
YML076C (WAR1) [3893] chr13 complement(112513..115347) Transcrip...    30   2.6  
Scas_615.12                                                            30   2.6  
CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06...    30   2.6  
KLLA0F18458g complement(1697871..1698293) some similarities with...    29   2.7  
ABR067C [658] [Homologous to ScYMR026C (PEX12) - SH] (514945..51...    30   3.2  
Sklu_2204.2 YBR136W, Contig c2204 3175-10305 reverse complement        30   3.8  
Scas_591.10                                                            30   4.0  
Scas_721.100                                                           30   4.3  
Kwal_23.3660                                                           29   5.2  
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    29   5.3  
CAGL0K10384g complement(1010551..1016865) similar to sp|P34756 S...    29   6.7  
Scas_697.32                                                            29   7.2  
Kwal_33.15326                                                          29   7.9  
Kwal_55.21206                                                          28   8.3  
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    28   9.0  
YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein ...    27   9.3  
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    28   9.8  
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    28   9.9  

>Scas_615.13
          Length = 330

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/330 (90%), Positives = 298/330 (90%)

Query: 1   MTDNNDEGKDAGSSSLALPFADAPTIVQAHQKDLQXXXXXXXXXXXXXXXXXGQLFTNTY 60
           MTDNNDEGKDAGSSSLALPFADAPTIVQAHQKDLQ                 GQLFTNTY
Sbjct: 1   MTDNNDEGKDAGSSSLALPFADAPTIVQAHQKDLQIESILTEKLTTLLTSLKGQLFTNTY 60

Query: 61  PKEISIAVKXXXXXXXXXXXXXXXGEEYVDLIYVDRKGTGLVKRYRKLLFILSYTLGPYL 120
           PKEISIAVK               GEEYVDLIYVDRKGTGLVKRYRKLLFILSYTLGPYL
Sbjct: 61  PKEISIAVKLLYLTLTTFRGRRTLGEEYVDLIYVDRKGTGLVKRYRKLLFILSYTLGPYL 120

Query: 121 ITKVYNKLCAKIYANEEDENRKKISLKQVLSAIVETHLVLFYFKGAYYEISKRLFGLRYS 180
           ITKVYNKLCAKIYANEEDENRKKISLKQVLSAIVETHLVLFYFKGAYYEISKRLFGLRYS
Sbjct: 121 ITKVYNKLCAKIYANEEDENRKKISLKQVLSAIVETHLVLFYFKGAYYEISKRLFGLRYS 180

Query: 181 IGHEPSANEAQTREQSTNTYKLLGNIMLLQQTAEVLPICKGWFKSYYSKDEKGTLTNEKQ 240
           IGHEPSANEAQTREQSTNTYKLLGNIMLLQQTAEVLPICKGWFKSYYSKDEKGTLTNEKQ
Sbjct: 181 IGHEPSANEAQTREQSTNTYKLLGNIMLLQQTAEVLPICKGWFKSYYSKDEKGTLTNEKQ 240

Query: 241 SQGDIQAGILTRIPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFC 300
           SQGDIQAGILTRIPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFC
Sbjct: 241 SQGDIQAGILTRIPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFC 300

Query: 301 WECILDWCKERPECPLCRQECQIQQILPLR 330
           WECILDWCKERPECPLCRQECQIQQILPLR
Sbjct: 301 WECILDWCKERPECPLCRQECQIQQILPLR 330

>YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogenesis
           protein (peroxin) [1014 bp, 337 aa]
          Length = 337

 Score =  291 bits (744), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 153/341 (44%), Positives = 199/341 (58%), Gaps = 16/341 (4%)

Query: 1   MTDNNDEGKDA--GSSSLALPFADAPTIVQAHQKDLQXXXXXXXXXXXXXXXXXGQLFTN 58
           M ++N   K+A    S L  PFADAP+IVQAHQKD Q                  QLF N
Sbjct: 1   MKNDNKLQKEALMRLSQLRFPFADAPSIVQAHQKDEQIQGLLIMKVTELCKLIKSQLFVN 60

Query: 59  TYPKEISIAVKXXXXXXXXXXXXXXXGEEYVDLIYVDRKGTGLVKRYRKLLFILSYTLGP 118
           +YPKE+SI  K               GEEYVDL Y +RKGT L  R + ++F  +Y L P
Sbjct: 61  SYPKELSIFAKLLYLLFTTGRRGRTLGEEYVDLTYTNRKGTRLAGRLKMIVFAFAYPLCP 120

Query: 119 YLITKVYNKLCAKIYANE-EDENRKKISLKQVLSAIVETHLVLFYFKGAYYEISKRLFGL 177
           Y ITK+Y K+      ++ ED        K +L  I++ H+ LFYFKGA+Y ISKR+FG+
Sbjct: 121 YFITKLYKKIMKNNKESKIEDTESVAAFCKGLLDFILDVHMTLFYFKGAFYSISKRIFGM 180

Query: 178 RYSIGHEPSANEAQTREQSTNTYKLLGNIMLLQQTAEVLPICKGWFKSYYSKDEKGTLTN 237
           RY   H  S NEA  RE+ +  YK+LG I+L Q   +  P+      S+    ++   TN
Sbjct: 181 RYVFKHILSKNEANFREEGSQKYKVLGYILLAQNVMKWYPVLTSTLGSWIYGRKR---TN 237

Query: 238 EKQSQGDIQAGILTR--------IPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTD 289
           +  ++  +  G+  R        IP ES++ H+NLSDK   PFIPE +RKCILCL  M+D
Sbjct: 238 DSITRSSV--GLQERSEHESIEGIPKESQLTHINLSDKNQLPFIPEASRKCILCLMNMSD 295

Query: 290 PSCSPCGHIFCWECILDWCKERPECPLCRQECQIQQILPLR 330
           PSC+PCGH+FCW C++ WCKERPECPLCRQ CQ Q+IL LR
Sbjct: 296 PSCAPCGHLFCWSCLMSWCKERPECPLCRQHCQPQEILVLR 336

>CAGL0M08690g complement(865182..866168) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w peroxisomal assembly
           protein - peroxin, hypothetical start
          Length = 328

 Score =  278 bits (710), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 138/320 (43%), Positives = 190/320 (59%), Gaps = 9/320 (2%)

Query: 18  LPFADAPTIVQAHQKDLQXXXXXXXXXXXXXXXXXGQLFTNTYPKEISIAVKXXXXXXXX 77
           LPFA AP+IVQAHQKD Q                 GQLF N Y KEIS+ VK        
Sbjct: 10  LPFAGAPSIVQAHQKDEQIETMLSVKVSELLRGVRGQLFINNYQKEISVVVKLIYLGLTT 69

Query: 78  XXXXXXXGEEYVDLIYVDRKGTGLVKRYRKLLFILSYTLGPYLITKVYNKLCAKIYANEE 137
                  GEEYVDLIYV+++G+ LV+  +++LF+LSYT  PYL+TK+  K+  +   NEE
Sbjct: 70  ALSRRTLGEEYVDLIYVNKRGSQLVRGIKRVLFVLSYTSIPYLVTKLSKKVNNRSTNNEE 129

Query: 138 DENRKKISLKQVLSAIVETHLVLFYFKGAYYEISKRLFGLRYSIGHEPSANEAQTREQST 197
            ++  + +   +LS +++ HL++FY  G YY++ KR +G+RY++GH  S  E   R++S+
Sbjct: 130 SDDGNESTYTDILSTMIDLHLMVFYITGTYYDVFKRFWGMRYALGHTLSQEEENYRDKSS 189

