Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_615.1267467429790.0
CAGL0M08668g65760514860.0
YDR266C63961614680.0
Scas_699.3861242412111e-158
Sklu_1676.265064111371e-147
AER391C63257910371e-132
Kwal_55.2000061757910301e-131
KLLA0E16698g6565879291e-116
AGR233W28493701.8
KLLA0F06732g16147663.4
Scas_672.226347674.1
Kwal_55.1999915242645.4
Scas_553.3*102567668.0
Scas_615.1333043659.2
Scas_665.139246659.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_615.12
         (674 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_615.12                                                          1152   0.0  
CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces c...   577   0.0  
YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Prote...   570   0.0  
Scas_699.38                                                           471   e-158
Sklu_1676.2 YDR266C, Contig c1676 743-2695                            442   e-147
AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)...   404   e-132
Kwal_55.20000                                                         401   e-131
KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674 Sac...   362   e-116
AGR233W [4544] [Homologous to ScYGL221C (NIF3) - SH] complement(...    32   1.8  
KLLA0F06732g complement(649269..649754) highly similar to sp|P40...    30   3.4  
Scas_672.2                                                             30   4.1  
Kwal_55.19999                                                          29   5.4  
Scas_553.3*                                                            30   8.0  
Scas_615.13                                                            30   9.2  
Scas_665.1                                                             30   9.6  

>Scas_615.12
          Length = 674

 Score = 1152 bits (2979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/674 (84%), Positives = 568/674 (84%)

Query: 1   MTDQQPTPSKALKTADKTQXXXXXXXXXXXXXXXXXXXXXXXSRISKPIEEIARTTRNLD 60
           MTDQQPTPSKALKTADKTQ                       SRISKPIEEIARTTRNLD
Sbjct: 1   MTDQQPTPSKALKTADKTQKKSTSKANTKAKNDTAKANKKGKSRISKPIEEIARTTRNLD 60

Query: 61  INSGXXXXXXLCLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTENDKLIF 120
           INSG      LCLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTENDKLIF
Sbjct: 61  INSGDDDDDDLCLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTENDKLIF 120

Query: 121 TENINANYTDSNLGHYQFNEKYGIVFTSEEVATATLNLLKYTCSVCPANKDGIEREDFGS 180
           TENINANYTDSNLGHYQFNEKYGIVFTSEEVATATLNLLKYTCSVCPANKDGIEREDFGS
Sbjct: 121 TENINANYTDSNLGHYQFNEKYGIVFTSEEVATATLNLLKYTCSVCPANKDGIEREDFGS 180

Query: 181 YKKYNEHLRSKHNKCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGNSEGFKGHPLCAFC 240
           YKKYNEHLRSKHNKCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGNSEGFKGHPLCAFC
Sbjct: 181 YKKYNEHLRSKHNKCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGNSEGFKGHPLCAFC 240

Query: 241 SGQRFYGDDELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLD 300
           SGQRFYGDDELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLD
Sbjct: 241 SGQRFYGDDELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLD 300

Query: 301 NKFIVFKDELELQAHILKEHGDLIRGKPKLFQSELSTFMSGPSRVVRDRDAMNYDMDXXX 360
           NKFIVFKDELELQAHILKEHGDLIRGKPKLFQSELSTFMSGPSRVVRDRDAMNYDMD   
Sbjct: 301 NKFIVFKDELELQAHILKEHGDLIRGKPKLFQSELSTFMSGPSRVVRDRDAMNYDMDSRP 360

Query: 361 XXXXXXXXXXATPLGTXXXXXXXXXXIPELRQLRLEERAKYYLENSQELYDKFIKCNDEY 420
                     ATPLGT          IPELRQLRLEERAKYYLENSQELYDKFIKCNDEY
Sbjct: 361 SLFSSSPSSSATPLGTDGNDDNSDNDIPELRQLRLEERAKYYLENSQELYDKFIKCNDEY 420

Query: 421 DKGYLTGLGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEAQEQKLYLQ 480
           DKGYLTGLGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEAQEQKLYLQ
Sbjct: 421 DKGYLTGLGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEAQEQKLYLQ 480

Query: 481 NGLPXXXXXXXXXXXXXXXWNNSGSVAMNRNIRDLPTLEAKSKSFDPFATTVKKTPALRT 540
           NGLP               WNNSGSVAMNRNIRDLPTLEAKSKSFDPFATTVKKTPALRT
Sbjct: 481 NGLPSLSGSSASISSATRSWNNSGSVAMNRNIRDLPTLEAKSKSFDPFATTVKKTPALRT 540

