Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_615.1134934917280.0
YDR267C33034412141e-168
CAGL0M08646g33735111941e-165
ACR091W32834410781e-147
Kwal_55.2155935133610521e-143
KLLA0E21879g33334910481e-143
Sklu_1710.12402408581e-115
Kwal_23.53514742862095e-18
KLLA0E23529g8262871761e-13
AER263C5133411742e-13
YCR072C5153241732e-13
CAGL0J03476g5173251705e-13
Scas_631.174741831642e-12
Kwal_56.2452612101301653e-12
AEL246C8153051644e-12
KLLA0C08547g5152981625e-12
Sklu_2173.25153251625e-12
CAGL0I03718g12011331582e-11
KLLA0F04884g12121331563e-11
ADR077C12041791564e-11
YDL145C (COP1)12011331531e-10
Scas_720.955151321521e-10
CAGL0J10340g3382481501e-10
YBL008W (HIR1)8401971493e-10
AGL196C9352601484e-10
Sklu_2160.37602711465e-10
AFL014C5571821456e-10
Scas_630.66211921458e-10
YGL137W (SEC27)8892181441e-09
Scas_624.1112052641432e-09
CAGL0M04279g9402431422e-09
KLLA0F11231g4343311376e-09
AFR199C3341771367e-09
Kwal_47.174658001371369e-09
Kwal_56.239209372431361e-08
CAGL0E02805g8401781361e-08
Scas_674.202972941331e-08
Kwal_23.63245141291351e-08
Scas_702.168161821351e-08
Kwal_27.122393162001321e-08
AGR168W8251981342e-08
AFL118W8322201342e-08
CAGL0H08932g9022201332e-08
YGL100W (SEH1)3492481313e-08
Kwal_26.87764333031313e-08
KLLA0F22000g7932131323e-08
YLR208W (SEC13)2971901293e-08
Kwal_56.245962941691294e-08
Scas_673.114342501304e-08
AFL038C3302541294e-08
KLLA0A04928g8611801314e-08
Scas_679.288151571314e-08
CAGL0M04081g4552311305e-08
KLLA0F06754g3442561295e-08
YPL151C (PRP46)4512911295e-08
KLLA0F10263g6821651306e-08
Scas_713.509832441307e-08
YLR129W (DIP2)9432431297e-08
KLLA0F10791g5451841288e-08
YNL317W (PFS2)4652041279e-08
YNL006W (LST8)3031241261e-07
YFL009W (CDC4)7792081281e-07
YPR178W (PRP4)4652321261e-07
Scas_652.163452051251e-07
YCR084C (TUP1)7131691271e-07
CAGL0J08778g2982971241e-07
Sklu_2431.127492881272e-07
CAGL0E00561g8361651272e-07
Kwal_55.220674511861252e-07
CAGL0L02629g7952191262e-07
Kwal_23.64297501691262e-07
Scas_721.115*3181801242e-07
ACR199C2951251232e-07
Scas_721.328221991252e-07
KLLA0E24508g3271991233e-07
AGL234W6291691243e-07
CAGL0G09845g5002731233e-07
Kwal_27.120537552771234e-07
KLLA0D16390g9361291234e-07
Scas_707.227302161234e-07
Scas_592.4*3181801214e-07
CAGL0I03454g3033041215e-07
KLLA0E12287g3261901215e-07
ACR137W4252911215e-07
Scas_704.406081691216e-07
Scas_720.457551331216e-07
AGR180W8061981217e-07
Scas_629.126711691209e-07
Kwal_23.50357442091209e-07
Sklu_1645.25871801201e-06
Kwal_26.75702181371161e-06
AGR207C3203141181e-06
CAGL0L02761g4192451181e-06
KLLA0C16643g3022091162e-06
AEL269C4551611172e-06
Sklu_2114.211401411182e-06
Sklu_1963.23142051162e-06
Kwal_56.241637291571172e-06
YCR057C (PWP2)9231671172e-06
Scas_720.83d9151671172e-06
Scas_721.73251981152e-06
KLLA0E07073g4522211153e-06
KLLA0B01958g8901871163e-06
Scas_585.84602011153e-06
YMR116C (ASC1)3191811143e-06
Kwal_14.16113341431134e-06
AAR057W9221671154e-06
KLLA0D04840g3031211134e-06
Sklu_2420.24413031145e-06
CAGL0C00737g8161861137e-06
Sklu_2416.54592021128e-06
Scas_695.153272121118e-06
KLLA0F13244g8142381121e-05
Kwal_14.17105741821111e-05
ADL082C5691711111e-05
KLLA0E04741g4592261111e-05
Scas_605.184242481101e-05
KLLA0F27511g6231691111e-05
YLR222C (UTP13)8172231111e-05
CAGL0L00781g6731691102e-05
YBR198C (TAF5)7982311102e-05
ACR097W4672481092e-05
CAGL0C03608g6431891092e-05
CAGL0M05335g8062761092e-05
Kwal_23.62409131671083e-05
CAGL0H03729g3031221063e-05
Kwal_23.57696271701073e-05
AER114W633971074e-05
Sklu_2442.23031241055e-05
CAGL0D02090g2771591036e-05
CAGL0K09284g9111671056e-05
AER448W7141771056e-05
Scas_719.526281451057e-05
CAGL0K00957g7932121048e-05
ADL184W4491861038e-05
YIL046W (MET30)6401691048e-05
Kwal_27.103855361771031e-04
CAGL0F07337g6211811031e-04
AGL024W7561871031e-04
Scas_718.6*5461001021e-04
YBR175W (SWD3)3151971011e-04
CAGL0L09647g429801011e-04
Kwal_27.115858232351022e-04
KLLA0C08976g9111671003e-04
KLLA0E18986g9901451003e-04
CAGL0J04818g65496985e-04
CAGL0L06952g347105965e-04
YOR212W (STE4)423250975e-04
AAL009C303121966e-04
ACR017W423147958e-04
Scas_469.3624181950.001
Kwal_33.15475783220950.001
CAGL0L03201g579132940.001
CAGL0M02277g427184940.001
Scas_680.1134782930.001
CAGL0J06512g545188930.001
Kwal_56.236851102139940.002
CAGL0C01441g1005242940.002
Scas_603.5589203930.002
YDR128W1148141930.002
CAGL0G04345g711267920.002
CAGL0K00275g715226920.003
KLLA0E11297g512295910.003
YGR200C (ELP2)78884910.003
Kwal_33.15591714180910.003
Kwal_27.1258650937900.003
KLLA0D07546g647292910.003
Kwal_56.2389536771900.004
YKR036C (CAF4)659317900.004
Sklu_2317.336871890.004
YPL183C1013241890.006
ADR176W46190880.007
AFL056C976139880.007
Sklu_2172.6263196870.007
CAGL0A00605g640139880.007
KLLA0A08822g582248880.007
KLLA0E03982g37273870.008
Sklu_2364.455561870.008
CAGL0M06193g316201860.008
AER280C510208870.008
Scas_442.2*795203870.009
ACL116W804257870.010
Kwal_26.8628422251860.010
Kwal_33.1513647391860.011
KLLA0D06787g436137860.011
KLLA0F15598g47891860.013
Kwal_26.8975445201860.013
ADR264C34685850.013
KLLA0E21263g429194850.014
Kwal_55.21450503162850.017
Sklu_2406.11426238840.019
Scas_558.3725199840.022
KLLA0E11143g49384840.022
YDR364C (CDC40)45587840.022
Scas_693.36375136830.026
AFL022W371192820.029
Sklu_2318.1711250830.030
CAGL0A02772g441265820.030
KLLA0C07513g43982820.032
CAGL0D05588g47791820.035
YGL116W (CDC20)61078820.036
KLLA0C07425g444135820.037
Scas_571.4601135820.038
YLL011W (SOF1)48991810.041
YOR272W (YTM1)460145810.042
ADL322C501126810.042
AAL157C47991810.042
AER337W44567810.042
CAGL0L10890g457135810.042
YLR429W (CRN1)651204820.043
KLLA0E08415g42285810.046
KLLA0D02530g707198810.048
Kwal_0.21230378800.051
AER255C467216800.054
YDR142C (PEX7)37581800.055
Scas_700.27*43377800.055
Scas_692.2945692800.059
YBR234C (ARC40)384199800.060
Scas_659.947591800.068
KLLA0B14410g706172800.074
Kwal_34.15818349198790.076
KLLA0F13750g620267790.085
CAGL0L04950g80589790.086
Scas_711.1169564790.087
Scas_652.7380135780.090
CAGL0C02937g467210790.092
AFL007C551178780.10
AGL190W37075780.10
Sklu_1926.5509152780.11
YIR012W (SQT1)43164780.12
YMR146C (TIF34)34781770.12
Kwal_47.17567590245770.13
CAGL0K07095g37190770.14
ADR090W1233179780.14
Sklu_675.130885760.15
CAGL0K12188g53585770.17
Sklu_1880.3471131760.20
Kwal_55.20441360134750.23
Scas_658.1442190750.24
Scas_601.238980740.28
YKL021C (MAK11)468160740.30
KLLA0E24354g39288740.31
AGR242C419193740.31
YGL003C (CDH1)566178740.32
Kwal_55.21144570134740.34
Kwal_27.11126996228740.34
KLLA0E19613g572315740.36
Scas_465.41002252740.40
Kwal_26.765574388740.41
CAGL0B00748g81288730.44
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_615.11
         (349 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_615.11                                                           670   0.0  
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...   472   e-168
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...   464   e-165
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....   419   e-147
Kwal_55.21559                                                         409   e-143
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...   408   e-143
Sklu_1710.1 YDR267C, Contig c1710 17-739                              335   e-115
Kwal_23.5351                                                           85   5e-18
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    72   1e-13
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    72   2e-13
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    71   2e-13
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    70   5e-13
Scas_631.17                                                            68   2e-12
Kwal_56.24526                                                          68   3e-12
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    68   4e-12
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    67   5e-12
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            67   5e-12
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    65   2e-11
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    65   3e-11
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    65   4e-11
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    64   1e-10
Scas_720.95                                                            63   1e-10
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    62   1e-10
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    62   3e-10
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    62   4e-10
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         61   5e-10
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    60   6e-10
Scas_630.6                                                             60   8e-10
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    60   1e-09
Scas_624.11                                                            60   2e-09
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    59   2e-09
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    57   6e-09
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    57   7e-09
Kwal_47.17465                                                          57   9e-09
Kwal_56.23920                                                          57   1e-08
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    57   1e-08
Scas_674.20                                                            56   1e-08
Kwal_23.6324                                                           57   1e-08
Scas_702.16                                                            57   1e-08
Kwal_27.12239                                                          55   1e-08
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    56   2e-08
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    56   2e-08
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    56   2e-08
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    55   3e-08
Kwal_26.8776                                                           55   3e-08
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    55   3e-08
YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the C...    54   3e-08
Kwal_56.24596                                                          54   4e-08
Scas_673.11                                                            55   4e-08
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    54   4e-08
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    55   4e-08
Scas_679.28                                                            55   4e-08
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    55   5e-08
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    54   5e-08
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    54   5e-08
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    55   6e-08
Scas_713.50                                                            55   7e-08
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    54   7e-08
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    54   8e-08
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    54   9e-08
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    53   1e-07
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    54   1e-07
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    53   1e-07
Scas_652.16                                                            53   1e-07
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    54   1e-07
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    52   1e-07
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      54   2e-07
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    54   2e-07
Kwal_55.22067                                                          53   2e-07
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    53   2e-07
Kwal_23.6429                                                           53   2e-07
Scas_721.115*                                                          52   2e-07
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    52   2e-07
Scas_721.32                                                            53   2e-07
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    52   3e-07
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    52   3e-07
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    52   3e-07
Kwal_27.12053                                                          52   4e-07
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    52   4e-07
Scas_707.22                                                            52   4e-07
Scas_592.4*                                                            51   4e-07
CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces c...    51   5e-07
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    51   5e-07
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    51   5e-07
Scas_704.40                                                            51   6e-07
Scas_720.45                                                            51   6e-07
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    51   7e-07
Scas_629.12                                                            51   9e-07
Kwal_23.5035                                                           51   9e-07
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          51   1e-06
Kwal_26.7570                                                           49   1e-06
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    50   1e-06
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    50   1e-06
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    49   2e-06
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    50   2e-06
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          50   2e-06
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         49   2e-06
Kwal_56.24163                                                          50   2e-06
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    50   2e-06
Scas_720.83d                                                           50   2e-06
Scas_721.7                                                             49   2e-06
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    49   3e-06
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    49   3e-06
Scas_585.8                                                             49   3e-06
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    49   3e-06
Kwal_14.1611                                                           48   4e-06
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    49   4e-06
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    48   4e-06
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            49   5e-06
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    48   7e-06
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           48   8e-06
Scas_695.15                                                            47   8e-06
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    48   1e-05
Kwal_14.1710                                                           47   1e-05
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    47   1e-05
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    47   1e-05
Scas_605.18                                                            47   1e-05
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    47   1e-05
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    47   1e-05
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    47   2e-05
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    47   2e-05
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    47   2e-05
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    47   2e-05
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    47   2e-05
Kwal_23.6240                                                           46   3e-05
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    45   3e-05
Kwal_23.5769                                                           46   3e-05
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    46   4e-05
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            45   5e-05
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    44   6e-05
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    45   6e-05
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    45   6e-05
Scas_719.52                                                            45   7e-05
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    45   8e-05
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    44   8e-05
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    45   8e-05
Kwal_27.10385                                                          44   1e-04
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    44   1e-04
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    44   1e-04
Scas_718.6*                                                            44   1e-04
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    44   1e-04
CAGL0L09647g 1032740..1034029 highly similar to sp|P35184 Saccha...    44   1e-04
Kwal_27.11585                                                          44   2e-04
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    43   3e-04
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    43   3e-04
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    42   5e-04
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    42   5e-04
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    42   5e-04
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    42   6e-04
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    41   8e-04
Scas_469.3                                                             41   0.001
Kwal_33.15475                                                          41   0.001
CAGL0L03201g complement(366795..368534) some similarities with s...    41   0.001
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    41   0.001
Scas_680.11                                                            40   0.001
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    40   0.001
Kwal_56.23685                                                          41   0.002
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    41   0.002
Scas_603.5                                                             40   0.002
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    40   0.002
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    40   0.002
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    40   0.003
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    40   0.003
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    40   0.003
Kwal_33.15591                                                          40   0.003
Kwal_27.12586                                                          39   0.003
KLLA0D07546g complement(647984..649927) some similarities with s...    40   0.003
Kwal_56.23895                                                          39   0.004
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    39   0.004
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            39   0.004
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    39   0.006
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    39   0.007
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    39   0.007
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       38   0.007
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    39   0.007
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    39   0.007
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    38   0.008
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         38   0.008
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    38   0.008
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    38   0.008
Scas_442.2*                                                            38   0.009
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    38   0.010
Kwal_26.8628                                                           38   0.010
Kwal_33.15136                                                          38   0.011
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    38   0.011
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    38   0.013
Kwal_26.8975                                                           38   0.013
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    37   0.013
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    37   0.014
Kwal_55.21450                                                          37   0.017
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      37   0.019
Scas_558.3                                                             37   0.022
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    37   0.022
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    37   0.022
Scas_693.36                                                            37   0.026
AFL022W [3171] [Homologous to ScYBR234C (ARC40) - SH] complement...    36   0.029
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          37   0.030
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    36   0.030
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    36   0.032
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    36   0.035
YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anapha...    36   0.036
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    36   0.037
Scas_571.4                                                             36   0.038
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    36   0.041
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    36   0.042
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    36   0.042
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    36   0.042
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    36   0.042
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    36   0.042
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    36   0.043
KLLA0E08415g 759718..760986 similar to sp|P53962 Saccharomyces c...    36   0.046
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    36   0.048
Kwal_0.212                                                             35   0.051
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    35   0.054
YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal...    35   0.055
Scas_700.27*                                                           35   0.055
Scas_692.29                                                            35   0.059
YBR234C (ARC40) [413] chr2 complement(685395..686549) Component ...    35   0.060
Scas_659.9                                                             35   0.068
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    35   0.074
Kwal_34.15818                                                          35   0.076
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    35   0.085
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    35   0.086
Scas_711.11                                                            35   0.087
Scas_652.7                                                             35   0.090
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    35   0.092
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    35   0.10 
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    35   0.10 
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         35   0.11 
YIR012W (SQT1) [2677] chr9 (378483..379778) Protein that may be ...    35   0.12 
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    34   0.12 
Kwal_47.17567                                                          34   0.13 
CAGL0K07095g 698028..699143 highly similar to sp|P38328 Saccharo...    34   0.14 
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    35   0.14 
Sklu_675.1 YMR146C, Contig c675 761-1687                               34   0.15 
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    34   0.17 
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            34   0.20 
Kwal_55.20441                                                          33   0.23 
Scas_658.1                                                             33   0.24 
Scas_601.2                                                             33   0.28 
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    33   0.30 
KLLA0E24354g complement(2163651..2164829) similar to sgd|S000602...    33   0.31 
AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH] (1203152..1...    33   0.31 
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    33   0.32 
Kwal_55.21144                                                          33   0.34 
Kwal_27.11126                                                          33   0.34 
KLLA0E19613g complement(1733708..1735426) similar to sp|P21304 S...    33   0.36 
Scas_465.4                                                             33   0.40 
Kwal_26.7655                                                           33   0.41 
CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces cer...    33   0.44 
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    33   0.45 
AAL119W [68] [Homologous to ScYFR021W (AUT10) - SH] complement(1...    33   0.48 
Kwal_56.23035                                                          32   0.54 
Kwal_0.356                                                             32   0.60 
Kwal_33.13515                                                          32   0.61 
YNL035C (YNL035C) [4552] chr14 complement(568520..569689) Protei...    32   0.63 
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    32   0.64 
Kwal_14.1675                                                           32   0.65 
Kwal_47.17572                                                          32   0.68 
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    32   0.73 
CAGL0K03861g complement(359448..360989) highly similar to sp|Q04...    32   0.73 
CAGL0H02937g complement(269645..271477) similar to sp|P40362 Sac...    32   0.75 
Kwal_27.9840                                                           32   0.76 
YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and ...    32   0.77 
CAGL0I07073g complement(681102..682283) similar to sp|Q02793 Sac...    32   0.86 
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    32   0.86 
YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransfer...    32   0.89 
Scas_607.8                                                             32   0.94 
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    32   0.97 
Scas_512.3                                                             32   0.98 
Sklu_2133.4 YBR234C, Contig c2133 6409-7530                            32   0.99 
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         32   1.1  
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    32   1.1  
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    32   1.3  
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         31   1.3  
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    31   1.3  
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    31   1.3  
Scas_670.21                                                            31   1.4  
YMR131C (RRB1) [4088] chr13 complement(533162..534697) Protein i...    31   1.4  
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             31   1.6  
Sklu_2364.5 YAR003W, Contig c2364 9220-10515 reverse complement        31   1.8  
AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH] (168010..16...    31   1.9  
Scas_649.10                                                            31   1.9  
KLLA0D15873g 1334131..1335426 similar to sp|P35184 Saccharomyces...    31   1.9  
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    31   1.9  
Scas_705.2                                                             31   1.9  
Kwal_56.22345                                                          30   2.0  
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    31   2.0  
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    31   2.1  
Scas_692.25                                                            30   2.2  
Scas_719.7*                                                            31   2.2  
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    30   2.3  
Kwal_33.14971                                                          30   2.3  
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    30   2.4  
YPL069C (BTS1) [5373] chr16 complement(422880..423887) Geranylge...    30   2.5  
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    30   2.5  
Scas_684.7                                                             30   2.6  
Scas_617.6                                                             30   2.7  
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    30   2.8  
Scas_715.22                                                            30   3.0  
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    30   3.1  
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    30   3.2  
Kwal_33.13148                                                          30   3.7  
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    30   3.9  
Kwal_26.7738                                                           30   4.1  
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    30   4.2  
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    29   4.5  
Sklu_1048.1 YIR012W, Contig c1048 895-2196                             30   4.5  
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    29   4.7  
Scas_595.3*                                                            29   4.9  
Scas_660.7*                                                            29   4.9  
AGR367C [4678] [Homologous to ScYDR324C - SH] (1408366..1410681)...    29   5.2  
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    29   5.2  
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    29   5.5  
KLLA0C01177g 89978..92131 weakly similar to sp|P25569 Saccharomy...    29   5.5  
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         29   5.6  
CAGL0E01485g complement(138830..142840) similar to tr|Q08281 Sac...    29   5.8  
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    29   6.4  
Kwal_47.17827                                                          29   6.5  
Scas_706.24                                                            29   6.9  
Scas_685.11                                                            29   7.0  
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    29   7.2  
Scas_589.13                                                            29   7.2  
Kwal_47.17555                                                          29   7.4  
Kwal_14.884                                                            28   8.1  
Scas_662.14                                                            28   8.3  
AFR715C [3908] [Homologous to ScYCL039W - SH] (1752847..1754997)...    29   8.6  
YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin int...    28   8.9  
Kwal_26.8953                                                           28   9.1  
Kwal_27.11550                                                          28   9.8  
Kwal_27.12667                                                          28   9.8  