Query: 198 NTYKLLGNIMLLQQTAEVLPICKGWFKSYYSKDEKGTLTNEKQSQGDIQA-------GIL 250
            +YK+LG I+LLQ  ++V PI             K TL       G  +        G+L
Sbjct: 190 KSYKILGYIILLQHISKVKPIINKVLSIL--PQTKETLNAGSNGVGLKEGFAPAATPGLL 247

Query: 251 TRIPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFCWECILDWCKE 310
           T +P    ++H+ LS+ +   FIP ++R CILCL  MTDPSC PCGH+FCW+CI DW KE
Sbjct: 248 TDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTKE 307

Query: 311 RPECPLCRQECQIQQILPLR 330
            PECPLCRQ    QQ+L LR
Sbjct: 308 NPECPLCRQRSYPQQVLALR 327

>AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH]
           complement(1370316..1370364,1370423..1371324) [951 bp,
           316 aa]
          Length = 316

 Score =  271 bits (693), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 145/320 (45%), Positives = 189/320 (59%), Gaps = 16/320 (5%)

Query: 17  ALPFADAPTIVQAHQKDLQXXXXXXXXXXXXXXXXXGQLFTNTYPKEISIAVKXXXXXXX 76
             PFADAP+IVQAHQKD+                  GQLF N Y +EISIA K       
Sbjct: 7   VFPFADAPSIVQAHQKDVYIESILGTKLEDALKALKGQLFANRYYQEISIASKILYLGLT 66

Query: 77  XXXXXXXXGEEYVDLIYVDRKGTGLVKRYRKLLFILSYTLGPYLITKVYNKLCAKIYANE 136
                   GEEYVDLIYV R G GLVK +R+LLF+LSY   PY ++K++ +L  +   + 
Sbjct: 67  TLRERRTLGEEYVDLIYVSRNGMGLVKAWRRLLFVLSYAALPYGLSKLFKRLKRRYEDDT 126

Query: 137 EDENR-----KKISLKQVLSAIVETHLVLFYFKGAYYEISKRLFGLRYSIGHEPSANEAQ 191
            ++N        ++ K ++   +  HL++FY  G +Y+ISKR+FGLRY+IGH+ +  E +
Sbjct: 127 PNKNGILHYLAGLTFKDIMDNALSVHLLVFYLTGGFYQISKRIFGLRYAIGHDVTKEEKE 186

Query: 192 TREQSTNTYKLLGNIMLLQQTAEVLPICKGWFKSYY-SKDEKGTLTNEKQSQGDIQAGIL 250
            R+ S+ +Y++LG ++LLQ  A+V P      K Y  S  E  T  N          GIL
Sbjct: 187 FRKSSSRSYRILGGLVLLQLLAKVQPHVNTMLKMYLKSPTENATNKN----------GIL 236

Query: 251 TRIPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFCWECILDWCKE 310
           T    E+   H+ LS+ EIFPFI E +RKCILCLA MTDPSC PCGH+FCW C++ WC E
Sbjct: 237 TNGSPEATARHIELSNPEIFPFISEQSRKCILCLADMTDPSCLPCGHMFCWACVMQWCNE 296

Query: 311 RPECPLCRQECQIQQILPLR 330
           R ECPLCRQ C  Q IL LR
Sbjct: 297 RNECPLCRQHCTKQSILQLR 316

>KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w PAS4 peroxisomal
           assembly protein - peroxin singleton, start by
           similarity
          Length = 305

 Score =  245 bits (626), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 128/319 (40%), Positives = 181/319 (56%), Gaps = 22/319 (6%)

Query: 16  LALPFADAPTIVQAHQKDLQXXXXXXXXXXXXXXXXXGQLFTNTYPKEISIAVKXXXXXX 75
           +  PFADAP+IVQAHQKD                   GQ FTN Y  EI I  K      
Sbjct: 5   MKFPFADAPSIVQAHQKDDTVENLLLQKIQDVLRKVKGQQFTNRYVSEIMILSKLIYLSI 64

Query: 76  XXXXXXXXXGEEYVDLIYVDRKGTGLVKRYRKLLFILSYTLGPYLITKVYNKLCAKIYAN 135
                    GEEYVDL YVDR+G G+ +  R++ F +SY   P++++KV+     K   N
Sbjct: 65  TTLRYRRTLGEEYVDLAYVDRRGKGVARLLRRIGFAISYCGVPWILSKVF----YKYKLN 120

Query: 136 EEDENRKKI----SLKQVLSAIVETHLVLFYFKGAYYEISKRLFGLRYSIGHEPSANEAQ 191
           E      K+    S + +L + +  HL++FY  G YY+ISKR+FG+RY +GHE + NE +
Sbjct: 121 ERGSGFLKVFNGKSFRDILDSTLNLHLIIFYLSGQYYDISKRIFGMRYVVGHEMNKNEVE 180

Query: 192 TREQSTNTYKLLGNIMLLQQTAEVLPICKGWFKSYYSKDEKGTLTNEKQSQGDIQAGILT 251
            +++S+  YK+LG I+ +Q  +++LP       + Y  D  GT  ++ +S   + A    
Sbjct: 181 FKKKSSQNYKILGFILGMQLASKLLPQI-----AEYIADRIGT--DDGKSHKSLSA---- 229

Query: 252 RIPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFCWECILDWCKER 311
                 +    +LSD E+ PFI ED+RKC+LCL YM DPS +PCGH+FCW+CI++W  ER
Sbjct: 230 ---LAKKHTSKDLSDLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLER 286

Query: 312 PECPLCRQECQIQQILPLR 330
            ECPLCRQ C  Q  +P+R
Sbjct: 287 QECPLCRQRCPRQLTIPVR 305

>Kwal_55.19999
          Length = 152

 Score =  153 bits (386), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 98/158 (62%), Gaps = 10/158 (6%)

Query: 177 LRYSIGHEPSANEAQTREQSTNTYKLLGNIMLLQQTAEVLPICKGWFKSYYSKDEKGTLT 236
           +RY++GH+   +E + RE    TY++LG ++L+Q  ++ L     W K   + D+     
Sbjct: 1   MRYAVGHKLDESEIRFRESGNKTYRILGTLLLVQLFSKRLLPAFRWMKGLIADDQ----- 55

Query: 237 NEKQSQGDIQAGILT----RIPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSC 292
           NEK +   +  G  T     +P +S+V H+ L       FIP D+RKCILCL +M DPSC
Sbjct: 56  NEKATS-SLSVGETTLSTAGLPTDSQVEHIGLEQASEMSFIPSDSRKCILCLGFMLDPSC 114

Query: 293 SPCGHIFCWECILDWCKERPECPLCRQECQIQQILPLR 330
           +PCGH+FCW+C+L WC ERPECPLCRQ C  Q +LPLR
Sbjct: 115 APCGHVFCWKCLLSWCNERPECPLCRQTCHAQNVLPLR 152

>Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement
          Length = 101

 Score =  123 bits (308), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 71/107 (66%), Gaps = 8/107 (7%)

Query: 224 KSYYSKDEKGTLTNEKQSQGDIQAGILTRIPNESEVNHLNLSDKEIFPFIPEDARKCILC 283
           KSY    + GT+T             ++ +P +S + H++LSD    PFI E +RKCILC
Sbjct: 3   KSYTKPLDDGTVTTSNNE--------ISGVPLDSSIRHVDLSDPAQMPFINESSRKCILC 54

Query: 284 LAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQECQIQQILPLR 330
           L  M DPSC+PCGHIFCW CI++WCKER ECPLCRQ+C  Q ILPLR
Sbjct: 55  LTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCRQKCLKQSILPLR 101

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%)

Query: 253  IPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFCWECILDWCKERP 312
            +  ES V +L+      +        +C +CL  +T+ +   CGH+FC  CI  W K R 
Sbjct: 1137 VSTESRVKYLHNLSTLTYEAQKNTTMECSICLQPITNGAMVNCGHLFCTSCIFSWLKNRK 1196