Query: 541 MXXXXXXXXSPSPIAYTPXXXXXXXXXXTVPRLPTTNVSNTVRMGSSTNGKNKKLADLNL 600
           M        SPSPIAYTP          TVPRLPTTNVSNTVRMGSSTNGKNKKLADLNL
Sbjct: 541 MKKTVVKKVSPSPIAYTPLGGSSLSSLSTVPRLPTTNVSNTVRMGSSTNGKNKKLADLNL 600

Query: 601 PQLPTPKPKVYIPPLRKTTIPDPKQWGGGGQNVPSTDNLPSLPIHHXXXXXXXXXXXXXX 660
           PQLPTPKPKVYIPPLRKTTIPDPKQWGGGGQNVPSTDNLPSLPIHH              
Sbjct: 601 PQLPTPKPKVYIPPLRKTTIPDPKQWGGGGQNVPSTDNLPSLPIHHSNGSSQSNQQKGKR 660

Query: 661 XXXXXXXLLFHIGI 674
                  LLFHIGI
Sbjct: 661 GKQKQKQLLFHIGI 674

>CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces
           cerevisiae YDR266c, start by similarity
          Length = 657

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/605 (48%), Positives = 383/605 (63%), Gaps = 51/605 (8%)

Query: 43  SRISKPIEEIARTTRNLDINSGXXXXXXLCLICASKLVYASLSPCNHTTCHKCSFKQRSL 102
           S I K +EE      + D          LC+ICA  LVYASLSPCNHTTCH CSF+QR+L
Sbjct: 56  SNIEKKVEEFNAREEDDDTE--------LCIICARVLVYASLSPCNHTTCHVCSFRQRAL 107

Query: 103 YNKKACLICRTENDKLIFTENINANYTDSNLGHYQFNEKYGIVFTSEEVATATLNLLKYT 162
           Y KK+CLICRTEND+L FT+NI+A Y++        ++K+GI FTS+EV  ATL+LLKY 
Sbjct: 108 YEKKSCLICRTENDRLTFTDNIDAQYSEIT-DFSGSDDKFGIDFTSDEVKNATLDLLKYA 166

Query: 163 CSVCPANKDGIEREDFGSYKKYNEHLRSKHNKCLCTICAQNNHIFPSELPVYTQNQLRNH 222
           C +CP N+  +      +YKKYNEHL+S HN+ +C ICA N H FP E+ +YT NQL+NH
Sbjct: 167 CPLCPDNEQHVST----TYKKYNEHLKSAHNRMICLICAGNKHSFPREMKIYTANQLKNH 222

Query: 223 QSKGNSEGFKGHPLCAFCSGQRFYGDDELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQL 282
            S+G+SEGFKGHP+CAFC+G+RFY DDELY+HMRN HEKCHICD+IDH  PQYFKDY+QL
Sbjct: 223 HSRGDSEGFKGHPMCAFCTGKRFYSDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQL 282

Query: 283 FDHFKNFHYICTVQTCLDNKFIVFKDELELQAHILKEHGDLIRGKPKLFQSELSTFMSGP 342
           F+HF+  HY+CTVQ+CLD+KF+VFKD++ELQAHILKEHGD++RGKPK FQSELSTF+S P
Sbjct: 283 FEHFRTSHYVCTVQSCLDDKFVVFKDDMELQAHILKEHGDILRGKPKFFQSELSTFISAP 342

Query: 343 SRVVRDRDAMNYDMDXXXXXXXXXXXXXATPLGTXXXXXXXXXXIPELRQLRLEERAKYY 402
           S+V+R+RD+ NYDM                  G+           PE+ +LR+ ERAK+Y
Sbjct: 343 SQVIRERDSYNYDM------------------GSVGSSNIEESSNPEVNRLRMNERAKHY 384

Query: 403 LENSQELYDKFIKCNDEYDKGYLTGLGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPK 462
           L +S E + KF   N+ YD   LT   L+  YK++FT   +++YLL++N++ LYPKNS K
Sbjct: 385 LNSSLEGFQKFETLNENYDSSVLTASQLVQEYKKLFTDTHADIYLLVHNLSALYPKNSKK 444

Query: 463 FKELNAIYEAQEQKLYLQNGLPXXXXXXXXXXXXXXXWNNSG---SVAMNRNIRDLPTLE 519
           FK+L+ IY+  EQ    +N LP                +++G   S +  +N+  LP+L 
Sbjct: 445 FKDLDVIYQEYEQTEKRKNALPSLLDDHIQTVPGGAWGSSTGRSKSHSSIKNLNQLPSLG 504