>Scas_615.11
          Length = 349

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/349 (95%), Positives = 334/349 (95%)

Query: 1   MGIKLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHK 60
           MGIKLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHK
Sbjct: 1   MGIKLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHK 60

Query: 61  KAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGH 120
           KAIRCVAWRPHSNLLAAGSFDSTVSIWTR               TTNSLEMDLLAIIEGH
Sbjct: 61  KAIRCVAWRPHSNLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGH 120

Query: 121 ENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELP 180
           ENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELP
Sbjct: 121 ENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELP 180

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
           LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR
Sbjct: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240

Query: 241 VWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDD 300
           VWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDD
Sbjct: 241 VWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDD 300

Query: 301 EHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWNWTD 349
           EHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWNWTD
Sbjct: 301 EHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWNWTD 349

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score =  472 bits (1214), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 231/344 (67%), Positives = 272/344 (79%), Gaps = 22/344 (6%)

Query: 3   IKLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKA 62
           I L KSLKL  +K+WS D+S G+LATGSTDRKIK+++V        +L+DVLD+T HKKA
Sbjct: 4   INLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSV---KYDDFTLIDVLDETAHKKA 60

Query: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHEN 122
           IR VAWRPH++LLAAGSFDSTVSIW +                  + EMDLLAIIEGHEN
Sbjct: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEES------------ADRTFEMDLLAIIEGHEN 108

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182
           EVKG+AWS+DG  L++CSRDKSVWIWETD+ GEEYECISVLQEHSQDVKHV+WHP   LL
Sbjct: 109 EVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALL 168

Query: 183 ASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           ASSSYDDT+R+WKDYDDDWEC AVLNGHEGTVW SDF+K +     RLCSGSDDSTVRVW
Sbjct: 169 ASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEG--VFRLCSGSDDSTVRVW 226

Query: 243 RYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDDEH 302
           +Y+ DDED QQEW+CEAILP VH RQ+Y+V+W  NGLIAS G+DG LAVY+EV       
Sbjct: 227 KYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDG----- 281

Query: 303 DWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWN 346
           +W+V AK+ LCHGVYE N+VKW+++NG  +LATGGDDG VN W+
Sbjct: 282 EWKVFAKRALCHGVYEINVVKWLELNGKTILATGGDDGIVNFWS 325

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 111/234 (47%), Gaps = 38/234 (16%)

Query: 129 WSHDGA--LLSSCSRDKSVWIWETDQDGEEYECISVLQE--HSQDVKHVVWHPELPLLAS 184
           WS D +  +L++ S D+ + +     D  ++  I VL E  H + ++ V W P   LLA+
Sbjct: 18  WSFDFSQGILATGSTDRKIKLVSVKYD--DFTLIDVLDETAHKKAIRSVAWRPHTSLLAA 75

Query: 185 SSYDDTIRLWK-----DYDDDWECAAVLNGHE----GTVWCSDFEKGKNGESIRLCSGSD 235
            S+D T+ +W      D   + +  A++ GHE    G  W +D           L + S 
Sbjct: 76  GSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSND--------GYYLATCSR 127

Query: 236 DSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSW-STNGLIASTGSDGTLAVYKE 294
           D +V +W   + DE G+ E+ C ++L + H + +  V W  +  L+AS+  D T+ ++K 
Sbjct: 128 DKSVWIW---ETDESGE-EYECISVLQE-HSQDVKHVIWHPSEALLASSSYDDTVRIWK- 181

Query: 295 VSNGDDEHDWEVIAKQELCHG-VYEANIVKWIDINGNMMLATGGDDGCVNLWNW 347
               D + DWE +A      G V+ ++  K     G   L +G DD  V +W +
Sbjct: 182 ----DYDDDWECVAVLNGHEGTVWSSDFDK---TEGVFRLCSGSDDSTVRVWKY 228

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score =  464 bits (1194), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 234/351 (66%), Positives = 274/351 (78%), Gaps = 16/351 (4%)

Query: 1   MGIKLAKSLKLQNDKLWSLDYS--HGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTV 58
           M ++LAKSLKL NDK+WS+D+    GLLATGSTDR IK++ + N   G+ +L+DVLDDTV
Sbjct: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKN---GKENLLDVLDDTV 57

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           HKKA+R VAWRPHS+LLAAGSFDST+SIWT+                   LEM+LLAIIE
Sbjct: 58  HKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGA---------KLEMELLAIIE 108

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GHENEVKGI+WS DG LL++CSRDKSVWIWETD+ GEEYECISVLQEHSQDVKHVVWH +
Sbjct: 109 GHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTK 168

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
             LLASSSYDDT+R+WKDYDDDWECAAVL GHEGT+WCSDF K ++   IRLCSGSDDST
Sbjct: 169 HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEED--PIRLCSGSDDST 226

Query: 239 VRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNG 298
           VRVW+YI DDED QQEW+CE+ LP  H  QIY V+WS +G IAS G+DG LAVYKE  N 
Sbjct: 227 VRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQND 286

Query: 299 DDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWNWTD 349
            +  +WE+ A  +  H VYE N VKW++I+G  ML T GDDG VNLWN+ D
Sbjct: 287 SEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNLWNYQD 337

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score =  419 bits (1078), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 214/344 (62%), Positives = 257/344 (74%), Gaps = 25/344 (7%)

Query: 3   IKLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKA 62
           + L +SLKL  D+ WS+D S GLLATGS DRKIK+++V N       L++ LDDT HKKA
Sbjct: 4   LHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRN-----FKLVEELDDTAHKKA 58