Query: 313  ECPLCRQ 319
             CPLC+ 
Sbjct: 1197 TCPLCKH 1203

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein, hypothetical start
          Length = 411

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%)

Query: 275 EDARKCILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQE 320
           +D  +C +C  ++ +P  +PCGH FC  CI  +    P+CPLC  E
Sbjct: 22  DDLLRCHICKDFLKNPVLTPCGHTFCSLCIRGYLSNEPKCPLCLHE 67

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 280  CILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQECQIQQI 326
            C +CL  +   +   CGH FC  CIL W +   +CP+C+  C I ++
Sbjct: 1239 CSICLGEVEIGAIIKCGHYFCKSCILTWLRAHSKCPICKGFCSISEV 1285

>Kwal_14.1287
          Length = 1518

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 280  CILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQECQIQQILPLR 330
            C +CL  +   S   CGH FC +CI  W K    CPLC+ +  +  +   +
Sbjct: 1189 CTICLGEIYMGSVIKCGHFFCQDCICSWLKNHSSCPLCKMQTTMSGVYSFK 1239

>Scas_573.9
          Length = 1502

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 279  KCILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQECQIQQI 326
            KC +CL  ++  S   CGH FC  CI  W K +  CP+C+      +I
Sbjct: 1190 KCSICLQDISLGSMLKCGHFFCKRCITSWLKNKKNCPMCKMVTTASEI 1237

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%)

Query: 280  CILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQECQIQQILPLR 330
            C +C   +   S   CGH FC+ CI  W KE   CPLC+      ++   R
Sbjct: 1165 CAVCFNEIFVGSVVKCGHFFCYSCIHTWLKEHNTCPLCKTNVTPSEVYNFR 1215

>Scas_713.45
          Length = 570

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 20/34 (58%)

Query: 286 YMTDPSCSPCGHIFCWECILDWCKERPECPLCRQ 319
           Y   P+  PCGHIF  EC+  WCK    CPLCR 
Sbjct: 226 YNHSPTKLPCGHIFGRECLYRWCKLENTCPLCRH 259

>YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein that
           may antagonize the function of Spt16p and Sir4p [1833
           bp, 610 aa]
          Length = 610

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 21/36 (58%)

Query: 285 AYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQE 320
           +Y   P   PCGHIF  ECI  W +    CPLCRQ+
Sbjct: 247 SYKHSPIKLPCGHIFGRECIYKWSRLENSCPLCRQK 282

>Scas_720.89
          Length = 469

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 279 KCILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQE 320
           +C +C  ++  P  +PC H FC  CI ++ K+  +CPLC  E
Sbjct: 27  RCHICKDFLKVPVLTPCSHTFCSLCIREYLKDNSKCPLCLNE 68

>YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA
           repair protein, required for post-replication repair
           [1464 bp, 487 aa]
          Length = 487

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 279 KCILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLC 317
           +C +C  ++  P  +PCGH FC  CI      +P CPLC
Sbjct: 27  RCHICKDFLKVPVLTPCGHTFCSLCIRTHLNNQPNCPLC 65

>AFR499C [3691] [Homologous to ScYLR323C (CWC24) - SH]
           (1339549..1340301) [753 bp, 250 aa]
          Length = 250

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 11/131 (8%)

Query: 193 REQSTNTYKLLGNIMLLQQTAEVLP-ICKGWFKSYYSKDEKGTLTNEKQSQGDIQAGILT 251
           R +S+     +G+ +  +   +  P +CK + ++ +     G       S+ D +AG   
Sbjct: 80  RAESSGARTAVGSNVRTRVVMDYQPDVCKDYRQTGFCG--YGDSCKFLHSRDDFRAGW-- 135

Query: 252 RIPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFCWECILDWCKER 311
           R+  E +V      D +  PF      +C+LC  +   P  + CGH FC  C     +E 
Sbjct: 136 RLNEEWKVGQTEARDLDSIPF------RCVLCRGHYRAPVRTRCGHYFCGGCFARRVRET 189

Query: 312 PECPLCRQECQ 322
            +C +C  + Q
Sbjct: 190 RQCAVCGADTQ 200

>KLLA0E03960g 369201..371315 some similarities with sp|P22470
           Saccharomyces cerevisiae YDR143c SAN1 mating-type
           regulation protein singleton, hypothetical start
          Length = 704

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 294 PCGHIFCWECILDWCKERPECPLCR 318
           PCGH+F  EC+  W  E   CP+CR
Sbjct: 218 PCGHVFGRECLYKWTTEHNSCPICR 242

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 25/51 (49%)

Query: 280  CILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQECQIQQILPLR 330
            C +C + +   S   CGH FC +C+  W K+   CP+C+      ++   +
Sbjct: 1208 CAVCYSDIYTGSILKCGHFFCKDCVTHWFKKNTSCPMCKNRMSSSEVYHFK 1258

>CAGL0E01441g 135075..137228 weakly similar to sp|P22470
           Saccharomyces cerevisiae YDR143c mating-type regulation
           protein, hypothetical start
          Length = 717

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 286 YMTDPSCSPCGHIFCWECILDWCKERPECPLCRQE 320
           Y+  P   PCGHIF   C+ +W +    CPLCR++
Sbjct: 286 YLHSPVKIPCGHIFGRSCLYEWTRLENSCPLCRKK 320

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (52%)

Query: 280  CILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQECQIQQILPLR 330
            C +CL  + D +    GH +C ECI  W + +  CPLC+ + +  ++   +
Sbjct: 1219 CTICLCDICDGAIIGRGHFYCQECISSWLETKQSCPLCKTQTKSSELYSFK 1269

>Kwal_23.6285
          Length = 458

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 279 KCILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQE 320
           +C +C  ++  P  +PC H FC  CI ++      CPLC  E
Sbjct: 36  RCHICKDFIKSPVLTPCAHTFCSLCIREYLNRELRCPLCLAE 77

>Scas_665.1
          Length = 392

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 12/62 (19%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDW----CKERPECPLCRQECQ--------IQQIL 327
           C +C  YM  P  + CGH +C+ C+  W     K+   CP CR +          IQQ L
Sbjct: 30  CTICSEYMFVPMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDITDTPNLNPFIQQTL 89

Query: 328 PL 329
            L
Sbjct: 90  QL 91

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 279 KCILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLC 317
           +C +C  ++     +PCGH FC  CI  + ++  +CPLC
Sbjct: 31  RCHICKDFLKASVLTPCGHSFCSICIRKYLQKESKCPLC 69

>YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required
           for normal resistance to NaCl and for normal mating
           efficiency of MATa cells, contains a C3HC4-type zinc
           finger [1221 bp, 406 aa]
          Length = 406

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCKERPE----CPLCRQE 320
           C +C  YM  P  +PCGH +C+ C+  W     +    CP CR +
Sbjct: 30  CSICHDYMFVPMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSD 74

>Scas_477.7
          Length = 244

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 11/70 (15%)

Query: 253 IPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFCWECILDWCKERP 312
           I N+++V  L     E  PF      KC+LC      P  + CGH FC  C     +E  
Sbjct: 5   INNDTKVKKL-----EEIPF------KCVLCKDDYKSPIVTNCGHYFCSSCFTKRVREDA 53

Query: 313 ECPLCRQECQ 322
            C +C ++ Q
Sbjct: 54  SCFICGEDTQ 63

>Sklu_2317.2 YDR143C, Contig c2317 4002-5483
          Length = 493

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 18/35 (51%)