Query: 520 AKSKSFDPFATTVKKTPALRTMXXXXXXXXSPSPI--AYTPXXXXXXXXXXTVPRLPTTN 577
             S SFDPF     K P  + +        SP P+  A             T       N
Sbjct: 505 GVSSSFDPFKNP-NKAPVYKGL------RQSPKPVVSATQRQTPMRISARPTASNRVEFN 557

Query: 578 VSNTVRMGSSTNGKN--------KKLADLNLPQLPTPKPKVYIPPLRKTTIPDPKQWGGG 629
             +T +  + + G           KLADLNLP LP PKPKVYIPP+ +  IPDPK+WG  
Sbjct: 558 GGSTTKAATPSWGSQPSSNSSSKNKLADLNLPTLPAPKPKVYIPPVHEPVIPDPKKWGQK 617

Query: 630 GQNVP 634
           G+  P
Sbjct: 618 GEPAP 622

>YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Protein
           of unknown function, contains a RING finger domain [1920
           bp, 639 aa]
          Length = 639

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/616 (52%), Positives = 399/616 (64%), Gaps = 51/616 (8%)

Query: 71  LCLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTENDKLIFTENINANYTD 130
           LC+ICA KL Y SL+PC+H TCH C F+QR+LYNKK+CLICRTEN++++FT+ I+ + +D
Sbjct: 63  LCVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMFTDRIDGDISD 122

Query: 131 SNLGHYQF---NEKYGIVFTSEEVATATLNLLKYTCSVCPANKDGIEREDFGSYKKYNEH 187
                Y F   NEKYGI FTSEEVAT TLNLLK+    CP +KD  +  DFGS+KKYNEH
Sbjct: 123 K----YNFCEKNEKYGINFTSEEVATETLNLLKF---FCPLSKDE-QVCDFGSFKKYNEH 174

Query: 188 LRSKHNKCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGNSEGFKGHPLCAFCSGQRFYG 247
           L+S+HN+ +C ICA + H FP EL ++TQNQLRNHQ+KGNSEGFKGHP+CAFCSG+RFY 
Sbjct: 175 LKSEHNRMICLICATHKHAFPCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFCSGKRFYS 234

Query: 248 DDELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLDNKFIVFK 307
           DDELY+HMRN+HEKCHICDK++  SPQYFKDY+QLFDHFK+ HY+CTVQTCLDNKF+VFK
Sbjct: 235 DDELYIHMRNQHEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVFK 294

Query: 308 DELELQAHILKEHGDLIRGKPKLFQSELSTFMSGPSRVVRDRDAMNYDMDXXXXXXXXXX 367
           DELELQAHIL+EHG++++GKPK FQSELSTF+S PSRV+R+RD  +YD+           
Sbjct: 295 DELELQAHILQEHGNILKGKPKFFQSELSTFISAPSRVIRERD--DYDLPSISSLPGSSS 352

Query: 368 XXXATPLGTXXXXXXXXXXIPELRQLRLEERAKYYLENSQELYDKFIKCNDEYDKGYLTG 427
                               PE  +LRL ERAKYYLENS+E ++KF   N++Y KG L+ 
Sbjct: 353 GSRTDVRSASS---------PEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSA 403

Query: 428 LGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEAQEQKLYLQNGLPXXX 487
             LL+SYK +FT P ++VYLLI+N+A+ +PKNS K+  LNAIYE +EQ L  Q  LP   
Sbjct: 404 EKLLESYKLLFTKPNADVYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTSLPSLS 463

Query: 488 XXXXXXXX-XXXXW---NNSGSVAMN---RNIRDLPTLEAKSKSFDPFATTVKKTPALRT 540
                        W   N+ GS       RNI++LPTL++ S S+DPFATTVKK   LR 
Sbjct: 464 SDSSLSMSIGRGHWGGTNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKN-TLRP 522

Query: 541 MXXXXXXXXSPSPIAYTPXXXXXXXXXXTVPRLPTTNVSNTVRMGSSTNGKNKKLADLNL 600
           +        +P  ++Y            TV   PT   S      +S N    KL  LNL
Sbjct: 523 V--QNIKRTTPQSVSY-------RTSTNTVAFSPTYLESKKGSSSTSLNNSKDKLKSLNL 573