Query: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHEN 122
           +R VAWRPH N+LAAGSFD+TVSIW R                  S E +LLA+IEGHEN
Sbjct: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDY-------------SGETELLAVIEGHEN 105

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182
           EVK +AWSHDGA L++CSRDKSVWIWE D+  EE+EC SVLQEHSQDVKH+VWH    LL
Sbjct: 106 EVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLL 165

Query: 183 ASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           ASSSYDDT+R+W + DDDWECAAVL+GH GTVWCSDFE+ + G  IRLCSGSDD+TVR+W
Sbjct: 166 ASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETG--IRLCSGSDDTTVRIW 223

Query: 243 RYIDDDED-GQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDDE 301
           R + DD D   +EWI E +LP VH R +YSVSWS +GLIAS GSDG LAVYKEV  G   
Sbjct: 224 RCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAG--- 280

Query: 302 HDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLW 345
             WEV+A+ +  H VYE N+VKW+ ++G ++L TGGDDGCVN+W
Sbjct: 281 -RWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNVW 323

>Kwal_55.21559
          Length = 351

 Score =  409 bits (1052), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 203/336 (60%), Positives = 255/336 (75%), Gaps = 18/336 (5%)

Query: 12  QNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPH 71
             DKLWS+D S GL+AT S+DRKIK++N+ N       L++ LDD+ HKK++R V++RPH
Sbjct: 32  HTDKLWSIDCSKGLMATSSSDRKIKLVNLKNM---DFQLVEELDDSTHKKSVRSVSFRPH 88

Query: 72  SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSH 131
           S++LAAGSFDST+SIW +                 +  E +LLAIIEGHENEVK ++WSH
Sbjct: 89  SSILAAGSFDSTISIWGKEEDADPQD---------DFPETELLAIIEGHENEVKAVSWSH 139

Query: 132 DGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTI 191
            G  L+SCSRDKSVWIWE D+ GEEYEC+SVLQEH+QDVKHVVWH E+ LLASSSYDDTI
Sbjct: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTI 199

Query: 192 RLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDG 251
           RLWK+  DDWECAAVLNGH+GTVWCSDFEK ++  S+RL S SDDSTVRVW Y++++E+G
Sbjct: 200 RLWKEDADDWECAAVLNGHKGTVWCSDFEKSES--SLRLASCSDDSTVRVWNYVEEEENG 257

Query: 252 QQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQE 311
           +  W  EAILP VH R +YSVSWS +G IAS GSDG L VYKEV  G    +WEV+ +Q 
Sbjct: 258 EDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLVVYKEVKKG----EWEVVVQQH 313

Query: 312 LCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWNW 347
             HG+YE N+VKW  ++ +++L TGGDDGC N+W++
Sbjct: 314 EAHGIYEINVVKWATVDDSVLLLTGGDDGCANIWSF 349

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 93/194 (47%), Gaps = 27/194 (13%)

Query: 166 HSQDVKHVVWHPELPLLASSSYDDTIRLW-----KDYDDDW---ECAAVLNGHEGTVWCS 217
           H + V+ V + P   +LA+ S+D TI +W      D  DD+   E  A++ GHE  V   
Sbjct: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135

Query: 218 DFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSW-ST 276
            +          L S S D +V +W   + DE G+ E+ C ++L + H + +  V W S 
Sbjct: 136 SWSHS----GYYLASCSRDKSVWIW---EADELGE-EYECLSVLQE-HAQDVKHVVWHSE 186

Query: 277 NGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHG-VYEANIVKWIDINGNMMLAT 335
             L+AS+  D T+ ++KE     D  DWE  A      G V+ ++  K      ++ LA+
Sbjct: 187 MHLLASSSYDDTIRLWKE-----DADDWECAAVLNGHKGTVWCSDFEK---SESSLRLAS 238

Query: 336 GGDDGCVNLWNWTD 349
             DD  V +WN+ +
Sbjct: 239 CSDDSTVRVWNYVE 252

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score =  408 bits (1048), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 212/349 (60%), Positives = 259/349 (74%), Gaps = 24/349 (6%)

Query: 2   GIKLAKSLKLQNDKLWSLDYSHG-LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHK 60
           G+KL KSL L +DK WS+D ++G ++ATGSTDRKIK++++ +       +++ LDDT HK
Sbjct: 3   GLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRS-----FQIIEELDDTAHK 57

Query: 61  KAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGH 120
           K +R VAWRPHSN+LAAGSFDSTVSIW +                 N LE +LLAIIEGH
Sbjct: 58  KTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDE---------NDLETELLAIIEGH 108

Query: 121 ENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELP 180
           ENE+K +AWSHDG LL++CSRDKSVWIWE D+ GEE+ECISVLQEHSQDVKHV+WH  LP
Sbjct: 109 ENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLP 168

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
           LLASSSYDDT+R+WKD DDDWEC AVLNGHEGTVW SDFEK  +  ++RLCSGSDD TVR
Sbjct: 169 LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNS--NVRLCSGSDDGTVR 226

Query: 241 VWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDD 300
           +W   DD+ + +QEWI E+ILPK H R +YSV+WS  G IASTGSDG L +YKE  +G  
Sbjct: 227 IWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDG-- 284

Query: 301 EHDWEVIAKQELCHGVYEANIVKWIDINGN--MMLATGGDDGCVNLWNW 347
              W V    EL HGVYE N+VKW++      ++L T GDDG VN+W +
Sbjct: 285 ---WIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVWKF 330

>Sklu_1710.1 YDR267C, Contig c1710 17-739
          Length = 240

 Score =  335 bits (858), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 164/240 (68%), Positives = 198/240 (82%), Gaps = 6/240 (2%)

Query: 107 NSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEH 166
           + +E +LLAI+EGHENEVK ++WSH G  L++CSRDKSVWIWE D+ GEE+ECISVLQEH
Sbjct: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH 64

Query: 167 SQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGE 226
           SQDVKHVVWH  L LLASSSYDDTIR+WKD+DDDW+CAAVLNGHEGTVWCSDFEK ++  
Sbjct: 65  SQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES-- 122

Query: 227 SIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSD 286
           S+RLCSGSDD+TVR+W+YI+D+ED +Q W  +++LP  H R +YSVSWS  GLIASTGSD
Sbjct: 123 SLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSD 182

Query: 287 GTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWN 346
           G LA+Y+E   G     WE+IA+ EL HGVYE N+VKW  I+G  +L TGGDDGCVN+W 
Sbjct: 183 GLLAIYQEKEEG----KWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWK 238

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 113/255 (44%), Gaps = 35/255 (13%)

Query: 1   MGIKLAKSLKLQNDKLWSLDYSHG--LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTV 58
           M  +L   ++   +++ S+ +SH    LAT S D+ + I         +   + VL +  
Sbjct: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGE-EFECISVLQE-- 63

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H + ++ V W    +LLA+ S+D T+ IW                      +    A++ 
Sbjct: 64  HSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDD-----------------DWQCAAVLN 106

Query: 119 GHENEV--KGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQE-----HSQDVK 171
           GHE  V       S     L S S D +V IW+  +D E+ E +  LQ      HS+ V 
Sbjct: 107 GHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVY 166

Query: 172 HVVWHPELPLLASSSYDDTIRLWKDYDD-DWECAAVLNGHEGTVWCSDFEKGK--NGESI 228
            V W P   L+AS+  D  + ++++ ++  WE  A      G V+ ++  K    +GE++
Sbjct: 167 SVSWSP-TGLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHG-VYETNVVKWTQIDGETL 224

Query: 229 RLCSGSDDSTVRVWR 243
            L +G DD  V +W+
Sbjct: 225 -LVTGGDDGCVNIWK 238

 Score = 32.0 bits (71), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 76/200 (38%), Gaps = 71/200 (35%)

Query: 156 EYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK--DYDDDWECAAVLNGH--- 210
           E E +++++ H  +VK V W      LA+ S D ++ +W+  +Y +++EC +VL  H   
Sbjct: 8   ETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67

Query: 211 -EGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQI 269
            +  VW        +     L S S D T+R+W+  DDD      W C A+L        
Sbjct: 68  VKHVVW--------HSVLSLLASSSYDDTIRIWKDFDDD------WQCAAVL-------- 105

Query: 270 YSVSWSTNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDING 329
                         G +GT+                       C    ++          
Sbjct: 106 -------------NGHEGTV----------------------WCSDFEKSE--------S 122

Query: 330 NMMLATGGDDGCVNLWNWTD 349
           ++ L +G DD  V +W + +
Sbjct: 123 SLRLCSGSDDTTVRIWKYIE 142

>Kwal_23.5351
          Length = 474

 Score = 85.1 bits (209), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 82/286 (28%), Positives = 124/286 (43%), Gaps = 49/286 (17%)

Query: 57  TVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAI 116
            V  + +  VA  P    LAAGS++  V I                     SLE+ + ++
Sbjct: 179 VVFSRPVSQVARSPDGASLAAGSWNGDVKILH-----------------PQSLEV-VRSL 220

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
              H++++ G+AWS D  LL++   D  V IW             VL+ H   V  V +H
Sbjct: 221 DGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFH 280

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDD 236
           P    +AS+S+D T RLW D + + E   +  GH   V+C DF+     +   LCS   D
Sbjct: 281 PSDRFVASASFDMTWRLW-DVERETEL-QLQEGHAKEVYCLDFQ----CDGSLLCSAGLD 334

Query: 237 STVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGS-DGTLAVYKEV 295
           S   VW    D   G+   + E      H + IY VSWS NG   +TGS DGT+ V    
Sbjct: 335 SVGHVW----DMRTGRSLMVLEG-----HAKPIYGVSWSPNGHHVATGSGDGTVQV---- 381

Query: 296 SNGDDEHDWEVIAKQELCHGVYEANIVKWIDI---NGNMMLATGGD 338
                   W++    +    +   +IV  ++    NGN ++++  D
Sbjct: 382 --------WDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYD 419

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 96/226 (42%), Gaps = 33/226 (14%)

Query: 17  WSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLA 76
           WS D    LLATG  D  +KI N       + S + VL    H+  +  V + P    +A
Sbjct: 233 WSSDSQ--LLATGGADNLVKIWNPQAQSHSEASRV-VLRG--HEARVSKVKFHPSDRFVA 287

Query: 77  AGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALL 136
           + SFD T  +W                          L + EGH  EV  + +  DG+LL
Sbjct: 288 SASFDMTWRLWDVERETE-------------------LQLQEGHAKEVYCLDFQCDGSLL 328

Query: 137 SSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKD 196
            S   D    +W    D      + VL+ H++ +  V W P    +A+ S D T+++W D
Sbjct: 329 CSAGLDSVGHVW----DMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVW-D 383

Query: 197 YDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
                + +++L  H   V   +FEK +NG    L S S D T+ V+
Sbjct: 384 IRKANKPSSIL-AHNSIVSEVNFEK-ENGNF--LVSSSYDRTIGVF 425

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 78/185 (42%), Gaps = 30/185 (16%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H K + C+ ++   +LL +   DS   +W                 T  SL      ++E
Sbjct: 312 HAKEVYCLDFQCDGSLLCSAGLDSVGHVW--------------DMRTGRSL-----MVLE 352

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH   + G++WS +G  +++ S D +V +W+  +  +    ++    H+  V  V +  E
Sbjct: 353 GHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILA----HNSIVSEVNFEKE 408

Query: 179 LP-LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDS 237
               L SSSYD TI ++      W   A L GH   +   D  +G       L S   D 
Sbjct: 409 NGNFLVSSSYDRTIGVFA--TGSWIKLASLQGHTDKILSVDISRG----GANLWSSGWDR 462

Query: 238 TVRVW 242
           +V++W
Sbjct: 463 SVKIW 467

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 72.4 bits (176), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 121/287 (42%), Gaps = 40/287 (13%)

Query: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHEN 122
           + CV +   + L AAG  DST+ +W                  +NS      A + GH  
Sbjct: 501 MTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNS------ATLVGHSG 554

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182
            V  +A+S D   L S S DK+V +W  D     + C+   + H+  V +V + P     
Sbjct: 555 PVYSVAFSPDNRYLLSASEDKTVRLWSLDT----FTCLVCYKGHNHPVWYVKFSPLGHYF 610

Query: 183 ASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
            ++S+D T RLW    D      + +GH   V CS F    NG    + +GS D T R+W
Sbjct: 611 ITASHDQTARLWS--CDHIYPLRIFSGHLNDVDCSTFH--PNG--CYVFTGSSDKTCRMW 664

Query: 243 RYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGS-DGTLAVYKEVSNGDDE 301
               D + G    +        H   + ++  S +G   +TGS DGT+ V+ ++  G   
Sbjct: 665 ----DIQTGDSVRLFLG-----HTSPVTALEVSPDGRWLTTGSEDGTIIVW-DIGTGKR- 713

Query: 302 HDWEVIAKQELCHGVYEANIVKWIDIN--GNMMLATGGDDGCVNLWN 346
                  KQ   HG    N +  I  N  GN  L TGG D  V +W+
Sbjct: 714 ------IKQMKGHG---KNPIYSITFNKEGN-CLVTGGADQSVRVWD 750

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 93/236 (39%), Gaps = 42/236 (17%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H   +  VA+ P +  L + S D TV +W+                         L   +
Sbjct: 552 HSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDT-------------------FTCLVCYK 592