Query: 286 YMTDPSCSPCGHIFCWECILDWCKERPECPLCRQE 320
           Y   P+   CGH F   CI  W KE   CP+CR E
Sbjct: 132 YKHSPTQLKCGHRFGRMCIYQWTKEHNSCPICRAE 166

>AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH]
           (428904..430235) [1332 bp, 443 aa]
          Length = 443

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 279 KCILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQE 320
           +C +C   +  P  + CGH FC  CI ++  +   CPLC  E
Sbjct: 31  RCHICKDMLQTPVLTQCGHTFCSLCIREYLNKESRCPLCLAE 72

>KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415
           Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 363

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 20/99 (20%)

Query: 245 IQAGILTRIPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFCWECI 304
           +   + T IP +S  +HL +  + +      D+  C +C  YM  P  + CGH +C+EC+
Sbjct: 1   MNGHLHTVIPKKSNADHLRIVGRVL------DSTVCTICHDYMFVPVMTSCGHNYCYECL 54

Query: 305 LDWCKERPE------CPLCRQ--------ECQIQQILPL 329
            +W            CP CR            +QQI+ L
Sbjct: 55  NNWLNNNRSNVSELTCPQCRNVITNEPSLNVALQQIVDL 93

>AGL217W [4095] [Homologous to ScYOL054W - SH]
           complement(290043..291287) [1245 bp, 414 aa]
          Length = 414

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 4/43 (9%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCKERPE----CPLCR 318
           C +C  YM  P  + CGH +C+ CI +W          CP CR
Sbjct: 38  CTICHDYMYVPVMTGCGHNYCYFCISNWLNNTSSTELNCPQCR 80

>KLLA0C18260g 1613311..1614000 similar to sp|P53769 Saccharomyces
           cerevisiae YLR323c singleton, start by similarity
          Length = 229

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 20/42 (47%)

Query: 279 KCILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQE 320
           +C LC    T P  + C H FC  C +   K    CP+C +E
Sbjct: 170 RCFLCKKEYTSPVVTKCNHYFCSSCFMKQMKVSTNCPICGKE 211

>Sklu_2423.8 YDL074C, Contig c2423 13513-15456 reverse complement
          Length = 647

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 9/43 (20%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCKER-----PECPLC 317
           C LC     + +   CGH+FC EC    CKER      +CP C
Sbjct: 595 CSLCSKNWKNTAIKSCGHVFCEEC----CKERLAARMRKCPTC 633

>Scas_551.3
          Length = 712

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 9/43 (20%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCKER-----PECPLC 317
           C LC     + +   CGH+FC EC    CKER      +CP C
Sbjct: 660 CSLCSKNWKNMAIKTCGHVFCEEC----CKERLAARMRKCPTC 698

>Kwal_56.23900
          Length = 589

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 17/35 (48%)

Query: 284 LAYMTDPSCSPCGHIFCWECILDWCKERPECPLCR 318
           + Y   P   PC H+F  ECI  W      CP+CR
Sbjct: 216 VTYKHSPVQLPCSHVFGRECIRQWTNLHNTCPICR 250

>Kwal_47.17771
          Length = 972

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 10/62 (16%)

Query: 279 KCILCLAYMTDPSC----SPCGHIFCWECILDWCKERPE------CPLCRQECQIQQILP 328
           +C +C +   DP      + CGH FC  CIL++ + + E      CP CR E   +++L 
Sbjct: 718 ECSICTSEPIDPVTQVIFTECGHAFCELCILEYIRFQTERQQDIKCPNCRHEINPKRLLT 777

Query: 329 LR 330
           ++
Sbjct: 778 IK 779

>Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement
          Length = 751

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 292 CSPCGHIFCWECILDWCKERPECPLCR 318
            +PCGHIF  +C+  W   + +CP+CR
Sbjct: 719 VTPCGHIFHTQCLESWMSYKLQCPVCR 745

>Scas_672.2
          Length = 263

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 6/54 (11%)

Query: 279 KCILCLAYMTDPSCSPCGHIFCWECILDWC------KERPECPLCRQECQIQQI 326
           +C +C+        +PCGH+FC +C+          ++   C LCR+E +++ +
Sbjct: 196 RCPICMDPPETALIAPCGHVFCCDCLFQMVNSSRTYRKDGHCALCRKEVRLRDV 249

>Kwal_23.4139
          Length = 668

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 9/43 (20%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCKER-----PECPLC 317
           C LC     + +   CGH+FC EC    CKER      +CP C
Sbjct: 616 CSLCSKNWKNTAIKNCGHVFCEEC----CKERLAARMRKCPTC 654

>YLR323C (CWC24) [3710] chr12 complement(778173..778952) Protein
           containing a CCCH-type zinc finger domain, which bind
           DNA or RNA, and a C3HC4 type (RING) zinc finger, which
           may mediate protein-protein interactions, has low
           similarity to uncharacterized zinc finger protein 183
           (human ZNF183) [780 bp, 259 aa]
          Length = 259

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 6/55 (10%)

Query: 266 DKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQE 320
           D E  PF      KC LC      P  + CGH FC  C     K+  +C +C +E
Sbjct: 191 DLEKIPF------KCTLCKEDYKSPVVTNCGHYFCGSCFAKDMKKGTKCFICHKE 239

>AER074W [2579] [Homologous to ScYDL074C (BRE1) - SH]
           complement(775019..776950) [1932 bp, 643 aa]
          Length = 643

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 9/43 (20%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCKER-----PECPLC 317
           C LC     D     CGH+FC +C    CKER      +CP C
Sbjct: 591 CSLCSKNWKDTVIKTCGHVFCADC----CKERLAARMRKCPTC 629

>YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiquitin
           ligase required for endoplasmic reticulum-associated
           degradation of misfolded luminal and integral membrane
           proteins [1656 bp, 551 aa]
          Length = 551

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 13/56 (23%)

Query: 276 DARKCILCLAYMTD-------------PSCSPCGHIFCWECILDWCKERPECPLCR 318
           D   CI+C+  +               P   PCGHI    C+ +W +    CP+CR
Sbjct: 345 DDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICR 400

>KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w singleton, start by similarity
          Length = 757

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 293 SPCGHIFCWECILDWCKERPECPLCR 318
           +PC HIF  EC+ +W   + +CP+CR
Sbjct: 726 TPCSHIFHTECLENWMSYKLQCPVCR 751

>CAGL0I09988g complement(951368..952531) similar to tr|Q12161
           Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 387

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 5/48 (10%)

Query: 276 DARKCILCLAYMTDPSCSPCGHIFCWECILDWCKERPE-----CPLCR 318
           D   C +C  YM  P  + CGH +C+ C+  W           CP CR
Sbjct: 26  DTTICSICHDYMFVPMTTECGHSYCYTCLKTWFSSDTNRGGLSCPECR 73

>Scas_644.6
          Length = 510

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 11/64 (17%)

Query: 266 DKEIFPFIPEDARK----CILCLAYMTDPSCS-------PCGHIFCWECILDWCKERPEC 314
           D ++   IPED +     CI+C+  +             PCGH     C+ +W +    C
Sbjct: 335 DSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTC 394

Query: 315 PLCR 318
           P+CR
Sbjct: 395 PICR 398

>AER113W [2618] [Homologous to ScYLR427W - SH]
           complement(848584..850581) [1998 bp, 665 aa]
          Length = 665

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 18/68 (26%)

Query: 280 CILCLAY-MTDPSCSPCGHIFCWECILDWCK---------------ERP--ECPLCRQEC 321
           C +CLA  +  P  +PCGHI C  C+L +                  RP  ECPLC    
Sbjct: 229 CPICLAEEVVAPRMAPCGHILCMTCMLQFFAAETGREVARAPGAYVRRPPKECPLCGSIV 288