Query: 601 PQLPTPKPKVYIPPLRKTTIPDPKQWG--GGGQNVPSTDNLPSLPIHHXXXXXXXXXXXX 658
           PQLP PKPKV IP L +  I DPKQWG     Q+    DNL  L                
Sbjct: 574 PQLPPPKPKVQIPGLNRPQIADPKQWGKKSSTQDTNVHDNLREL----------NTTSGG 623

Query: 659 XXXXXXXXXLLFHIGI 674
                    LLFHIG+
Sbjct: 624 NKKKGKQKQLLFHIGV 639

>Scas_699.38
          Length = 612

 Score =  471 bits (1211), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 234/424 (55%), Positives = 304/424 (71%), Gaps = 19/424 (4%)

Query: 71  LCLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTE--NDKLIFTENINAN- 127
           +C+ICA+ + +A+ SPCNH TCHKCSF+Q +L++KK+CLICRT+  N+ +IFTE +N+  
Sbjct: 43  VCVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQA 102

Query: 128 YTDSNLGHYQ---FNEKYGIVFTSEEVATATLNLLKYTCSVC--PANKDGIEREDFGSYK 182
           Y D N   +Q    N KYGI FTS++VA  TLNL K+ CSVC     ++ +   D+ S+K
Sbjct: 103 YEDFNSNMWQTDLINTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKSFK 162

Query: 183 KYNEHLRSKHN-KCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGN-SEGFKGHPLCAFC 240
           K NEHL+ +HN K +C ICA ++  FPSEL +YT NQL+NH +KG+ ++GFKGHP+C FC
Sbjct: 163 KLNEHLKLEHNNKTICMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCKFC 222

Query: 241 SGQRFYGDDELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLD 300
           S +RFY  DEL  HMR KHE+CHICDKIDHN+PQ+FK+YDQLF HFKN HYICT QTCLD
Sbjct: 223 SNKRFYSQDELMSHMREKHERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICTFQTCLD 282

Query: 301 NKFIVFKDELELQAHILKEHGDLIRGKPKLFQSELSTFMSGPSRVVRDRDAMNYDMDXXX 360
           +KFIVFKD++ELQAHIL+EHGDLIRGKPK FQSELSTF+S PSRV+ D +A         
Sbjct: 283 DKFIVFKDDMELQAHILQEHGDLIRGKPKFFQSELSTFISTPSRVITDDNAF-------- 334

Query: 361 XXXXXXXXXXATPLGTXXXXXXXXXXIPELRQLRLEERAKYYLENSQELYDKFIKCNDEY 420
                     + P               E++QLRL+ERAK+YL+NS E +  FI  N +Y
Sbjct: 335 -TSQHSFSDSSLPSLNSVNSTNANNSSQEVKQLRLDERAKHYLDNSHEDFQTFINLNKQY 393

Query: 421 DKGYLTGLGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEAQEQKLYLQ 480
               LT   LL+SYK +F TPQS+V+LLI+N+++LYP NS K+KEL++IY AQE+KL  +
Sbjct: 394 AANKLTAAQLLNSYKNLFQTPQSDVHLLIHNLSELYPMNSLKYKELDSIYRAQEKKLSKK 453

Query: 481 NGLP 484
             LP
Sbjct: 454 PQLP 457

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 599 NLPQLPTPKPKVYIPPLRKTTIPDPKQWGGGGQNVPSTDNLPSLPIHHXXXXXXXXXXXX 658
           NLP LPTPKPKVYIPP+R+T IPDP  WG  G    + D L  +  +             
Sbjct: 538 NLPSLPTPKPKVYIPPVRQTVIPDPNSWGRRGPQQTNGDVLEGIS-NLNMNGNSSSQTTR 596

Query: 659 XXXXXXXXXLLFHIGI 674
                    LLFHIGI
Sbjct: 597 GSGKRKQKQLLFHIGI 612

>Sklu_1676.2 YDR266C, Contig c1676 743-2695
          Length = 650

 Score =  442 bits (1137), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 244/641 (38%), Positives = 349/641 (54%), Gaps = 93/641 (14%)

Query: 71  LCLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTENDKLIFTENINANYTD 130
           +C+ICA+   Y +LS C+HTTCHKC+F+QR+LY KK CLICRTEN++LIFT+  +  + D
Sbjct: 66  ICIICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTENEQLIFTDKFDHQFAD 125

Query: 131 SNLGHY-QFNEKYGIVFTSEEVATATLNLLKYTCSVCPANKDGIEREDFGSYKKYNEHLR 189
                + + +E+YGI FTSE V TATL LLKY C         +  +DF S+KKYNEHL+
Sbjct: 126 FTPRDFAKTSEEYGIAFTSEAVYTATLQLLKYNCPF-----GDVADKDFESFKKYNEHLK 180

Query: 190 SKHNKCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGNSEGFKGHPLCAFCSGQRFYGDD 249
           + HNK +C ICA N   FPSEL ++T NQLRNHQS+G+S GFKGHP+C FC+GQRFY DD
Sbjct: 181 TSHNKTICMICANNKKAFPSELKIFTPNQLRNHQSRGDSHGFKGHPMCGFCTGQRFYSDD 240

Query: 250 ELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLDNKFIVFKDE 309
           ELYVHMR++HE+CHICD+ID  +PQYFK+YDQLF+HF+N HY+CTVQTCL++KF+VF+D+
Sbjct: 241 ELYVHMRDRHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQTCLESKFVVFRDD 300

Query: 310 LELQAHILKEHGDLIRGKP-------KLFQSELSTFMSGPSRVVRDRDAMNYDMDXXXXX 362
           ++LQAHILKEH  ++           + FQSELSTF + P+R V +RD  +         
Sbjct: 301 IDLQAHILKEHRTILANDKGNIPVAGRRFQSELSTFSATPARAVHERDTFD--------- 351

Query: 363 XXXXXXXXATPLGTXXXXXXXXXXIPELRQLRLEERAKYYLENSQELYDKFIKCNDEYDK 422
                    +               PE++++R+EERA++YL  SQ  ++ F+  N++Y K
Sbjct: 352 ----TPALRSSSAARSANTTNSNSSPEVKRMRMEERARHYLNYSQPEFEAFLAINEDYRK 407

Query: 423 GYLTGLGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEAQEQKLYLQNG 482
             L+   +  +Y+++F +P ++V LLI + + ++P+NS K K+L AIYEA+++K   Q  
Sbjct: 408 NTLSAEDVFTAYQKLFNSPSADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQKKNNHQIN 467

Query: 483 LPXXXXXXXXXXXXXXXWNNSGSV-----------------AMNRNIRDLPTLEAKSKSF 525
            P                +   S                  A+++ +   P    K  SF
Sbjct: 468 FPSLAPPSSVAAANVIGGSWGRSSSPSSASSSKSSGRYNFPALSKPVNSQPLFTPKKASF 527

Query: 526 DPFATTVKKTPALRTMXXXXXXXXSPSPIAYTPXXXXXXXXXXTVPRLPTTNVSNTVRMG 585
               T V+  P ++                YTP                 T + N     
Sbjct: 528 KSLNTNVRTAPVVKKASANNGTN-------YTP-----------------TYLQNKSTSS 563

Query: 586 SSTNGKNKKLADLNLPQLPTPKPKVYIPPL-RKTTIPDPKQWGGG-----------GQNV 633
            S +  +  +++   P LP  + K +  PL  +  IP+P+QWG             G + 
Sbjct: 564 GSLSSSSASISEEKFPPLPKAQKKKFRAPLVNEPNIPNPQQWGVSSSSLRQEQQQIGSSN 623

Query: 634 PSTDNLPSLPIHHXXXXXXXXXXXXXXXXXXXXXLLFHIGI 674
            STD+L +                          LLFHIGI
Sbjct: 624 ASTDSLST--------------SGKKRGKQKQKQLLFHIGI 650

>AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)
           [1899 bp, 632 aa]
          Length = 632

 Score =  404 bits (1037), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/579 (39%), Positives = 327/579 (56%), Gaps = 79/579 (13%)

Query: 72  CLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTENDKLIFTENINANYTDS 131
           CLICA  L Y +LSPCNHTTCHKC+F+QR+LY KKACL+CRTE++ LIFT+ I A +  +
Sbjct: 67  CLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEYLIFTDQIKAEH--A 124

Query: 132 NLGHYQF---NEKYGIVFTSEEVATATLNLLKYTCSVCPANKDGIEREDFGSYKKYNEHL 188
             G       +++YGI FTS    + TL+LLKY C         +   D  S+K YNEHL
Sbjct: 125 RFGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPY-----GDVPEFDLDSFKNYNEHL 179

Query: 189 RSKHNKCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGNSEGFKGHPLCAFCSGQRFYGD 248
           +++H + +CTICA++   FP+E+   T NQL+ H + G+S+GF GHPLC FCSG+RFY D
Sbjct: 180 KNEHKRSICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSKGFTGHPLCGFCSGKRFYSD 239