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH + V  + +S  G    + S D++  +W  D        + +   H  DV    +HP 
Sbjct: 593 GHNHPVWYVKFSPLGHYFITASHDQTARLWSCDH----IYPLRIFSGHLNDVDCSTFHPN 648

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIR-LCSGSDDS 237
              + + S D T R+W     D     +  GH   V     E   +G   R L +GS+D 
Sbjct: 649 GCYVFTGSSDKTCRMWDIQTGD--SVRLFLGHTSPVTA--LEVSPDG---RWLTTGSEDG 701

Query: 238 TVRVWRYIDDDEDGQQEWICEAILPKVHDRQ-IYSVSWSTNG-LIASTGSDGTLAV 291
           T+ VW      + G  + I +    K H +  IYS++++  G  + + G+D ++ V
Sbjct: 702 TIIVW------DIGTGKRIKQM---KGHGKNPIYSITFNKEGNCLVTGGADQSVRV 748

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 91/341 (26%), Positives = 140/341 (41%), Gaps = 73/341 (21%)

Query: 23  HGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTV----HKKAIRCVAWRPH-SNLLAA 77
           H LL  G    +   I +   P+    +  V   +     H   I C A+ PH S+ +  
Sbjct: 101 HSLLGPGLKGTE-DFITLVYTPKAVFKVRPVTRSSSAIAGHGATILCSAFAPHTSSRMVT 159

Query: 78  GSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLS 137
           G+ D+T  IW                   +      L  ++GH N V  +AWS DG +++
Sbjct: 160 GAGDNTARIW-------------------DCDTQTPLCTLKGHSNWVLCVAWSADGEVIA 200

Query: 138 SCSRDKSVWIWETDQDGEEYECIS-VLQEHSQDVKHVVWHP-------ELPLLASSSYDD 189
           + S D ++ +W    D E+ + +   L+ H++ +  + W P       E P LAS+S D 
Sbjct: 201 TGSMDATIRLW----DSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDG 256

Query: 190 TIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDE 249
           TI++W        C   L+GH  +V C  +  G+N     L S S D TVR W   D   
Sbjct: 257 TIKIWDTTRR--VCIYTLSGHTSSVSCIKW-GGRN----VLYSASHDRTVRCW---DMAA 306

Query: 250 DGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSD--GTLAVYKEVSNGDDEHDWEVI 307
            G+    C  IL K H   +  +S ST+  +     D  GT     E +      ++E +
Sbjct: 307 GGK----CINIL-KSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKV 361

Query: 308 AKQELCHGVYEANIVKWIDINGNM--MLATGGDDGCVNLWN 346
           AK+                 NG M  ++ TG DD  + LWN
Sbjct: 362 AKK-----------------NGTMEELMVTGSDDFTMYLWN 385

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (47%), Gaps = 10/128 (7%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           + GH+  V  +A+S DG  + S S D S+ +W    DG + + I+  + H   V  V W 
Sbjct: 396 MTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW----DGRDGKFIATFRGHVASVYQVAWS 451

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDD 236
            +  LL S S D T+++W       +    L GH   V+  D+      +  R+CSG  D
Sbjct: 452 SDCRLLVSCSKDTTLKVWDVKTR--KLTVDLPGHNDEVYTVDWSV----DGKRVCSGGKD 505

Query: 237 STVRVWRY 244
             VR+W +
Sbjct: 506 KMVRLWTH 513

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 72/170 (42%), Gaps = 29/170 (17%)

Query: 25  LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTV 84
           L+ TGS D  + + N     +       +L  T H+K +  VA+ P    + + SFD+++
Sbjct: 371 LMVTGSDDFTMYLWNPLKGSK------PILRMTGHQKLVNHVAFSPDGRYIVSASFDNSI 424

Query: 85  SIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKS 144
            +W                   +  +   +A   GH   V  +AWS D  LL SCS+D +
Sbjct: 425 KLW-------------------DGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTT 465

Query: 145 VWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
           + +W    D +  +    L  H+ +V  V W  +   + S   D  +RLW
Sbjct: 466 LKVW----DVKTRKLTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 73/161 (45%), Gaps = 35/161 (21%)

Query: 135 LLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
           L+ + S D ++++W   +  +    I  +  H + V HV + P+   + S+S+D++I+LW
Sbjct: 371 LMVTGSDDFTMYLWNPLKGSKP---ILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW 427

Query: 195 KDYDDDWECAAVLNGHEGTV----WCSDFEKGKNGESIRLCSGSDDSTVRVW----RYID 246
              D  +   A   GH  +V    W SD           L S S D+T++VW    R + 
Sbjct: 428 DGRDGKF--IATFRGHVASVYQVAWSSDCR--------LLVSCSKDTTLKVWDVKTRKLT 477

Query: 247 DDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSD 286
            D  G             H+ ++Y+V WS +G  + S G D
Sbjct: 478 VDLPG-------------HNDEVYTVDWSVDGKRVCSGGKD 505

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 65/152 (42%), Gaps = 28/152 (18%)

Query: 204 AAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPK 263
           ++ + GH  T+ CS F       S R+ +G+ D+T R+W     D D Q   +C     K
Sbjct: 134 SSAIAGHGATILCSAFAPH---TSSRMVTGAGDNTARIW-----DCDTQTP-LCTL---K 181

Query: 264 VHDRQIYSVSWSTNGLIASTGS-DGTLAVY---KEVSNGD---DEHDWEVIAKQELCHGV 316
            H   +  V+WS +G + +TGS D T+ ++   K  S GD       W      E  H V
Sbjct: 182 GHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLV 241

Query: 317 YEANIVKWIDINGNMMLATGGDDGCVNLWNWT 348
                 +         LA+   DG + +W+ T
Sbjct: 242 KPGEKPR---------LASASKDGTIKIWDTT 264

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 88/324 (27%), Positives = 133/324 (41%), Gaps = 68/324 (20%)

Query: 38  INVTNAPRGQVSLMDVLDDTV----HKKAIRCVAWRPH-SNLLAAGSFDSTVSIWTRXXX 92
           I +   PR    +  V   +     H   I C A+ PH S+ +  G+ D+T  IW     
Sbjct: 117 ITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW----- 171

Query: 93  XXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQ 152
                         +      +  ++GH N V  ++WS DG ++++ S D ++ +W    
Sbjct: 172 --------------DCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLW---- 213

Query: 153 DGEEYECIS-VLQEHSQDVKHVVWHP-------ELPLLASSSYDDTIRLWKDYDDDWECA 204
           D +  +C+   L+ HS+ +  + W P         P LASSS D TI++W        C 
Sbjct: 214 DPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSR--VCQ 271

Query: 205 AVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKV 264
             ++GH  +V C  +     G+ + L SGS D TVRVW   D +  G+    C  IL K 
Sbjct: 272 YTMSGHTNSVSCVKW----GGQGL-LYSGSHDRTVRVW---DINSQGR----CINIL-KS 318

Query: 265 HDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKW 324
           H   +  +S ST+  +     D T         G      E   K+ L       N  K 
Sbjct: 319 HAHWVNHLSLSTDYALRIGAFDHT---------GKKPSTPEEAQKKAL------ENYEKI 363

Query: 325 IDINGNM--MLATGGDDGCVNLWN 346
              NGN   M+ T  DD  + LWN
Sbjct: 364 CKKNGNSEEMMVTASDDYTMFLWN 387

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 66/132 (50%), Gaps = 12/132 (9%)

Query: 114 LAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV 173
           +A + GH+  V  +A+S DG  + S S D S+ +W    DG + + IS  + H   V  V
Sbjct: 395 IARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW----DGRDGKFISTFRGHVASVYQV 450

Query: 174 VWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFE-KGKNGESIRLCS 232
            W  +  LL S S D T+++W       + +  L GH+  V+  D+   GK     R+CS
Sbjct: 451 AWSSDCRLLVSCSKDTTLKVWDVRTR--KLSVDLPGHKDEVYTVDWSVDGK-----RVCS 503

Query: 233 GSDDSTVRVWRY 244
           G  D  VR+W +
Sbjct: 504 GGKDKMVRLWTH 515

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 60/139 (43%), Gaps = 25/139 (17%)

Query: 57  TVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAI 116
           T H+K +  VA+ P    + + SFD+++ +W                   +  +   ++ 
Sbjct: 399 TGHQKLVNHVAFSPDGRYIVSASFDNSIKLW-------------------DGRDGKFIST 439

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISV-LQEHSQDVKHVVW 175
             GH   V  +AWS D  LL SCS+D ++ +W+          +SV L  H  +V  V W
Sbjct: 440 FRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV-----RTRKLSVDLPGHKDEVYTVDW 494

Query: 176 HPELPLLASSSYDDTIRLW 194
             +   + S   D  +RLW
Sbjct: 495 SVDGKRVCSGGKDKMVRLW 513

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 113/278 (40%), Gaps = 73/278 (26%)

Query: 23  HGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNL-----LAA 77
            GLL +GS DR +++ ++ +  R     +++L    H        W  H +L     L  
Sbjct: 289 QGLLYSGSHDRTVRVWDINSQGR----CINILKSHAH--------WVNHLSLSTDYALRI 336

Query: 78  GSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLS 137
           G+FD T                       ++ E      +E +E   K    S +  ++ 
Sbjct: 337 GAFDHT-------------------GKKPSTPEEAQKKALENYEKICKKNGNSEE--MMV 375

Query: 138 SCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDY 197
           + S D ++++W   +  +    I+ +  H + V HV + P+   + S+S+D++I+LW   
Sbjct: 376 TASDDYTMFLWNPLKSTKP---IARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGR 432

Query: 198 DDDWECAAVLNGHEGTV----WCSDFEKGKNGESIRLCSGSDDSTVRVW----RYIDDDE 249
           D  +   +   GH  +V    W SD           L S S D+T++VW    R +  D 
Sbjct: 433 DGKF--ISTFRGHVASVYQVAWSSDCR--------LLVSCSKDTTLKVWDVRTRKLSVDL 482

Query: 250 DGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSD 286
            G             H  ++Y+V WS +G  + S G D
Sbjct: 483 PG-------------HKDEVYTVDWSVDGKRVCSGGKD 507

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 70.1 bits (170), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 87/325 (26%), Positives = 133/325 (40%), Gaps = 68/325 (20%)

Query: 37  IINVTNAPRGQVSLMDVLDDTV----HKKAIRCVAWRPH-SNLLAAGSFDSTVSIWTRXX 91
           II +   PR    +  +   +     H   I C A+ PH S+ +  G  D+T  IW    
Sbjct: 118 IITLDFQPRAVFKVKPITRSSSAIAGHGATILCSAFAPHTSSRVVTGGGDNTARIW---- 173

Query: 92  XXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETD 151
                         T + ++ L     GH N V  ++WS DG ++++ S D ++ +W   
Sbjct: 174 -----------DCDTQTPKVTL----NGHRNWVLCVSWSADGEVIATGSMDNTIRLW--- 215

Query: 152 QDGEEYECIS-VLQEHSQDVKHVVWHP-------ELPLLASSSYDDTIRLWKDYDDDWEC 203
            D E  + +   L+ HS+ +  + W P         P LAS+S D TIR+W        C
Sbjct: 216 -DAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWD--SSRRVC 272

Query: 204 AAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPK 263
              L GH  +V C  +     GE I L SGS D TVR W       D +Q   C  IL K
Sbjct: 273 LMTLGGHTNSVSCVKW----GGEGI-LYSGSHDKTVRAW-------DMKQNGKCINIL-K 319

Query: 264 VHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDDE--HDWEVIAKQELCHGVYEANI 321
            H   +  +S ST+  +     D T           D+   ++E +A++   +G +E   
Sbjct: 320 SHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQNYEKVARK---NGKHEE-- 374

Query: 322 VKWIDINGNMMLATGGDDGCVNLWN 346
                     ++ T  DD  + LWN
Sbjct: 375 ----------LMVTASDDFTMFLWN 389

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 65/131 (49%), Gaps = 10/131 (7%)

Query: 114 LAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV 173
           ++ + GH+  V  +A+S DG  + S S D S+ +W    DG+E   +S  + H   V  V
Sbjct: 397 ISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLW----DGKEGTFLSTFRGHVASVYQV 452

Query: 174 VWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSG 233
            W  +  LL S S D T+++W       + +  L GH+  V+  D+      +  R+CSG
Sbjct: 453 AWSSDCRLLVSCSKDTTLKVWDVKTR--KLSVDLPGHQDEVYTVDWSV----DGKRVCSG 506

Query: 234 SDDSTVRVWRY 244
             D  +R+W +
Sbjct: 507 GKDKMMRLWTH 517

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 61/139 (43%), Gaps = 25/139 (17%)

Query: 57  TVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAI 116
           T H+K +  VA+ P    + + SFD+++ +W                   +  E   L+ 
Sbjct: 401 TGHQKLVNHVAFSPDGKYIVSASFDNSIKLW-------------------DGKEGTFLST 441

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISV-LQEHSQDVKHVVW 175
             GH   V  +AWS D  LL SCS+D ++ +W+      +   +SV L  H  +V  V W
Sbjct: 442 FRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV-----KTRKLSVDLPGHQDEVYTVDW 496

Query: 176 HPELPLLASSSYDDTIRLW 194
             +   + S   D  +RLW
Sbjct: 497 SVDGKRVCSGGKDKMMRLW 515

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 77/167 (46%), Gaps = 35/167 (20%)