Query: 322 QIQQILPL 329
           + ++ +P+
Sbjct: 289 RKERCMPV 296

>CAGL0G03553g complement(345057..345689) weakly similar to sp|P40072
           Saccharomyces cerevisiae YER116c YEU6, hypothetical
           start
          Length = 210

 Score = 35.4 bits (80), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 6/54 (11%)

Query: 279 KCILCLAYMTDPSCSPCGHIFCWECILDWC------KERPECPLCRQECQIQQI 326
           KC +C         +PCGH+FC EC+          ++   C LCR+   ++QI
Sbjct: 145 KCPICFEPPDVAIMTPCGHVFCCECLFQMVNNSRTPRKGGVCALCRKTINMKQI 198

>CAGL0E02299g complement(219009..220646) similar to tr|Q08109
           Saccharomyces cerevisiae YOL013c HRD1, start by
           similarity
          Length = 545

 Score = 36.2 bits (82), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 23/57 (40%), Gaps = 12/57 (21%)

Query: 274 PEDARKCILCLAYMTD------------PSCSPCGHIFCWECILDWCKERPECPLCR 318
           P     CI+C+  +              P   PCGH+    C+ +W +    CP+CR
Sbjct: 344 PNFDNVCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICR 400

>CAGL0D00638g complement(80947..83028) similar to tr|Q07457
           Saccharomyces cerevisiae YDL074c BRE1, hypothetical
           start
          Length = 693

 Score = 36.2 bits (82), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 9/45 (20%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCKER-----PECPLCRQ 319
           C LC     + +   CGH+FC +C    CKER      +CP C +
Sbjct: 641 CSLCSKNWKNMAIRTCGHVFCEDC----CKERLAARMRKCPTCNK 681

>CAGL0A00935g complement(97372..98052) some similarities with
           sp|P53769 Saccharomyces cerevisiae YLR323c, hypothetical
           start
          Length = 226

 Score = 35.4 bits (80), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 6/51 (11%)

Query: 267 KEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLC 317
           KE  PF      KC+LC      P  + CGH FC +C ++  K    C +C
Sbjct: 158 KEAVPF------KCVLCKESYERPVKTNCGHYFCQKCFVNRIKIDKSCFIC 202

>Scas_625.4
          Length = 761

 Score = 36.2 bits (82), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 292 CSPCGHIFCWECILDWCKERPECPLCR 318
            +PC HIF  +C+ +W   + +CP+CR
Sbjct: 729 VTPCDHIFHTDCLENWMGYKLQCPVCR 755

>Kwal_26.8099
          Length = 750

 Score = 36.2 bits (82), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 289 DPSCSPCGHIFCWECILDWCKERPECPLCR 318
           D   +PC HIF  +C+  W   + +CP+CR
Sbjct: 715 DYMITPCSHIFHTQCLESWMSYKLQCPVCR 744

>KLLA0C05874g complement(520079..521740) weakly similar to
           sgd|S0005373 Saccharomyces cerevisiae YOL013c HRD1
           involved in degradation of HMG2P, start by similarity
          Length = 553

 Score = 35.8 bits (81), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 41/107 (38%), Gaps = 6/107 (5%)

Query: 212 TAEVLPICKGWFKSYYSKDEKGTLTNEKQSQGDIQAGILTRIPNESEVNHLNLSDKEIFP 271
           T  V+ +   W      K  +G   N K S+  + A ++     + E   +++    +  
Sbjct: 301 TGRVMMVTVLWEAITTFKSARGLWKNWKSSKS-LDASLMDATDIQIESGEIDICIVCMED 359

Query: 272 FIPEDARKCILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCR 318
           F+P   RK     +        PC H     C+ +W    P CP+CR
Sbjct: 360 FLPSHQRK-----SDGKKVKILPCTHALHLSCLKNWIARSPTCPICR 401

>Kwal_56.22522
          Length = 513

 Score = 35.8 bits (81), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 10/53 (18%)

Query: 276 DARKCILCLAYMTDPS-CS---------PCGHIFCWECILDWCKERPECPLCR 318
           D + CI+C+  M  PS C+         PC H     C+  W +    CP+CR
Sbjct: 312 DDKMCIVCMDDMLAPSECTNAKQKPKRLPCNHCLHLGCLKSWMERSQTCPICR 364

>YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.5365p [2277 bp, 758 aa]
          Length = 758

 Score = 35.8 bits (81), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 292 CSPCGHIFCWECILDWCKERPECPLCR 318
            +PC H+F   C+ +W   + +CP+CR
Sbjct: 726 VTPCNHVFHTSCLENWMNYKLQCPVCR 752

>YDL074C (BRE1) [794] chr4 complement(324047..326149) Ubiquitin
           ligase (E3), may be required for Rad6p function in
           chromatin modification, plays a role in gene silencing
           [2103 bp, 700 aa]
          Length = 700

 Score = 35.8 bits (81), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 9/43 (20%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCKER-----PECPLC 317
           C LC     + +   CGH+FC  C    CKER      +CP C
Sbjct: 648 CSLCSKNWKNMAIKTCGHVFCENC----CKERLAARMRKCPTC 686

>Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement
          Length = 331

 Score = 35.0 bits (79), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 4/44 (9%)

Query: 290 PSCSPCGHIFCWECILDWCKERPE----CPLCRQECQIQQILPL 329
           P  + CGH +C++CI +W          CP CR    +  +L +
Sbjct: 4   PVMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSVSVPPVLNV 47

>Scas_625.11
          Length = 274

 Score = 34.7 bits (78), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 9/57 (15%)

Query: 277 ARKCILC-LAYM----TDPSCSP-CGHIFCWECILDWCKERPECPLCRQ---ECQIQ 324
           + +C +C +AY     T+ +C P C H F +ECI  W ++   CPLCR    EC+ +
Sbjct: 207 SDECPICRIAYSDDFETEITCLPNCSHHFHFECIKLWLQKNSLCPLCRDNVMECKAE 263

>KLLA0B02981g complement(267798..269789) similar to sgd|S0002232
           Saccharomyces cerevisiae YDL074c BRE1, start by
           similarity
          Length = 663

 Score = 35.0 bits (79), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 9/43 (20%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCKER-----PECPLC 317
           C LC     + +   CGH+FC  C    CKER      +CP C
Sbjct: 611 CSLCSKNWKNTALKTCGHVFCDVC----CKERLAARMRKCPTC 649

>YLR427W (MAG2) [3803] chr12 (988424..990436) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.6916p [2013 bp, 670 aa]
          Length = 670

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 17/80 (21%)

Query: 267 KEIFPFIPEDARKCILCLAYM-TDPSCSPCGHIFCWECILDWC----------------K 309
           ++I   I    + C +CL+     P    CGHIFC  C+L++                 K
Sbjct: 182 EKILRVIVPKGQNCSICLSEEPVAPRMVTCGHIFCLSCLLNFFSIEETVKNKETGYSKKK 241

Query: 310 ERPECPLCRQECQIQQILPL 329
           +  ECPLC      +++ P+
Sbjct: 242 KYKECPLCGSIIGPKRVKPV 261

>ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH]
           (328044..329771) [1728 bp, 575 aa]
          Length = 575

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 294 PCGHIFCWECILDWCKERPECPLCR 318
           PCGH+  + C+  W +    CP+CR
Sbjct: 344 PCGHMLHFGCLKSWMERSQTCPICR 368

>Kwal_27.10723
          Length = 229

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 6/54 (11%)

Query: 279 KCILCLAYMTDPSCSPCGHIFCWECILDWCKERP------ECPLCRQECQIQQI 326
           KC +C         +PCGH+FC EC+               C LCR+    + +
Sbjct: 163 KCPICFEPPEAALVTPCGHVFCTECLFQMVNSSRGQSRAGHCALCRRGVHFRDV 216

>CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces
           cerevisiae YDR266c, start by similarity
          Length = 657

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 10/81 (12%)

Query: 242 QGDIQAGILTRIPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFCW 301
           Q +I++G  + I  E +V   N  +++      +D   CI+C   +   S SPC H  C 
Sbjct: 47  QKEIKSGKKSNI--EKKVEEFNAREED------DDTELCIICARVLVYASLSPCNHTTCH 98

Query: 302 ECILDWCK--ERPECPLCRQE 320
            C        E+  C +CR E
Sbjct: 99  VCSFRQRALYEKKSCLICRTE 119

>YER116C (SLX8) [1547] chr5 complement(395344..396168) Subunit of
           Hex3p-Slx8p complex, required for cell growth in the
           absence of SGS1 or TOP3 [825 bp, 274 aa]
          Length = 274

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 56/144 (38%), Gaps = 19/144 (13%)

Query: 197 TNTYKLLGNIMLLQQTAEVLPICKGWFKSYYSKDEKGTLTNEKQSQGDIQAGILTRIPNE 256
           TN  + L  + +L QTA   P       +     + GT  N K+   D+ A  +     E
Sbjct: 120 TNNVEELHTMDVLSQTANT-PSASPMLDAAPPTTKPGT--NSKEQTVDLTADAIDLDAEE 176

Query: 257 SEVNHLNLSDKEIFPFIPEDAR--------KCILCLAYMTDPSCSPCGHIFCWECILDW- 307
            +V  L +SD +      E  +        +C +C         + CGH+FC  C+    
Sbjct: 177 QQV--LQISDDDFQEETKEAPKEYGAAKDYRCPICFEPPETALMTLCGHVFCCPCLFQMV 234

Query: 308 -----CKERPECPLCRQECQIQQI 326
                C++   C LCR +  ++ +
Sbjct: 235 NSSRTCRQFGHCALCRSKVYLKDV 258

>CAGL0H10274g complement(1003801..1004145) similar to sp|P38239
           Saccharomyces cerevisiae YBR062c, hypothetical start
          Length = 114

 Score = 32.3 bits (72), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 295 CGHIFCWECILDWCKERPECPLCRQECQIQQILP 328
           CGH F +EC+  W  +   CP+CR +   ++ LP
Sbjct: 64  CGHKFDFECVSMWLTKNTTCPMCRDDVTHKKELP 97

>AGL191W [4121] [Homologous to ScYDR143C (SAN1) - SH]
           complement(339295..341043) [1749 bp, 582 aa]
          Length = 582

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 16/32 (50%)

Query: 286 YMTDPSCSPCGHIFCWECILDWCKERPECPLC 317
           Y   P+  PCGH+F  +CI  W +E      C
Sbjct: 217 YKHSPTELPCGHVFGRDCIFRWTQEHNSLSYC 248

>Kwal_27.10546
          Length = 104

 Score = 32.0 bits (71), Expect = 0.16,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 6/52 (11%)

Query: 275 EDARKC-ILCLAYMTDP-----SCSPCGHIFCWECILDWCKERPECPLCRQE 320
           +DA  C I C  Y  D          C H F  EC+  W  +   CPLCR +
Sbjct: 30  KDAEACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRTCPLCRDD 81

>AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH]
           (164204..164929) [726 bp, 241 aa]
          Length = 241

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 6/54 (11%)

Query: 279 KCILCLAYMTDPSCSPCGHIFCWECILDWC------KERPECPLCRQECQIQQI 326
           KC +C         +PCGHI+C  C+          +   +C LCR++ +++++
Sbjct: 172 KCPICFDPPEAALMTPCGHIYCTVCLFQMVNSSRGYRRNGQCALCRKDVKLKEV 225

>AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH]
           complement(928488..930749) [2262 bp, 753 aa]
          Length = 753

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 20/34 (58%)

Query: 285 AYMTDPSCSPCGHIFCWECILDWCKERPECPLCR 318
           A + D   +PC H+F   C+ +W   + +CP+CR
Sbjct: 714 ANIHDYMVTPCSHLFHTGCLENWMSYKLQCPVCR 747

>Kwal_47.17638
          Length = 248

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 22/44 (50%)

Query: 279 KCILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQECQ 322
           KC++C      P  + C H FC  C L   ++  +C +C ++ Q
Sbjct: 187 KCLICKGDYKKPVVTKCQHYFCSSCFLAKARKTTKCVVCGEDTQ 230

>Scas_585.5*
          Length = 109

 Score = 32.0 bits (71), Expect = 0.22,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 24/64 (37%), Gaps = 18/64 (28%)

Query: 280 CILCLAYMTDP--SCSP----------------CGHIFCWECILDWCKERPECPLCRQEC 321
           C +C  ++ +P   C P                C H F   CI  W K R  CPL  Q  
Sbjct: 43  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKTRDACPLDNQPW 102

Query: 322 QIQQ 325
           Q+ +
Sbjct: 103 QLAR 106

>CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w, start by similarity
          Length = 757

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 293 SPCGHIFCWECILDWCKERPECPLCR 318
           +PC H+F   C+  W   + +CP+CR
Sbjct: 726 TPCDHMFHTSCLESWMSYKLQCPVCR 751

>Scas_719.51
          Length = 647

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 18/75 (24%)

Query: 260 NHLNLSDKEIFPFIPEDARKCILCLAYM-TDPSCSPCGHIFCWECILDWC---------- 308
           N L   +K I   +P+  + C +CL+     P    CGHIFC  C++++           
Sbjct: 158 NKLVPEEKIIRVVVPK-GQNCPICLSEEPIAPRMITCGHIFCMSCLINFFSIEETIKNPE 216

Query: 309 ------KERPECPLC 317
                 K+  ECPLC
Sbjct: 217 TGYVKKKKYKECPLC 231

>Sklu_2411.2 YMR026C, Contig c2411 3617-4798
          Length = 393

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 7/61 (11%)

Query: 262 LNLSDKEIFPFIPEDARK-----CILCLAYMTDPSCSPCGHIFCWECILDWC-KERPECP 315
           LN  DK+I P  P +++K     C +C   +T+P     G++FC+ C+L++      +CP
Sbjct: 307 LNDIDKDIPP-PPINSKKQTSTKCEICHQIITNPCAIETGYVFCYPCVLNYLPANEGKCP 365

Query: 316 L 316
           +
Sbjct: 366 V 366

>KLLA0D02552g complement(215290..217149) similar to sgd|S0004419
           Saccharomyces cerevisiae YLR427w, start by similarity
          Length = 619

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 30/77 (38%), Gaps = 21/77 (27%)

Query: 273 IPEDARKCILCLAY-MTDPSCSPCGHIFCWECILDWCKERP------------------- 312
           IP+  + C +CL+  +  P    CGH+FC  C+L      P                   
Sbjct: 170 IPK-GQTCPICLSEDLISPRMVVCGHVFCQTCLLQLFTNDPMVGKNDESTYARMKRKDLR 228

Query: 313 ECPLCRQECQIQQILPL 329
           ECPLC    +   + P+
Sbjct: 229 ECPLCSSIIKKTSVKPV 245

>Scas_705.41
          Length = 428

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 9/57 (15%)

Query: 280 CILCLAYMTDPSC-----SPCGHIFCWECILDWC--KERPECPLCRQECQIQQILPL 329
           C +C   + D         PC H + ++CI  W    +  +CPLCR  CQ + ++ L
Sbjct: 12  CPICFDDLNDTDILQGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCR--CQPKTMIVL 66