Query: 249 DELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLDNKFIVFKD 308
           DELY+HMR +HEKCHICD++D   PQYFKDYDQLF+HFK+ HYIC V++CLD+KF+VF D
Sbjct: 240 DELYIHMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLDSKFVVFAD 299

Query: 309 ELELQAHILKEHGDLIRGKPKL-------FQSELST-FMSGPSRVVRDRDAMNYDMDXXX 360
           +L+LQAH+LKEH +++  K  +       ++SELS+ F    SR V +  + N       
Sbjct: 300 DLDLQAHMLKEHPNIMGNKSTISLTAGRRYRSELSSGFTPNVSRAVHETSSSN------- 352

Query: 361 XXXXXXXXXXATPLGTXXXXXXXXXXIPELRQLRLEERAKYYLENSQELYDKFIKCNDEY 420
                      +P+ T           PE+++ RLEERA++YL  SQ     F + N++Y
Sbjct: 353 ---ALALGPSVSPVATAES--------PEMKRKRLEERARHYLNYSQSEMKLFEQINNDY 401

Query: 421 DKGYLTGLGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEAQEQKLYLQ 480
           +   ++   +   Y ++F  P+++ +LL+ N A  +P+ S K+KELNAIY+A+++K   Q
Sbjct: 402 NNNVISATSVQRRYDQLFRNPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQ 461

Query: 481 NGLPXXXXX-XXXXXXXXXXWNNSGSVAMNRNIRDLPTL-EAKSKSFDPFATTVKKTPAL 538
              P                W  +G    + + R+ P+L  A + S+       KK    
Sbjct: 462 AKFPSLSTNPWYSAPVVGAAWGKNG--GKSSSSRNFPSLSSALTDSYQNVTPQPKK---- 515

Query: 539 RTMXXXXXXXXSPSPIAYTPXXXXXXXXXXTVPRLPTTNVSNTVR--------MGSSTNG 590
                         P+ Y P                +T V NT R        + S T G
Sbjct: 516 --------------PVPYRPTSPVASS---------STQVQNTKRNSNYTPTYLKSKTKG 552

Query: 591 KNKKLADLNL-PQLPTPKPKVY-IPPLRKTTIPDPKQWG 627
           +++  ++  L P L +P  K +  PP+ +  +PDPKQWG
Sbjct: 553 ESRAQSNAALFPPLSSPDTKKFRAPPVNE--LPDPKQWG 589

>Kwal_55.20000
          Length = 617

 Score =  401 bits (1030), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/579 (39%), Positives = 330/579 (56%), Gaps = 75/579 (12%)

Query: 71  LCLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTENDKLIFTENINANYTD 130
           +C+ICA KL Y +LSPCNH TC++C+F+QR+LYNKK+CL+CRTE+D +IF+ + NA + D
Sbjct: 52  ICIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFSADRNAVFDD 111

Query: 131 SNLGH-YQFNEKYGIVFTSEEVATATLNLLKYTCSVCPANKDGIEREDFGSYKKYNEHLR 189
            +  +  + N   G+ FTS++VA+ TL LL Y+C     +  G   E+F   KKYN HL+
Sbjct: 112 FDEKNLVETNVDLGVSFTSQDVASKTLGLLIYSCPF--GDTGGTNHENF---KKYNAHLK 166

Query: 190 SKHNKCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGNSEGFKGHPLCAFCSGQRFYGDD 249
           ++HNK LC ICA +   FPSEL +YT +QLR HQSKG+SEGFKGHP+C FCSGQRFY DD
Sbjct: 167 NEHNKTLCMICASHKKAFPSELRIYTPSQLRIHQSKGDSEGFKGHPMCGFCSGQRFYSDD 226

Query: 250 ELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLDNKFIVFKDE 309
           EL VHMR++HEKCHICD+ + NSPQYFKDYDQLF+HFK  HY+C VQ+CLD+KF+VF+D+
Sbjct: 227 ELNVHMRDRHEKCHICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVFRDD 286

Query: 310 LELQAHILKEHGDLIRG--------KPKLFQSELSTF-----MSGPSRVVRDRDAMNYDM 356
           L+LQAHILKEHG ++R           + +QS+LSTF      S  ++ VRD  A N   
Sbjct: 287 LDLQAHILKEHGGILRNGNNNLSMKGGRKYQSQLSTFSRPPSRSSSTQDVRDNTAKNNSS 346