Query: 135 LLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
           L+ + S D ++++W   +  +    IS +  H + V HV + P+   + S+S+D++I+LW
Sbjct: 375 LMVTASDDFTMFLWNPLKGTKP---ISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLW 431

Query: 195 KDYDDDWECAAVLNGHEGTV----WCSDFEKGKNGESIRLCSGSDDSTVRVW----RYID 246
              +  +   +   GH  +V    W SD           L S S D+T++VW    R + 
Sbjct: 432 DGKEGTF--LSTFRGHVASVYQVAWSSDCR--------LLVSCSKDTTLKVWDVKTRKLS 481

Query: 247 DDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVY 292
            D  G Q+             ++Y+V WS +G  + S G D  + ++
Sbjct: 482 VDLPGHQD-------------EVYTVDWSVDGKRVCSGGKDKMMRLW 515

>Scas_631.17
          Length = 474

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 91/183 (49%), Gaps = 17/183 (9%)

Query: 111 MDLLAIIE-GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQD 169
           +D+++ IE GH+ ++ G+AW+     L S + D  V I   D D +  + ++ LQ H+  
Sbjct: 218 LDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFDPDVKIIKELTALQGHTGR 277

Query: 170 VKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIR 229
           V +V +HP    +AS+S+D T RLW D + + E      GH   V+   F+     +   
Sbjct: 278 VVNVDFHPSGRFVASASFDMTWRLW-DIESETEL-QFQEGHGKEVYSLSFQN----DGAL 331

Query: 230 LCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGL-IASTGSDGT 288
           LCSG  D+   VW    D   G+     +      H + IYSV WS +G  IA+ G DG 
Sbjct: 332 LCSGGLDNAAIVW----DVRTGKSIMNLQG-----HAKPIYSVDWSPDGYHIATGGGDGV 382

Query: 289 LAV 291
           + +
Sbjct: 383 INI 385

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 104/271 (38%), Gaps = 50/271 (18%)

Query: 25  LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTV 84
           L+   S D  +KII    A +G            H   +  V + P    +A+ SFD T 
Sbjct: 252 LVKIHSFDPDVKIIKELTALQG------------HTGRVVNVDFHPSGRFVASASFDMTW 299

Query: 85  SIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKS 144
            +W                          L   EGH  EV  +++ +DGALL S   D +
Sbjct: 300 RLWDIESETE-------------------LQFQEGHGKEVYSLSFQNDGALLCSGGLDNA 340

Query: 145 VWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECA 204
             +W    D    + I  LQ H++ +  V W P+   +A+   D  I +W D     E  
Sbjct: 341 AIVW----DVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIW-DIRKTTETT 395

Query: 205 AVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKV 264
            +L  H   V    F+K   G  +  C    D  +R++            WI    L + 
Sbjct: 396 RLL-AHNNIVTGVRFQK-STGHCLVSCGY--DKQIRIY--------SSDNWIQVKTL-EG 442

Query: 265 HDRQIYSVSWSTNG-LIASTGSDGTLAVYKE 294
           H  +I  V  S +  LI S+G D +L ++K+
Sbjct: 443 HTDKILDVDISEDAQLIVSSGWDRSLKLWKQ 473

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 77/189 (40%), Gaps = 39/189 (20%)

Query: 8   SLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVA 67
           SL  QND          LL +G  D    + +V    R   S+M++     H K I  V 
Sbjct: 322 SLSFQNDG--------ALLCSGGLDNAAIVWDV----RTGKSIMNLQG---HAKPIYSVD 366

Query: 68  WRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGI 127
           W P    +A G  D  ++IW                 TT +    LLA    H N V G+
Sbjct: 367 WSPDGYHIATGGGDGVINIW-------------DIRKTTETTR--LLA----HNNIVTGV 407

Query: 128 AWSHD-GALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSS 186
            +    G  L SC  DK + I+ +D     +  +  L+ H+  +  V    +  L+ SS 
Sbjct: 408 RFQKSTGHCLVSCGYDKQIRIYSSDN----WIQVKTLEGHTDKILDVDISEDAQLIVSSG 463

Query: 187 YDDTIRLWK 195
           +D +++LWK
Sbjct: 464 WDRSLKLWK 472

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 73/175 (41%), Gaps = 30/175 (17%)

Query: 172 HVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLC 231
           H+V   +  L+   S+D  +++ K+          L GH G V   DF    +G  +   
Sbjct: 243 HLVSGADDCLVKIHSFDPDVKIIKEL-------TALQGHTGRVVNVDFHP--SGRFV--A 291

Query: 232 SGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAV 291
           S S D T R+W    + E   QE          H +++YS+S+  +G +  +G     A+
Sbjct: 292 SASFDMTWRLWDIESETELQFQEG---------HGKEVYSLSFQNDGALLCSGGLDNAAI 342

Query: 292 YKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWN 346
             +V  G       ++  Q     +Y    V W        +ATGG DG +N+W+
Sbjct: 343 VWDVRTGK-----SIMNLQGHAKPIYS---VDWSP--DGYHIATGGGDGVINIWD 387

>Kwal_56.24526
          Length = 1210

 Score = 68.2 bits (165), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 65/130 (50%), Gaps = 10/130 (7%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           LL   E HE  V+GI +     L  S   D ++ +W  D      +C+  L  H   V+ 
Sbjct: 45  LLHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTK----KCLFTLNGHLDYVRT 100

Query: 173 VVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCS 232
           V +H ELP + S+S D TIR+W ++ +  E A  L GH   V C+DF   ++     + S
Sbjct: 101 VFFHRELPWIISASDDQTIRIW-NWQNRKEIAC-LTGHNHFVMCADFHPTED----LVVS 154

Query: 233 GSDDSTVRVW 242
            S D TVRVW
Sbjct: 155 ASLDETVRVW 164

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 85/220 (38%), Gaps = 52/220 (23%)

Query: 26  LATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTVS 85
           + + S D+ I+I N  N  R +++ +     T H   + C  + P  +L+ + S D TV 
Sbjct: 110 IISASDDQTIRIWNWQN--RKEIACL-----TGHNHFVMCADFHPTEDLVVSASLDETVR 162

Query: 86  IWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSV 145
           +W                                   ++ G+   H     S+ + +  +
Sbjct: 163 VW-----------------------------------DISGLRKRHSAP--STYTLEDQI 185

Query: 146 WIWETDQDGEEYECI--SVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK-DYDDDWE 202
              +   DG   +C+   +L+ HS+ V    +HP LPL+ S   D  ++LW+      WE
Sbjct: 186 AAQQNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWE 245

Query: 203 CAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
                 GH   V    F   +N     + S  +D TVRVW
Sbjct: 246 VDTC-RGHTNNVDSVIFHPHQN----LIISVGEDKTVRVW 280

 Score = 35.4 bits (80), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 12/88 (13%)

Query: 158 ECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNG---HEGTV 214
           + ++  +  S   K + +HP  P +  + +  +I+LW     D+    +L+    HEG V
Sbjct: 2   KMLTKFESKSTRAKGLAFHPSRPWVLVALFSSSIQLW-----DYRMGTLLHKFEDHEGPV 56

Query: 215 WCSDFEKGKNGESIRLCSGSDDSTVRVW 242
              DF   +        S  DD T++VW
Sbjct: 57  RGIDFHPTQP----LFVSAGDDYTIKVW 80

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/148 (20%), Positives = 59/148 (39%), Gaps = 23/148 (15%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H + +   ++ P   L+ +G  D  V +W                 +T + E+D      
Sbjct: 208 HSRGVNWASFHPTLPLIVSGGDDRQVKLW--------------RMSSTKAWEVD---TCR 250

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH N V  + +     L+ S   DK+V +W+ D+       +   +  +     V  HP 
Sbjct: 251 GHTNNVDSVIFHPHQNLIISVGEDKTVRVWDLDKRTP----VKQFKRENDRFWLVRAHPN 306

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAV 206
           + L   +++D  I ++K  D +  C+ +
Sbjct: 307 INLFG-AAHDSGIMVFK-LDRERPCSVI 332

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 67.8 bits (164), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 124/305 (40%), Gaps = 42/305 (13%)

Query: 47  QVSLMDVLDDTVHK--KAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXX 104
           Q S   V   T H   + + C+ +   S L+AAG  DS + +W+                
Sbjct: 472 QTSAPSVCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKD 531

Query: 105 TTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQ 164
            +N++       + GH   V  +++S D   L S S DK+V +W  D     Y C+   +
Sbjct: 532 ASNTV------TLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDT----YTCLVSYK 581

Query: 165 EHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKN 224
            H+  V  V + P     A+ S+D T RLW    D      +  GH   V C  F    N
Sbjct: 582 GHNHPVWDVKFSPLGHYFATGSHDQTARLWS--CDHIYPLRIFAGHLNDVDCVTFH--PN 637

Query: 225 GESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTG 284
           G  +   +GS D T R+W    D + G    +        H   + SV+ S +G   +TG
Sbjct: 638 GTYV--LTGSSDKTCRMW----DIQTGDSVRLFLG-----HTASVVSVAVSPDGRWLTTG 686

Query: 285 SDGTLAVYKEVSNGDDEHDWEVIAKQELCHG---VYEANIVKWIDINGNMMLATGGDDGC 341
           S+  + +  ++  G          KQ   HG   VY  +  K     GN +L +GG D  
Sbjct: 687 SEDGVIIVWDIGTGKR-------IKQMRGHGKSAVYSLSFNK----EGN-ILVSGGADQS 734

Query: 342 VNLWN 346
           V +W+
Sbjct: 735 VRVWD 739

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 67.0 bits (162), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 129/298 (43%), Gaps = 62/298 (20%)

Query: 59  HKKAIRCVAWRPH-SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
           H   I C A+ P+ S+ +  G+ D+T  IW                   +      +  +
Sbjct: 142 HGSTILCSAFAPNTSSRMVTGAGDNTACIW-------------------DCDTQTRMCTL 182

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           +GH N V   +WS DG L+++ S D ++ +WE+ + G+ Y     L+ HS+ +  + W P
Sbjct: 183 QGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSK-GKPYG--DALRGHSKWITSLSWEP 239

Query: 178 -------ELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRL 230
                  + P LA++S D TI++W        C   L GH  +V C  +  GKN     L
Sbjct: 240 IHLVKPGDKPRLATASKDGTIKIWDTTRR--VCLLTLCGHTSSVSCVKW-GGKN----VL 292

Query: 231 CSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSD--GT 288
            SGS D T+R W   D + +G+    C  IL K H   +  +S ST+  +     D  G 
Sbjct: 293 YSGSHDKTIRCW---DMNLNGK----CINIL-KSHAHWVNHLSLSTDYALRLGAFDHKGE 344

Query: 289 LAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWN 346
                E +      ++E +AK++   G +E             ++ T  DD  + LWN
Sbjct: 345 TPASPEEAQQKALKNYEKVAKRK---GDFEE------------LMVTASDDFTMYLWN 387

 Score = 60.1 bits (144), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 64/128 (50%), Gaps = 10/128 (7%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           + GH+  V  +A+S DG  + S S D S+ +W    DG + + +S  + H   V  V W 
Sbjct: 398 MTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW----DGRDGKFLSTFRGHVASVYQVAWS 453

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDD 236
            +  LL S S D T+++W       + +  L GH+  V+  D+    + +  R+CSG  D
Sbjct: 454 SDCRLLVSCSKDTTLKVWDVKTR--KLSVDLPGHQDEVYTVDW----SVDGKRVCSGGKD 507

Query: 237 STVRVWRY 244
             VR+W +
Sbjct: 508 KMVRIWTH 515

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 119/297 (40%), Gaps = 64/297 (21%)

Query: 26  LATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTVS 85
           LAT S D  IKI + T     +V L+ +     H  ++ CV W    N+L +GS D T+ 
Sbjct: 251 LATASKDGTIKIWDTTR----RVCLLTLCG---HTSSVSCVKWG-GKNVLYSGSHDKTIR 302

Query: 86  IWTRXXXXXXXXXXXXXXXTTN--SLEMDLLAIIEGHENEVKGIAWSHDGA--------- 134
            W                   N  SL  D    +   +++ +  A   +           
Sbjct: 303 CWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKALKNYEK 362

Query: 135 ----------LLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLAS 184
                     L+ + S D ++++W   +  +    I+ +  H + V HV + P+   + S
Sbjct: 363 VAKRKGDFEELMVTASDDFTMYLWNPLKSTKP---ITRMTGHQKLVNHVAFSPDGRYIVS 419

Query: 185 SSYDDTIRLWKDYDDDWECAAVLNGHEGTV----WCSDFEKGKNGESIRLCSGSDDSTVR 240
           +S+D++I+LW   D  +   +   GH  +V    W SD           L S S D+T++
Sbjct: 420 ASFDNSIKLWDGRDGKF--LSTFRGHVASVYQVAWSSDCR--------LLVSCSKDTTLK 469

Query: 241 VW----RYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVY 292
           VW    R +  D  G Q+             ++Y+V WS +G  + S G D  + ++
Sbjct: 470 VWDVKTRKLSVDLPGHQD-------------EVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 64/153 (41%), Gaps = 30/153 (19%)

Query: 204 AAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPK 263
           ++ + GH  T+ CS F       S R+ +G+ D+T  +W     D D Q   +C     +
Sbjct: 136 SSAIAGHGSTILCSAFAPN---TSSRMVTGAGDNTACIW-----DCDTQTR-MCTL---Q 183