>Kwal_47.17099
          Length = 605

 Score = 32.3 bits (72), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 18/71 (25%)

Query: 277 ARKCILCLAY-MTDPSCSPCGHIFCWECILDWC-----------------KERPECPLCR 318
            + C +CL+  +  P    CGH+FC  C+L +                  K   ECPLC 
Sbjct: 163 GQSCPICLSQEIIAPRMVSCGHLFCQTCLLSFFAAGAQEQDKGAGINYKKKRYMECPLCS 222

Query: 319 QECQIQQILPL 329
              + ++ +P+
Sbjct: 223 TIIRKEKSIPV 233

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 32.3 bits (72), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 6/44 (13%)

Query: 280 CILCLAYMTDPSCS----PCGHIFCWECILDWCKERPECPLCRQ 319
           C +CL  M   +      PC H F  +C+  W   R  CP+CR 
Sbjct: 240 CPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR--CPVCRH 281

>CAGL0J04796g 453697..455496 similar to tr|Q06436 Saccharomyces
           cerevisiae YLR427w, hypothetical start
          Length = 599

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 29/70 (41%), Gaps = 18/70 (25%)

Query: 266 DKE-IFPFIPEDARKCILCLAYM-TDPSCSPCGHIFCWECILDWC--------------- 308
           DKE I   I    + C +CL  +   P    CGHIFC  C+ ++                
Sbjct: 137 DKEKIVRVIVPRGQNCPICLNEIPVAPRMVTCGHIFCMSCLENFFEIEEVVKNPETGIKQ 196

Query: 309 -KERPECPLC 317
            K+  ECPLC
Sbjct: 197 KKKFKECPLC 206

>KLLA0E07007g 641391..642230 some similarities with sp|P40072
           Saccharomyces cerevisiae YER116c subunit of HEX3P-SLX8P
           complex, required for cell growth in the absence of SGS1
           or TOP3 singleton, hypothetical start
          Length = 279

 Score = 31.6 bits (70), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 44/107 (41%), Gaps = 14/107 (13%)

Query: 230 DEKGTLTNEKQSQGDIQAGILTRIPNESEV-NHLNLSDKEIFPFIPEDARK--CILCLAY 286
           D+   LT E+Q    I+A  +  I +E E   H +  D    P   + A    C +C+  
Sbjct: 163 DDIKVLTEEEQ----IKAQQVIEIDDEDETEGHKSGKDMSETPLETKKAADYVCPICMEP 218

Query: 287 MTDPSCSPCGHIFCWECILDWC-------KERPECPLCRQECQIQQI 326
                 + CGH+FC  C+           +    C LCR+  ++Q +
Sbjct: 219 PEAALVTKCGHVFCTTCLYGMVNSSKGNGRRNGLCALCRENVKLQDL 265

>Kwal_55.20000
          Length = 617

 Score = 32.0 bits (71), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 2/46 (4%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCK--ERPECPLCRQECQI 323
           CI+C   +T  + SPC H+ C  C         +  C +CR E  +
Sbjct: 53  CIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDL 98

>Kwal_26.8247
          Length = 386

 Score = 31.6 bits (70), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 5/60 (8%)

Query: 262 LNLSDKEIFPF-IPEDARK---CILCLAYMTDPSCSPCGHIFCWECILDWCKERP-ECPL 316
           LN  DK+I P  +P +  +   C +C   + +P+    G++FC+ CIL++  +    CP+
Sbjct: 300 LNSIDKDIPPPPLPHEKNEDGTCRICKGPIQNPAAIGTGYVFCYPCILEYLPQHEGRCPV 359

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 6/43 (13%)

Query: 280 CILCLAYMTDPSCS----PCGHIFCWECILDWCKERPECPLCR 318
           C +CL  M   +      PC H F  +C+  W  +  +CP+CR
Sbjct: 247 CPVCLERMDSETTGLITIPCQHTFHCQCLDKW--KNSKCPVCR 287

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 10/62 (16%)

Query: 279 KCILCLAYMTDPSC----SPCGHIFCWECILDWC------KERPECPLCRQECQIQQILP 328
           +C +C +   +P      + C H FC  C+L++       K   +CP CR+    +++L 
Sbjct: 873 ECSICTSEPIEPITQVIFTECAHAFCEHCLLEYIDFQTQKKLELKCPNCRESIDPKRLLT 932

Query: 329 LR 330
           L+
Sbjct: 933 LK 934

>Kwal_27.10419
          Length = 300

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 4/33 (12%)

Query: 290 PSCSPCGHIFCWECILDWCKERPE----CPLCR 318
           P  + CGH +C++CI +W          CP CR
Sbjct: 4   PVMTTCGHNYCYDCISNWLVSNNANELTCPQCR 36

>AGR034W [4344] [Homologous to ScYBR062C - SH]
           complement(772772..773251) [480 bp, 159 aa]
          Length = 159

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 17/31 (54%)

Query: 295 CGHIFCWECILDWCKERPECPLCRQECQIQQ 325
           CGH F  +C+  W      CP+CR +  +++
Sbjct: 111 CGHTFDLQCVSVWLSRSTTCPMCRSDVLVRK 141

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
           cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 9/58 (15%)

Query: 279 KCILCLAYMTDPS---CSPCGHIFCWECILDWCKERPE------CPLCRQECQIQQIL 327
           +C +C A   + S    + C H+FC EC+ ++   + E      CP CR++  + + L
Sbjct: 896 ECSICTAEPIESSSAVVTECEHVFCKECLEEYGNFQKEKSLQQKCPNCRRDINLNRCL 953

>Scas_674.12d
          Length = 1323

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 3/46 (6%)

Query: 276  DARKCILCLAYMTDPSCS---PCGHIFCWECILDWCKERPECPLCR 318
            D+  C+ CL  +   S S    CGH+ C  CI  +  E+   P  +
Sbjct: 1030 DSATCVWCLEQLEPESTSILTSCGHLLCDACIDPFYSEQSTLPTAK 1075

>KLLA0D00979g 86703..88388 similar to sp|P09232 Saccharomyces
           cerevisiae YEL060c PRB1 protease B, vacuolar, start by
           similarity
          Length = 561

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 144 ISLKQVLSAIVETHLVLFYFKGAYYEISKRLFGLRYSIGHEPSANEAQTREQSTNT 199
            S K VLS + E  +    + G   ++   L+G  YSIG EPSAN   + E   N+
Sbjct: 485 FSTKNVLSDLPEDTVNYLIYNGGGQDLDD-LWGKDYSIGKEPSANPEFSLESLINS 539

>KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674
           Saccharomyces cerevisiae YDR266c, start by similarity
          Length = 656

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCK--ERPECPLCRQECQ 322
           C++C   +   + SPC H  C +C L      E+ +C  CR E +
Sbjct: 89  CLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVE 133

>YML076C (WAR1) [3893] chr13 complement(112513..115347)
           Transcription factor with a Zn[2]-Cys[6] fungal-type
           binuclear cluster domain, involved in mediating the weak
           acid stress response [2835 bp, 944 aa]
          Length = 944

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 150 LSAIVETHLVLFYFKGAYYEISKRLFGLRYSIGHEPSANEAQTREQSTNTYKLLGNIMLL 209
           L  I+ T L LF+     Y +   L  LRYS+   PS ++            ++G   LL
Sbjct: 689 LEPILITSLPLFHTSRIIYTVGMLLLKLRYSVVAIPSFHDLMPLTDDAIAL-VIGVNNLL 747

Query: 210 QQTAEVLPICKGWFKSYY 227
           ++T+E+ P     +K  Y
Sbjct: 748 EKTSELYPFNNSLYKFRY 765

>Scas_615.12
          Length = 674

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 2/43 (4%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCK--ERPECPLCRQE 320
           C++C + +   S SPC H  C +C         +  C +CR E
Sbjct: 72  CLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTE 114

>CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06834
           Saccharomyces cerevisiae YPR093c, hypothetical start
          Length = 305

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 6/48 (12%)

Query: 277 ARKCILCLAYMTDPSCS----PCGHIFCWECILDW--CKERPECPLCR 318
           ++ C +CL  +   S +    PCGH +  +CI  W    E  +CP+CR
Sbjct: 3   SKVCAICLEDICGKSSTSYLKPCGHEYHSDCIRKWHGHAEDLKCPMCR 50

>KLLA0F18458g complement(1697871..1698293) some similarities with
           sp|P38239 Saccharomyces cerevisiae YBR062c singleton,
           hypothetical start
          Length = 140

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 18/32 (56%)

Query: 295 CGHIFCWECILDWCKERPECPLCRQECQIQQI 326
           C H F  EC+  W +    CP+CR + + +++
Sbjct: 92  CNHKFDLECLSIWLQNNHTCPMCRDDLRSKKV 123

>ABR067C [658] [Homologous to ScYMR026C (PEX12) - SH]
           (514945..516006) [1062 bp, 353 aa]
          Length = 353

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 10/43 (23%), Positives = 25/43 (58%)

Query: 274 PEDARKCILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPL 316
           P  + +C +C + +++P     G+I C+ C + + ++  +CP+
Sbjct: 294 PYISVRCPVCRSAVSNPGVLQTGYIACYPCAVRYVEKHGKCPV 336

>Sklu_2204.2 YBR136W, Contig c2204 3175-10305 reverse complement
          Length = 2376

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 267 KEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQ 319
           KEIFPF  E   KC+  + Y T    +    +F  + +L W  +  + PL +Q
Sbjct: 341 KEIFPF-DETTNKCLGLIYYDTKRRSASKDQLFFDKFLLTWDLKSDDYPLIKQ 392

>Scas_591.10
          Length = 772

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 7/45 (15%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCKERPE-------CPLC 317
           C LC     +P  S C H FC  CI ++ +   E       CP+C
Sbjct: 518 CQLCDDVAEEPIASKCHHKFCRMCIKEYIESFMENNDSKLTCPVC 562

>Scas_721.100
          Length = 1137

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 15/69 (21%)

Query: 271 PFIPEDARKCILCLAYMTDP------SCSPCGHIFCWECILDWCKERP------ECPLCR 318
           P I   A +C +C    TDP        + CGH FC  CI ++ + +       +CP CR
Sbjct: 875 PQIDFPALECSIC---TTDPIPLDKIVFTECGHPFCESCIEEYFEFQAGKNLELKCPNCR 931

Query: 319 QECQIQQIL 327
           ++    ++L
Sbjct: 932 EQINSNRLL 940

>Kwal_23.3660
          Length = 768

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 6/44 (13%)

Query: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCK------ERPECPLC 317
           C LC     +P  S C H FC  CI ++ +      E+  CP+C
Sbjct: 515 CQLCDDEAEEPIESKCHHRFCRLCIKEYTESFLENLEKLTCPVC 558

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
           complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 10/61 (16%)

Query: 279 KCILC----LAYMTDPSCSPCGHIFCWECILDWCKERPE------CPLCRQECQIQQILP 328
           +C +C    ++ +T    + CGH FC  C+L++ + + +      CP CR   + + +L 
Sbjct: 831 ECSICTCEAISPLTSVVFTRCGHPFCESCLLEYIQFQNKKGSETICPNCRAAVESRYLLK 890

Query: 329 L 329
           L
Sbjct: 891 L 891

>CAGL0K10384g complement(1010551..1016865) similar to sp|P34756
           Saccharomyces cerevisiae YFR019w FAB1
           phosphatidylinositol 3-phosphate 5-kinase, hypothetical
           start
          Length = 2104

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 4/41 (9%)

Query: 275 EDARKCILC----LAYMTDPSCSPCGHIFCWECILDWCKER 311
           E AR+C  C      +     C  CG IFC  C L    ER
Sbjct: 282 ESARECFTCGKRFNTFRRKHHCRICGQIFCKNCTLIINGER 322

>Scas_697.32
          Length = 521

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 6/57 (10%)

Query: 274 PEDARKCILCLAYMTDPS---CSPCGHIFCWECILDWCK-ERP--ECPLCRQECQIQ 324
           P     C LCL+ +T+      SPC H + ++C+ D    E P   CP C+ +  ++
Sbjct: 339 PNATDNCSLCLSKITEGKPIFISPCSHHWHYKCVKDLITVEYPFFFCPTCKNQFDLE 395

>Kwal_33.15326
          Length = 1044

 Score = 28.9 bits (63), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 176 GLRYSIGHEPSANEAQTREQSTNTYKLLGNIMLLQQTAEVLPICKGWFKS 225
           G  Y  G  P +++  TRE+  N  +L  +    ++     P+C GW KS
Sbjct: 556 GFFYHFGKSPWSHDKLTREEVVNYLQLSKSTSGFRKIKRC-PLCSGWCKS 604

>Kwal_55.21206
          Length = 275

 Score = 28.5 bits (62), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 295 CGHIFCWECILDW-CKERPECPLCRQECQIQQIL 327
           C H+F   CI  W C+    CPLC++   + ++ 
Sbjct: 138 CNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVF 171

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 28.5 bits (62), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 43/103 (41%), Gaps = 16/103 (15%)

Query: 224 KSYYSKDEKGTLTNEKQSQGDIQAGILTRIPNESEV-NHLNLSDKEIFPFIPED--ARKC 280
           + Y S  E+G + N         A I T I    ++ +H +L  K +  F  +D     C
Sbjct: 485 RKYNSFVEEGVVLNN-------YANIFTLITRMRQLADHPDLVLKRLNNFPGDDIGVVIC 537

Query: 281 ILCLAYMTDPSCSPCGHIFCWECILDWCKERPE------CPLC 317
            LC     +P  S C H FC  CI ++ +   E      CP+C
Sbjct: 538 QLCNDEAEEPIESKCHHKFCRLCIKEYVESFMENNNKLTCPVC 580

>YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.8878p
           [348 bp, 115 aa]
          Length = 115

 Score = 27.3 bits (59), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 15/33 (45%)

Query: 295 CGHIFCWECILDWCKERPECPLCRQECQIQQIL 327
           C H F  EC+  W      CPLCR      +I+
Sbjct: 65  CHHKFDLECLSVWLSRSTTCPLCRDNVMGHRII 97

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
           DNA-dependent ATPase of the Snf2p family of DNA
           helicases, member of the RAD6 epistasis group, involved
           in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 28.5 bits (62), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 6/43 (13%)

Query: 293 SPCGHIFCWECILDWCKERP------ECPLCRQECQIQQILPL 329
           + CGH FC +C+ ++ + +       +CP CR +    ++L L
Sbjct: 930 TECGHSFCEKCLFEYIEFQNSKNLGLKCPNCRNQIDACRLLAL 972

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 6/43 (13%)

Query: 280 CILCL----AYMTDPSCSPCGHIFCWECILDWCKERPECPLCR 318
           C +CL    + +T    +PC H F  +C+  W  +   CP+CR
Sbjct: 215 CPVCLEKLDSEVTGLVTTPCQHTFHCKCLDQW--KNGNCPVCR 255

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,968,988
Number of extensions: 391158
Number of successful extensions: 1196
Number of sequences better than 10.0: 137
Number of HSP's gapped: 1202
Number of HSP's successfully gapped: 137
Length of query: 330
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 228
Effective length of database: 13,065,073
Effective search space: 2978836644
Effective search space used: 2978836644
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)