Query: 357 DXXXXXXXXXXXXXATPLGTXXXXXXXXXXIPELRQLRLEERAKYYLENSQELYDKFIKC 416
           +                               E+++LR+EERA++YL+ S   +++F+  
Sbjct: 347 ENSL----------------------------EVKRLRMEERARHYLKYSHTDFEQFLAI 378

Query: 417 NDEYDKGYLTGLGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEAQEQK 476
           N  Y  G +T   +L +Y+ +F +P++ V LL+ + ++L+P++S   ++L  IY+  ++K
Sbjct: 379 NSSYQNGLITAQDVLSAYEGLFKSPEAQVGLLLYDFSELFPQSSKLHQDLRVIYDTVQKK 438

Query: 477 LYLQNGLPXXXXXXXXXXXXXXXWNNSG-SVAMNRNIR--DLPTLEAKSKSFDPFATTVK 533
                  P                 + G S   N+  R  + P+L+  +    P  T  K
Sbjct: 439 ENRHTNFPSLSALNPTLLPGSVASGSWGRSTGSNKAARQYNFPSLKKPASPQPPIIT--K 496

Query: 534 KTPALRTMXXXXXXXXSPSPIAYTPXXXXXXXXXXTVPRLPTTNVSN---TVRMGSSTNG 590
           K  + +           P                  V R P++N S+   T   G   + 
Sbjct: 497 KPSSTKVNNVQPKAKAVP------------------VTRKPSSNESSFKPTYLDGKQKSA 538

Query: 591 KNKKLADLN-LPQLPTPKPKVYIPPL-RKTTIPDPKQWG 627
            +    D    P LP  + + +  PL  + +IP+P QWG
Sbjct: 539 SSSPALDREKFPPLPKSQARKFRAPLVNEASIPNPSQWG 577

>KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674
           Saccharomyces cerevisiae YDR266c, start by similarity
          Length = 656

 Score =  362 bits (929), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 222/587 (37%), Positives = 313/587 (53%), Gaps = 57/587 (9%)

Query: 71  LCLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTENDKLIFTENINANYTD 130
           +CLICA KL   +LSPCNH TCHKC  +QR+LY KK CL CR+E + +IFT+ I   Y  
Sbjct: 88  VCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVEDIIFTDKIKETYEH 147

Query: 131 -SNLGHYQF-NEKYGIVFTSEEVATATLNLLKYTCSVCPANKDGIEREDFGSYKKYNEHL 188
                  +F NEK GI FTS+ V    +NLLKY      ANKD      FGS+KK NE L
Sbjct: 148 LDKKAKLEFKNEKLGIRFTSKNVMNDAMNLLKYVSPFGDANKD------FGSFKKLNEFL 201

Query: 189 RSKHNKCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGN-SEGFKGHPLCAFCSGQRFYG 247
           R +HNK +C ICA +   FP EL V T  QL+ H+S+G+  +GFKGHP+C FCSG+RFY 
Sbjct: 202 RQEHNKTICMICAGHKKAFPGELKVMTVKQLKIHESRGDPKDGFKGHPMCGFCSGKRFYS 261

Query: 248 DDELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLDNKFIVFK 307
           DDELY HM+  HE+CHICD++D + PQYFK+Y+ LF+HFK+ HY+CTV +CLD KF+VF 
Sbjct: 262 DDELYKHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYVCTVPSCLDAKFVVFS 321

Query: 308 DELELQAHILKEH----GD------LIRGKPKLFQSELSTFMSGPSRVVRDRDAMNYDMD 357
           DEL+L+AHI+KEH    GD      LI    K F+S+++TF S P+R++   DA N + +
Sbjct: 322 DELDLRAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQITTF-SNPTRII---DAQNEESN 377

Query: 358 XXXXXXXXXXXXXATPLGTXXXXXXXXXXIPELRQLRLEERAKYYLENSQELYDKFIKCN 417
                                          ++++ R+E+RA++YL NS+  +  F+  N
Sbjct: 378 SANSR--------------------------DVKRRRMEQRARHYLGNSEPDFQSFLIIN 411

Query: 418 DEYDKGYLTGLGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEA-QEQK 476
           D ++K  ++   L   Y+++F     ++ LLI ++++LY   S K K L AIYE   ++K
Sbjct: 412 DLFNKNEISAQELQSKYEDLFKQHADDIQLLIYDLSELYHSTSDKHKRLRAIYEGIMKKK 471