Query: 264 VHDRQIYSVSWSTNGLIASTGS-DGTLAVYKEVSNGDDEHD-------WEVIAKQELCHG 315
            H   +   SWS +G + +TGS D T+ ++ E S G    D       W      E  H 
Sbjct: 184 GHHNWVLCCSWSPDGELIATGSMDNTIRLW-ESSKGKPYGDALRGHSKWITSLSWEPIHL 242

Query: 316 VYEANIVKWIDINGNMMLATGGDDGCVNLWNWT 348
           V   +  +         LAT   DG + +W+ T
Sbjct: 243 VKPGDKPR---------LATASKDGTIKIWDTT 266

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 67.0 bits (162), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 84/325 (25%), Positives = 133/325 (40%), Gaps = 68/325 (20%)

Query: 37  IINVTNAPRGQVSLMDVLDDTV----HKKAIRCVAWRPH-SNLLAAGSFDSTVSIWTRXX 91
            I +   PR    +  V   +     H   I C A+ PH S+ +  G+ D+T  IW    
Sbjct: 116 FITLVYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIW---- 171

Query: 92  XXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETD 151
                          +      ++ ++GH N V  ++WS DG L+++ S D ++ +WE  
Sbjct: 172 ---------------DCNTQTPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWE-- 214

Query: 152 QDGEEYECIS-VLQEHSQDVKHVVWHP-------ELPLLASSSYDDTIRLWKDYDDDWEC 203
             G + + +   L+ H + +  + W P       + P LAS+S D TI++W        C
Sbjct: 215 --GNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRR--VC 270

Query: 204 AAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPK 263
              L+GH  +V C  +     G+ + L SGS D T+R W   D +  G+    C  IL K
Sbjct: 271 LITLSGHTSSVSCIKW----GGQGV-LYSGSHDKTIRAW---DMNLGGK----CINIL-K 317

Query: 264 VHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVK 323
            H   +  +S ST         D  L +      G  +H  E  +  E        N  K
Sbjct: 318 SHAHWVNHLSLST---------DYALRI------GAFDHTSEKPSTPEEAQKRALKNYEK 362

Query: 324 WIDINGNM--MLATGGDDGCVNLWN 346
               NG +  ++ T  DD  + LWN
Sbjct: 363 IAKRNGEVEELMVTASDDFTMYLWN 387

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 64/129 (49%), Gaps = 12/129 (9%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           + GH+  V  +A+S DG  + S S D S+ +W    +G + + IS  + H   V  V W 
Sbjct: 398 MTGHQKLVNHVAFSPDGRHIVSASFDNSIKLW----NGRDGKFISTFRGHVASVYQVAWS 453

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFE-KGKNGESIRLCSGSD 235
            +  LL S S D T+++W       + A  L GH+  V+  D+   GK     R+CSG  
Sbjct: 454 SDCRLLVSCSKDTTLKVWDVKTK--KLAVDLPGHKDEVYTVDWSVDGK-----RVCSGGK 506

Query: 236 DSTVRVWRY 244
           D  VR+W +
Sbjct: 507 DKMVRLWTH 515

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 59/138 (42%), Gaps = 23/138 (16%)

Query: 57  TVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAI 116
           T H+K +  VA+ P    + + SFD+++ +W                   N  +   ++ 
Sbjct: 399 TGHQKLVNHVAFSPDGRHIVSASFDNSIKLW-------------------NGRDGKFIST 439

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
             GH   V  +AWS D  LL SCS+D ++ +W    D +  +    L  H  +V  V W 
Sbjct: 440 FRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW----DVKTKKLAVDLPGHKDEVYTVDWS 495

Query: 177 PELPLLASSSYDDTIRLW 194
            +   + S   D  +RLW
Sbjct: 496 VDGKRVCSGGKDKMVRLW 513

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 75/157 (47%), Gaps = 27/157 (17%)

Query: 135 LLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
           L+ + S D ++++W   +  +    I+ +  H + V HV + P+   + S+S+D++I+LW
Sbjct: 373 LMVTASDDFTMYLWNPLKSTKP---ITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLW 429

Query: 195 KDYDDDWECAAVLNGHEGTV----WCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDED 250
              D  +   +   GH  +V    W SD           L S S D+T++VW       D
Sbjct: 430 NGRDGKF--ISTFRGHVASVYQVAWSSDCR--------LLVSCSKDTTLKVW-------D 472

Query: 251 GQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSD 286
            + + +  A+    H  ++Y+V WS +G  + S G D
Sbjct: 473 VKTKKL--AVDLPGHKDEVYTVDWSVDGKRVCSGGKD 507

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 64/133 (48%), Gaps = 16/133 (12%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           LL   EGHE  V+ + +     +  S   D S+ +W  + +     C+  L  H   V+ 
Sbjct: 45  LLHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETN----RCLYTLTGHLDYVRT 100

Query: 173 VVWHPELPLLASSSYDDTIRLWKDYDDDWECA---AVLNGHEGTVWCSDFEKGKNGESIR 229
           V +H ELP + S+S D T+R+W     +W+     A L GH   V C+ F + ++     
Sbjct: 101 VFFHSELPWVISASDDQTVRIW-----NWQNRKELACLTGHNHFVMCAQFHQTED----L 151

Query: 230 LCSGSDDSTVRVW 242
           + S S D TVRVW
Sbjct: 152 VVSASLDETVRVW 164

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 104/261 (39%), Gaps = 45/261 (17%)

Query: 111 MDLLAIIEGHENEVKGIAW--SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQ 168
           M LL   E      KGIA+  S   AL++  S    +W +        +E       H  
Sbjct: 1   MKLLTKFESKSTRAKGIAFHPSRPWALVALFSSTIQLWDYRMGTLLHRFEG------HEG 54

Query: 169 DVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESI 228
            V+ V +HP  P+  S+  D +I++W    +   C   L GH   V    F    + E  
Sbjct: 55  PVRAVDFHPTQPIFVSAGDDASIKVWSLETN--RCLYTLTGHLDYVRTVFF----HSELP 108

Query: 229 RLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSW-STNGLIASTGSDG 287
            + S SDD TVR+W +       ++E  C       H+  +    +  T  L+ S   D 
Sbjct: 109 WVISASDDQTVRIWNW-----QNRKELACLT----GHNHFVMCAQFHQTEDLVVSASLDE 159

Query: 288 TLAVY-------KEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNM--------- 331
           T+ V+       K  + G   ++  + ++Q L  G +    VK+I + G+          
Sbjct: 160 TVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFI-LEGHTRGVNWASFH 218

Query: 332 ----MLATGGDDGCVNLWNWT 348
               ++ TGGDD  V LW  +
Sbjct: 219 PTLPLIVTGGDDRQVKLWRMS 239

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 64/156 (41%), Gaps = 32/156 (20%)

Query: 114 LAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETD---------------------- 151
           LA + GH + V    +     L+ S S D++V +W+                        
Sbjct: 130 LACLTGHNHFVMCAQFHQTEDLVVSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQ 189

Query: 152 --QDGEEYECI--SVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK-DYDDDWECAAV 206
              DG   +C    +L+ H++ V    +HP LPL+ +   D  ++LW+   +  WE    
Sbjct: 190 NLLDGAFGDCKVKFILEGHTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTC 249

Query: 207 LNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
             GH   V C  F   +N     + S ++D T+R+W
Sbjct: 250 -RGHTNNVDCVVFHPDQN----LILSVAEDKTLRIW 280

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 84/215 (39%), Gaps = 59/215 (27%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDL-LAII 117
           H+  +R V + P   +  +   D+++ +W                    SLE +  L  +
Sbjct: 52  HEGPVRAVDFHPTQPIFVSAGDDASIKVW--------------------SLETNRCLYTL 91

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
            GH + V+ + +  +   + S S D++V IW   Q+ +E  C   L  H+  V    +H 
Sbjct: 92  TGHLDYVRTVFFHSELPWVISASDDQTVRIWNW-QNRKELAC---LTGHNHFVMCAQFHQ 147

Query: 178 ELPLLASSSYDDTIRLW--------------KDYDD--------------DWECAAVLNG 209
              L+ S+S D+T+R+W                Y+D              D +   +L G
Sbjct: 148 TEDLVVSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEG 207

Query: 210 H-EGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWR 243
           H  G  W S      +     + +G DD  V++WR
Sbjct: 208 HTRGVNWAS-----FHPTLPLIVTGGDDRQVKLWR 237

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 27/137 (19%), Positives = 54/137 (39%), Gaps = 22/137 (16%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H + +   ++ P   L+  G  D  V +W                 +  + E+D      
Sbjct: 208 HTRGVNWASFHPTLPLIVTGGDDRQVKLW--------------RMSSNKAWEVD---TCR 250

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH N V  + +  D  L+ S + DK++ IW+ D+       +   +  +     +  HP 
Sbjct: 251 GHTNNVDCVVFHPDQNLILSVAEDKTLRIWDLDKRTP----VKQFKRENDRFWLIRSHPN 306

Query: 179 LPLLASSSYDDTIRLWK 195
           + L   +++D  I ++K
Sbjct: 307 MSLFG-AAHDSGIMIFK 322

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 45/133 (33%), Positives = 64/133 (48%), Gaps = 16/133 (12%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           LL   E HE  V+GI +     L  S   D ++ +W  + +    +C+  L  H   V+ 
Sbjct: 45  LLHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLESN----KCLFTLDGHLDYVRT 100

Query: 173 VVWHPELPLLASSSYDDTIRLWKDYDDDWEC---AAVLNGHEGTVWCSDFEKGKNGESIR 229
           V +H ELP + SSS D TIR+W     +W+     A L GH   V C+ F   ++     
Sbjct: 101 VFFHHELPWIISSSDDQTIRIW-----NWQNRKEIACLTGHNHFVMCAQFHPVED----L 151

Query: 230 LCSGSDDSTVRVW 242
           + S S D TVRVW
Sbjct: 152 VVSASLDETVRVW 164

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 62/265 (23%), Positives = 106/265 (40%), Gaps = 67/265 (25%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMD-LLAII 117
           H+  +R + + P   L  +   D T+ +W                    SLE +  L  +
Sbjct: 52  HEGPVRGIDFHPTQPLFVSAGDDYTIKVW--------------------SLESNKCLFTL 91

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           +GH + V+ + + H+   + S S D+++ IW   Q+ +E  C   L  H+  V    +HP
Sbjct: 92  DGHLDYVRTVFFHHELPWIISSSDDQTIRIWNW-QNRKEIAC---LTGHNHFVMCAQFHP 147

Query: 178 ELPLLASSSYDDTIRLW--------------KDYDDDW------------ECAA--VLNG 209
              L+ S+S D+T+R+W              + +++              +C    +L G
Sbjct: 148 VEDLVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEG 207

Query: 210 H-EGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQ 268
           H  G  W S      +     + SGSDD  V++WR         + W  E    + H   
Sbjct: 208 HTRGVNWAS-----FHPTLPLIVSGSDDRQVKLWRM-----SATKAW--EVDTCRGHTNN 255

Query: 269 IYSVSW-STNGLIASTGSDGTLAVY 292
           + SV +     LI S G D T+ V+
Sbjct: 256 VDSVIFHPQQNLIISVGEDKTVRVW 280

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 50/220 (22%), Positives = 86/220 (39%), Gaps = 52/220 (23%)

Query: 26  LATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTVS 85
           + + S D+ I+I N  N  R +++ +     T H   + C  + P  +L+ + S D TV 
Sbjct: 110 IISSSDDQTIRIWNWQN--RKEIACL-----TGHNHFVMCAQFHPVEDLVVSASLDETVR 162

Query: 86  IWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSV 145
           +W                                   ++ G+   H      + S ++ +
Sbjct: 163 VW-----------------------------------DISGLRKRHSAP--GTQSFEEQM 185

Query: 146 WIWETDQDGEEYECIS--VLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK-DYDDDWE 202
              +   DG   +C+   +L+ H++ V    +HP LPL+ S S D  ++LW+      WE
Sbjct: 186 RQQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWE 245

Query: 203 CAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
                 GH   V    F   +N     + S  +D TVRVW
Sbjct: 246 -VDTCRGHTNNVDSVIFHPQQN----LIISVGEDKTVRVW 280

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 61/261 (23%), Positives = 102/261 (39%), Gaps = 51/261 (19%)

Query: 111 MDLLAIIEGHENEVKGIAW--SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQ 168
           M +L   E      KGIA+  S    L++  S    +W +        +E      +H  
Sbjct: 1   MKMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFE------DHEG 54

Query: 169 DVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESI 228
            V+ + +HP  PL  S+  D TI++W    +  +C   L+GH   V    F      E  
Sbjct: 55  PVRGIDFHPTQPLFVSAGDDYTIKVWSLESN--KCLFTLDGHLDYVRTVFFHH----ELP 108

Query: 229 RLCSGSDDSTVRVWRYIDDDE----DGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTG 284
            + S SDD T+R+W + +  E     G   ++  A    V D            L+ S  
Sbjct: 109 WIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVED------------LVVSAS 156

Query: 285 SDGTLAVY-------KEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNM------ 331
            D T+ V+       +  + G    + ++  +Q L  G +   +VK+I + G+       
Sbjct: 157 LDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFI-LEGHTRGVNWA 215

Query: 332 -------MLATGGDDGCVNLW 345
                  ++ +G DD  V LW
Sbjct: 216 SFHPTLPLIVSGSDDRQVKLW 236

 Score = 35.0 bits (79), Expect = 0.11,   Method: Composition-based stats.
 Identities = 31/137 (22%), Positives = 54/137 (39%), Gaps = 22/137 (16%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H + +   ++ P   L+ +GS D  V +W                  T + E+D      
Sbjct: 208 HTRGVNWASFHPTLPLIVSGSDDRQVKLWR--------------MSATKAWEVD---TCR 250

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH N V  + +     L+ S   DK+V +W+ D+       I   +  +     V  HP 
Sbjct: 251 GHTNNVDSVIFHPQQNLIISVGEDKTVRVWDLDKRTP----IKQFKRENDRFWLVRAHPN 306

Query: 179 LPLLASSSYDDTIRLWK 195
           L L   +++D  I ++K
Sbjct: 307 LNLFG-AAHDSGIMIFK 322

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 64.7 bits (156), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 49/179 (27%), Positives = 76/179 (42%), Gaps = 29/179 (16%)

Query: 64  RCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENE 123
           + +A+ P    +    F ST+ +W                         LL   E HE  
Sbjct: 15  KAIAFHPSRPWVLVALFSSTIQLWDYRMGV-------------------LLHRFEEHEGP 55

Query: 124 VKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLA 183
           V+G+ +     L  S   D S+ +W        ++C+  L  H   V+ V +H ELP + 
Sbjct: 56  VRGVDFHPTQPLFVSAGDDYSIKVWSLST----HKCLFTLNGHLDYVRTVFFHTELPWII 111

Query: 184 SSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           S+S D TIR+W ++ +  E A  L GH   V C+ F   ++     + S S D TVR+W
Sbjct: 112 SASDDQTIRIW-NWQNRREIAC-LTGHNHFVMCAQFHPTED----LVVSASLDETVRIW 164

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 52/220 (23%), Positives = 87/220 (39%), Gaps = 52/220 (23%)

Query: 26  LATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTVS 85
           + + S D+ I+I N  N  R +++ +     T H   + C  + P  +L+ + S D TV 
Sbjct: 110 IISASDDQTIRIWNWQN--RREIACL-----TGHNHFVMCAQFHPTEDLVVSASLDETVR 162

Query: 86  IWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSV 145
           IW                                   ++ G+   H      S S ++ +
Sbjct: 163 IW-----------------------------------DISGLRKRHSAP--GSQSFEEQM 185

Query: 146 WIWETDQDGEEYECIS--VLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK-DYDDDWE 202
              +   DG   +C+   +L+ H++ V    +HP LPL+ S S D  ++LW+      WE
Sbjct: 186 ITQQNLFDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWE 245

Query: 203 CAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
                 GH   V    F   +N     + S  +DST+RVW
Sbjct: 246 -VDTCRGHTNNVDSVIFHPFQN----LIISVGEDSTIRVW 280

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 62/262 (23%), Positives = 101/262 (38%), Gaps = 53/262 (20%)

Query: 111 MDLLAIIEGHENEVKGIAW--SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQ 168
           M +L   E      K IA+  S    L++  S    +W +        +E      EH  
Sbjct: 1   MKMLTKFESKSTRAKAIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFE------EHEG 54

Query: 169 DVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESI 228
            V+ V +HP  PL  S+  D +I++W       +C   LNGH   V    F      E  
Sbjct: 55  PVRGVDFHPTQPLFVSAGDDYSIKVWSL--STHKCLFTLNGHLDYVRTVFFHT----ELP 108

Query: 229 RLCSGSDDSTVRVWRYIDDDE----DGQQEWI-CEAILPKVHDRQIYSVSWSTNGLIAST 283
            + S SDD T+R+W + +  E     G   ++ C    P             T  L+ S 
Sbjct: 109 WIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHP-------------TEDLVVSA 155

Query: 284 GSDGTLAVY-------KEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNM----- 331
             D T+ ++       +  + G    + ++I +Q L  G +   +VK+I + G+      
Sbjct: 156 SLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVVKFI-LEGHTRGVNW 214

Query: 332 --------MLATGGDDGCVNLW 345
                   ++ +G DD  V LW
Sbjct: 215 ASFHPTLPLIVSGSDDRQVKLW 236

 Score = 31.2 bits (69), Expect = 1.6,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 38/94 (40%), Gaps = 17/94 (18%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H + +   ++ P   L+ +GS D  V +W                 +T + E+D      
Sbjct: 208 HTRGVNWASFHPTLPLIVSGSDDRQVKLWR--------------MSSTKAWEVD---TCR 250

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQ 152
           GH N V  + +     L+ S   D ++ +W+ D+
Sbjct: 251 GHTNNVDSVIFHPFQNLIISVGEDSTIRVWDLDK 284

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 41/133 (30%), Positives = 63/133 (47%), Gaps = 16/133 (12%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           LL   E HE  V+G+ +     +  S   D ++ +W  D +    +C+  L  H   V+ 
Sbjct: 45  LLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTN----KCLYTLTGHLDYVRT 100

Query: 173 VVWHPELPLLASSSYDDTIRLWKDYDDDWEC---AAVLNGHEGTVWCSDFEKGKNGESIR 229
           V +H ELP + S+S D TIR+W     +W+     A L GH   V C+ F    +     
Sbjct: 101 VFFHRELPWIISASDDQTIRIW-----NWQNRKEIACLTGHNHFVMCAQFHPTDD----L 151

Query: 230 LCSGSDDSTVRVW 242
           + S S D T+R+W
Sbjct: 152 IVSASLDETIRIW 164

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 51/220 (23%), Positives = 84/220 (38%), Gaps = 52/220 (23%)

Query: 26  LATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTVS 85
           + + S D+ I+I N  N  R +++ +     T H   + C  + P  +L+ + S D T+ 
Sbjct: 110 IISASDDQTIRIWNWQN--RKEIACL-----TGHNHFVMCAQFHPTDDLIVSASLDETIR 162

Query: 86  IWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSV 145
           IW                                   ++ G+   H     SS     S 
Sbjct: 163 IW-----------------------------------DISGLRKRHSAPGTSSFEEQMSA 187

Query: 146 WIWETDQDGEEYECIS--VLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK-DYDDDWE 202
              +   DG   +C+   +L+ H++ V    +HP LPL+ S S D  ++LW+      WE
Sbjct: 188 Q--QNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWE 245

Query: 203 CAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
                 GH   V    F   +N     + S  +D T+RVW
Sbjct: 246 -VDTCRGHTNNVDSVIFHPHQN----LIISVGEDKTLRVW 280

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 62/262 (23%), Positives = 103/262 (39%), Gaps = 53/262 (20%)

Query: 111 MDLLAIIEGHENEVKGIAW--SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQ 168
           M +L   E      KGIA+  S    L++  S    +W +        +E      +H  
Sbjct: 1   MKMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFE------DHEG 54

Query: 169 DVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESI 228
            V+ + +HP  P+  S+  D TI++W    D  +C   L GH   V    F +    E  
Sbjct: 55  PVRGLDFHPTQPIFVSAGDDYTIKVWSL--DTNKCLYTLTGHLDYVRTVFFHR----ELP 108

Query: 229 RLCSGSDDSTVRVWRYIDDDE----DGQQEWI-CEAILPKVHDRQIYSVSWSTNGLIAST 283
            + S SDD T+R+W + +  E     G   ++ C    P             T+ LI S 
Sbjct: 109 WIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHP-------------TDDLIVSA 155

Query: 284 GSDGTLAVY-------KEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNM----- 331
             D T+ ++       +  + G    + ++ A+Q L  G     +VK+I + G+      
Sbjct: 156 SLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFI-LEGHTRGVNW 214

Query: 332 --------MLATGGDDGCVNLW 345
                   ++ +G DD  V LW
Sbjct: 215 ASFHPTLPLIVSGSDDRQVKLW 236

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 60/259 (23%), Positives = 102/259 (39%), Gaps = 55/259 (21%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H+  +R + + P   +  +   D T+ +W+                 TN      L  + 
Sbjct: 52  HEGPVRGLDFHPTQPIFVSAGDDYTIKVWS---------------LDTNKC----LYTLT 92

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH + V+ + +  +   + S S D+++ IW   Q+ +E  C   L  H+  V    +HP 
Sbjct: 93  GHLDYVRTVFFHRELPWIISASDDQTIRIWNW-QNRKEIAC---LTGHNHFVMCAQFHPT 148

Query: 179 LPLLASSSYDDTIRLW--------------KDYDDDWECAA-VLNGHEG----TVWCSDF 219
             L+ S+S D+TIR+W                +++       +L+G  G           
Sbjct: 149 DDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGH 208

Query: 220 EKGKNGESIR-----LCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSW 274
            +G N  S       + SGSDD  V++WR         + W  E    + H   + SV +
Sbjct: 209 TRGVNWASFHPTLPLIVSGSDDRQVKLWRM-----SATKAW--EVDTCRGHTNNVDSVIF 261

Query: 275 STN-GLIASTGSDGTLAVY 292
             +  LI S G D TL V+
Sbjct: 262 HPHQNLIISVGEDKTLRVW 280

 Score = 33.1 bits (74), Expect = 0.41,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 88/220 (40%), Gaps = 49/220 (22%)

Query: 25  LLATGSTDRKIKIINVT------NAP---------RGQVSLMD-VLDDTV-------HKK 61
           L+ + S D  I+I +++      +AP           Q +L+D  L D V       H +
Sbjct: 151 LIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTR 210

Query: 62  AIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHE 121
            +   ++ P   L+ +GS D  V +W                  T + E+D      GH 
Sbjct: 211 GVNWASFHPTLPLIVSGSDDRQVKLWR--------------MSATKAWEVD---TCRGHT 253

Query: 122 NEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPL 181
           N V  + +     L+ S   DK++ +W+ D+       +   +  +     +  HP + L
Sbjct: 254 NNVDSVIFHPHQNLIISVGEDKTLRVWDLDKRTP----VKQFKRENDRFWLIAAHPHINL 309

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEK 221
              +++D  I ++K  D +  C+ +   H+  ++  + EK
Sbjct: 310 FG-AAHDSGIMVFK-LDRERPCSFI---HQNQLFFVNAEK 344

>Scas_720.95
          Length = 515

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 66/132 (50%), Gaps = 12/132 (9%)

Query: 114 LAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV 173
           +A + GH+  V  +A+S DG  + S S D S+ +W    DG + + IS  + H   V  V
Sbjct: 395 IARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW----DGRDGKFISTFRGHVASVYQV 450

Query: 174 VWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFE-KGKNGESIRLCS 232
            W  +  LL S S D T+++W       + +  L GH+  V+  D+   GK     R+CS
Sbjct: 451 AWSADCRLLVSCSKDTTLKVWDVRTR--KLSVDLPGHKDEVYTVDWSVDGK-----RVCS 503

Query: 233 GSDDSTVRVWRY 244
           G  D  VR+W +
Sbjct: 504 GGKDKMVRIWTH 515

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 90/372 (24%), Positives = 144/372 (38%), Gaps = 107/372 (28%)

Query: 25  LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRP-------HSNLLAA 77
           ++ATGS D  I++ +  +       L D L    H K I  +AW P        S  LA+
Sbjct: 200 VIATGSMDNTIRLWDSKDGK----PLGDALRG--HLKWITSLAWEPIHLVKPGESPRLAS 253

Query: 78  GSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLS 137
            S D T+ IW                   +      L  + GH N V  I WS  G ++ 
Sbjct: 254 ASKDGTIRIW-------------------DITRRVCLYTMSGHTNSVSCIKWSGQG-IIY 293

Query: 138 SCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELP----------------- 180
           S S DK+V +W+ + DG+   CI++L+ H+  V H+    +                   
Sbjct: 294 SGSHDKTVRVWDMNADGK---CINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAK 350

Query: 181 ----------------------LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSD 218
                                 L+ ++S D T+ LW     + +  A + GH+  V    
Sbjct: 351 DARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSN-KPIARMTGHQKLVNHVA 409

Query: 219 FEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTN- 277
           F    +G  I   S S D+++++W    D  DG+  +I      + H   +Y V+WS + 
Sbjct: 410 FS--PDGRYI--VSASFDNSIKLW----DGRDGK--FISTF---RGHVASVYQVAWSADC 456

Query: 278 GLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQ---ELCHGVYEANIVKWIDINGNMMLA 334
            L+ S   D TL V            W+V  ++   +L     E   V W  ++G   + 
Sbjct: 457 RLLVSCSKDTTLKV------------WDVRTRKLSVDLPGHKDEVYTVDW-SVDGK-RVC 502

Query: 335 TGGDDGCVNLWN 346
           +GG D  V +W 
Sbjct: 503 SGGKDKMVRIWT 514

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 81/186 (43%), Gaps = 18/186 (9%)

Query: 117 IEGHENEVKGIAWSHD-GALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW 175
           I GH + +   A++ +  + + + + D +  IW+ D    +    + L  H   V  V +
Sbjct: 139 IAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCDTQTPK----ATLTGHFNWVLCVSY 194

Query: 176 HPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEK---GKNGESIRLCS 232
            P   ++A+ S D+TIRLW D  D       L GH   +    +E     K GES RL S
Sbjct: 195 CPNGEVIATGSMDNTIRLW-DSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLAS 253