Query: 477 LYLQNGLPXXXXXXXXXXXXXXXWNNSGSVAMNRNIRDLPTLEAKSKSFDPFATTVKKTP 536
                  P               W    S  +  +     +L A S   +P  ++     
Sbjct: 472 ENAGKFKPLVADSSSSVNVVYGKWGKKSSSGVGGSNVKFTSLPAVS---EPIFSSKASYT 528

Query: 537 ALRTMXXXXXXXXSPSPIAYTPXXXXXXXXXXTVPRLPTTNVSNTVRMGSSTNGKNKKLA 596
            LR          SP   +                +  +   S+TV + S  N    K  
Sbjct: 529 NLR--KNGSSSPSSPVIRSGLTSNSSSSTSLNYAKKNQSPPGSSTVVVNSQPNVTAIKSP 586

Query: 597 D-LNLPQLPTPKPKVYIPPLRKTTIPDPKQWGGGGQNVPSTDNLPSL 642
           +  + P+L   K K   PP+++TTIP+P  W G  QN   + NL SL
Sbjct: 587 NPTSFPKLQATKKKFVAPPVKQTTIPNPSTW-GKPQNDNDSINLDSL 632

>AGR233W [4544] [Homologous to ScYGL221C (NIF3) - SH]
           complement(1185515..1186369) [855 bp, 284 aa]
          Length = 284

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 38/93 (40%)

Query: 172 GIEREDFGSYKKYNEHLRSKHNKCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGNSEGF 231
           G+      + K   +HL      C  +       + P ++ +Y   +L +H+     E  
Sbjct: 181 GVAHVQISTAKAPEDHLIQNVALCAGSGSGVFKGVSPGDVDLYYTGELSHHEILRYREAG 240

Query: 232 KGHPLCAFCSGQRFYGDDELYVHMRNKHEKCHI 264
           K   +C   + +R Y  D +Y H++    +CH+
Sbjct: 241 KAVIVCNHSNTERGYLRDVMYKHIQELGVECHV 273

>KLLA0F06732g complement(649269..649754) highly similar to sp|P40581
           Saccharomyces cerevisiae YIR037w HYR1 glutathione
           peroxidase, start by similarity
          Length = 161

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 438 FTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEAQEQKLYLQNGLP 484
           FT  +  V L++N  +K     +P++KEL A+Y+  E K ++  G P
Sbjct: 19  FTQLEGKVVLIVNVASKC--GFTPQYKELEALYKKYEDKGFIVLGFP 63

>Scas_672.2
          Length = 263

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 4/47 (8%)

Query: 72  CLICASKLVYASLSPCNHTTCHKCSFK----QRSLYNKKACLICRTE 114
           C IC      A ++PC H  C  C F+     R+      C +CR E
Sbjct: 197 CPICMDPPETALIAPCGHVFCCDCLFQMVNSSRTYRKDGHCALCRKE 243

>Kwal_55.19999
          Length = 152

 Score = 29.3 bits (64), Expect = 5.4,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 4/42 (9%)

Query: 72  CLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKA-CLICR 112
           C++C   ++  S +PC H  C KC     S  N++  C +CR
Sbjct: 102 CILCLGFMLDPSCAPCGHVFCWKCLL---SWCNERPECPLCR 140

>Scas_553.3*
          Length = 1025

 Score = 30.0 bits (66), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 7/67 (10%)

Query: 262 CHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTV--QTCLDNKFIVFKDELELQAHILKE 319
           CH+CDK     P     Y    + +   H+ CT+  + C   K  +F+D+L  + H LK 
Sbjct: 99  CHVCDK-----PLRGLYYTAFGNRYDEEHFACTICKEPCGVKKCFMFEDQLYCKYHFLKY 153

Query: 320 HGDLIRG 326
                +G
Sbjct: 154 FSKRCKG 160

>Scas_615.13
          Length = 330

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 2/43 (4%)

Query: 72  CLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTE 114
           C++C + +   S SPC H  C +C         +  C +CR E
Sbjct: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCK--ERPECPLCRQE 320

>Scas_665.1
          Length = 392

 Score = 29.6 bits (65), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 71  LCLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKK--ACLICRTE 114
           +C IC+  +    ++ C H  C+ C     S  +KK  AC  CR++
Sbjct: 29  ICTICSEYMFVPMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSD 74

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,042,443
Number of extensions: 949544
Number of successful extensions: 2596
Number of sequences better than 10.0: 36
Number of HSP's gapped: 2629
Number of HSP's successfully gapped: 42
Length of query: 674
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 566
Effective length of database: 12,857,365
Effective search space: 7277268590
Effective search space used: 7277268590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)