Query: 233 GSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVY 292
            S D T+R+W             +C   +   H   +  + WS  G+I S   D T+ V+
Sbjct: 254 ASKDGTIRIWDI--------TRRVCLYTM-SGHTNSVSCIKWSGQGIIYSGSHDKTVRVW 304

Query: 293 KEVSNG 298
              ++G
Sbjct: 305 DMNADG 310

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 83/194 (42%), Gaps = 42/194 (21%)

Query: 26  LATGSTDRKIKIINV-TNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTV 84
           + TG+ D   +I +  T  P+  +        T H   + CV++ P+  ++A GS D+T+
Sbjct: 159 MVTGAGDNTARIWDCDTQTPKATL--------TGHFNWVLCVSYCPNGEVIATGSMDNTI 210

Query: 85  SIWTRXXXXXXXXXXXXXXXTTNSLEMDLLA-IIEGHENEVKGIAWSH-------DGALL 136
            +W                   +S +   L   + GH   +  +AW         +   L
Sbjct: 211 RLW-------------------DSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRL 251

Query: 137 SSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKD 196
           +S S+D ++ IW    D     C+  +  H+  V  + W  +  ++ S S+D T+R+W D
Sbjct: 252 ASASKDGTIRIW----DITRRVCLYTMSGHTNSVSCIKWSGQ-GIIYSGSHDKTVRVW-D 305

Query: 197 YDDDWECAAVLNGH 210
            + D +C  +L  H
Sbjct: 306 MNADGKCINILKSH 319

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/248 (22%), Positives = 108/248 (43%), Gaps = 24/248 (9%)

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW-HP 177
           GHE+ V  +A+   G  +++CS D+ + +++ D+D   +E     + H   +  + W  P
Sbjct: 7   GHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATRWEVNDSWRAHDSSIVSLDWASP 66

Query: 178 EL-PLLASSSYDDTIRLWKDYDDDWECAA-------VLNGHEGTVWCSDFEKGKNGESIR 229
           E   ++AS+SYD TI++W++  +  EC+         LN  +G+++C  F     G  +R
Sbjct: 67  EYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLCTLNDSKGSLYCVKFAPSHLG--LR 124

Query: 230 LCSGSDDSTVRVWRYIDDDEDGQQEWICEA------ILPKVHDRQIYSVSWSTNGLIAST 283
           + S  +D  +R++  +  D    + W   A      + P  + +  + +SW         
Sbjct: 125 IASIGNDGIMRMYDAL--DPSNLRSWTMTAEVKVLPVAPANNLQSAFGLSWCFTRFSPEK 182

Query: 284 GSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNM--MLATGGDDGC 341
            +   L        G D H ++     +L         + W  + G    ++ATG  DG 
Sbjct: 183 IAVCALDQAYIYQRGKDGHFYQA---GKLPGHTSLIRSISWAPLIGRPYHLIATGCKDGR 239

Query: 342 VNLWNWTD 349
           V ++   D
Sbjct: 240 VRIFRVND 247

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 54/130 (41%), Gaps = 20/130 (15%)

Query: 59  HKKAIRCVAWRP----HSNLLAAGSFDSTVSIWTRXXXXXXXXXXX-------------- 100
           H   IR ++W P      +L+A G  D  V I+                           
Sbjct: 211 HTSLIRSISWAPLIGRPYHLIATGCKDGRVRIFRVNDSPSKSNTPNLSDSDDYNMEDQGI 270

Query: 101 XXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECI 160
                   LE++LL+  + H+ EV  ++W+  G +LSS   D  V +W++     EY+C+
Sbjct: 271 KQRQNNTDLEVELLSEHDDHKGEVWSVSWNLTGTILSSTGEDGKVRLWKSTY-SNEYKCM 329

Query: 161 SVLQEHSQDV 170
           S++    QD+
Sbjct: 330 SIITS-KQDI 338

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 156 EYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKD-YDDDWECAAVLNGHE 211
           E E +S   +H  +V  V W+    +L+S+  D  +RLWK  Y ++++C +++   +
Sbjct: 280 EVELLSEHDDHKGEVWSVSWNLTGTILSSTGEDGKVRLWKSTYSNEYKCMSIITSKQ 336

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 89/197 (45%), Gaps = 24/197 (12%)

Query: 15  KLWSLDYSH--GLLATGSTDRKIKIINV-------------TNAPRGQVSLMDVLDDTVH 59
           +++++D SH    LATG  D KI+I ++                P  Q   M +   + H
Sbjct: 19  EIYTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPLCSMSRH 78

Query: 60  KKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTN-SLEMDLLAIIE 118
             +I CV + P    LA+GS D  + IW                   + ++   L+A   
Sbjct: 79  TGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVA--- 135

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
            H+N+++ I W+ D ++L +   D+SV +W    +G  +E +     H   VK VV+ P 
Sbjct: 136 -HDNDIQDICWAPDSSILVTVGLDRSVIVW----NGSTFEKLKRFDVHQSLVKGVVFDPA 190

Query: 179 LPLLASSSYDDTIRLWK 195
               A++S D T+++++
Sbjct: 191 NKYFATTSDDRTMKIFR 207

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 91/242 (37%), Gaps = 59/242 (24%)

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           E  + E+  +  SHDG  L++   D  + IW  D      E  S+              P
Sbjct: 14  ESRKYEIYTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLT-------------P 60

Query: 178 ELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEK-GKNGESIRLCSGSDD 236
           E+PL      D  + L         C+  ++ H G++ C  F   GK      L SGSDD
Sbjct: 61  EIPL----PQDLQMPL---------CS--MSRHTGSITCVKFSPDGK-----YLASGSDD 100

Query: 237 STVRVWRYIDDDEDGQ---------QEWICEAILPKVHDRQIYSVSWSTN-GLIASTGSD 286
             + +W  +D+++  Q         + W     L   HD  I  + W+ +  ++ + G D
Sbjct: 101 RILLIW-ALDEEQSSQPAFGSEHEREHWTVRKRL-VAHDNDIQDICWAPDSSILVTVGLD 158

Query: 287 GTLAVYKEVSNGDDEHDWEVI-AKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLW 345
            ++ V+    NG      +     Q L  GV        +    N   AT  DD  + ++
Sbjct: 159 RSVIVW----NGSTFEKLKRFDVHQSLVKGV--------VFDPANKYFATTSDDRTMKIF 206

Query: 346 NW 347
            +
Sbjct: 207 RY 208

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/108 (21%), Positives = 43/108 (39%), Gaps = 23/108 (21%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H   I+ + W P S++L     D +V +W                   N    + L   +
Sbjct: 136 HDNDIQDICWAPDSSILVTVGLDRSVIVW-------------------NGSTFEKLKRFD 176

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEH 166
            H++ VKG+ +       ++ S D+++ I+   + G+    IS   EH
Sbjct: 177 VHQSLVKGVVFDPANKYFATTSDDRTMKIFRYHKTGD----ISFTIEH 220

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 105/260 (40%), Gaps = 46/260 (17%)

Query: 5   LAKSLKLQNDK------LWSLDYSH--GLLATGSTDRKIKIIN-------VTNAPRGQVS 49
           LA S  L+N +      +WSLD +     L T S D+ +K  +       V       V 
Sbjct: 453 LASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVP 512

Query: 50  LMDVLDDTVHK--KAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTN 107
            M ++ DT     + + CV   P    LA    D+TV ++                    
Sbjct: 513 KMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLD----------------- 555

Query: 108 SLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHS 167
              M     + GH+  V  +  SHD  L+ + S DK++ IW  D      +C   L  H 
Sbjct: 556 --SMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFG----DCHKSLFAHQ 609

Query: 168 QDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGES 227
             + +V + PE     S S D T++ W    + ++C   L GH+G VW        +G++
Sbjct: 610 DSIMNVKFLPESHNFFSCSKDGTVKYWD--GNSFDCIQKLYGHQGEVWA--LAVSSDGQA 665

Query: 228 IRLCSGSDDSTVRVWRYIDD 247
           +   S S D ++RVW   +D
Sbjct: 666 V--VSVSHDRSIRVWEETED 683

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 12/99 (12%)

Query: 147 IWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAV 206
           + +T +DG     I    E   +  ++ +H E  +LA    D TI++W     D +   V
Sbjct: 55  LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW-----DMQTQTV 109

Query: 207 L---NGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           L   + H   +    F++       RL SGS D+T+ +W
Sbjct: 110 LIVFHSHSSAITILRFDQ----TGTRLISGSRDATIILW 144

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 101/271 (37%), Gaps = 56/271 (20%)

Query: 59  HKKAIRCVAWRPH-SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
           H+  + CVA+ P   N  A+   D TV IW+                  N ++   L   
Sbjct: 21  HEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPL--- 77

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
                         D   L + S D+SV IW    D +   C++ L+ H  +V + ++HP
Sbjct: 78  -------------QDKPYLITSSDDRSVKIW----DYQTKSCVATLEGHMANVSYAIFHP 120

Query: 178 ELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWC-------------SDFEKGKN 224
            LP++ S S D T+++W    + ++    LN      WC             S F+ G N
Sbjct: 121 SLPIIISGSEDGTVKIWN--ANTYKLEKTLNLGLERSWCVAAHPTGKRNYVASGFDNGFN 178

Query: 225 GESI-----RL----------CSGSD----DSTVRVWRYIDDDEDGQQEWICEAILPKVH 265
             S+     RL          C G +    D    V R  +  EDG+   +    L  V 
Sbjct: 179 VLSMGNDEPRLSLDPVGKLVWCGGKNAVATDVFTAVIRGTEQVEDGETIPLQTKELGTV- 237

Query: 266 DRQIYSVSWSTNGLIASTGSDGTLAVYKEVS 296
           D    S+  S NG   +   DG   VY  ++
Sbjct: 238 DVYPQSLKHSPNGRFVTVTGDGEYIVYTALA 268

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 83/182 (45%), Gaps = 19/182 (10%)

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           E H +EV GI +  DG  L+S   D +V IW+T QD    E + V + H+  VK + WHP
Sbjct: 344 EKHTSEVCGIKFRQDGLQLASGGNDNTVMIWDTRQD----EPLWVKRNHNAAVKAITWHP 399

Query: 178 E-LPLLAS--SSYDDTIRLWKDYDDDWECAAVLNGHEGTV--WCSDFEKGKNGESIRLCS 232
           + + LLA+   S D  I  W +        ++  G + +   W   +E       I    
Sbjct: 400 DVVNLLATGGGSLDRHIHFW-NTTTGARIGSINTGSQVSSLHWGQSYEDSHMNREIVATG 458

Query: 233 GSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAV 291
           GS D+++ ++ Y           +  A + + H+ +I S   S +G  IA+ G D  L  
Sbjct: 459 GSPDNSISIYNY--------DSKVKVAEITQAHESRIVSSQLSPDGTTIATVGGDENLKF 510

Query: 292 YK 293
           Y+
Sbjct: 511 YR 512

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 80/214 (37%), Gaps = 40/214 (18%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H   +  + +R     LA+G  D+TV IW                   ++ + + L +  
Sbjct: 346 HTSEVCGIKFRQDGLQLASGGNDNTVMIW-------------------DTRQDEPLWVKR 386

Query: 119 GHENEVKGIAWSHDGALLSSC---SRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW 175
            H   VK I W  D   L +    S D+ +  W T         I  +   SQ V  + W
Sbjct: 387 NHNAAVKAITWHPDVVNLLATGGGSLDRHIHFWNTTTGAR----IGSINTGSQ-VSSLHW 441

Query: 176 -------HPELPLLAS-SSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGES 227
                  H    ++A+  S D++I ++ +YD   + A +   HE  +  S      +G +
Sbjct: 442 GQSYEDSHMNREIVATGGSPDNSISIY-NYDSKVKVAEITQAHESRIVSSQLS--PDGTT 498

Query: 228 IRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAIL 261
           I    G  D  ++ +R  D      ++   E+ L
Sbjct: 499 IATVGG--DENLKFYRVFDAKRKKSRDHEAESFL 530

>Scas_630.6
          Length = 621

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 83/192 (43%), Gaps = 38/192 (19%)

Query: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHEN 122
           IR + + P    LA G+ D  + IW                   N  E  ++ +++GHE 
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIW-------------------NIKERKIVMVLKGHEQ 384

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182
           ++  + +  DG  L S S D+S+ IW    D +  +C   L          V   E  L+
Sbjct: 385 DIYSLDYFPDGQKLVSGSGDRSIRIW----DLKTGQCSLTLSIEDGVTTVAVSPNEGKLI 440

Query: 183 ASSSYDDTIRLW--------KDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGS 234
           A+ S D ++R+W        +  D D E     NGH+ +V+   F   K+G+ +   SGS
Sbjct: 441 AAGSLDRSVRIWDSSTGFLVERLDSDNESG---NGHQDSVYSVAFT--KDGQHV--VSGS 493

Query: 235 DDSTVRVWRYID 246
            D TV++W   D
Sbjct: 494 LDRTVKLWNLGD 505

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 101/257 (39%), Gaps = 47/257 (18%)

Query: 25  LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTV 84
            LATG+ D+ I+I N+      +  ++ VL    H++ I  + + P    L +GS D ++
Sbjct: 355 FLATGAEDKLIRIWNIK-----ERKIVMVLKG--HEQDIYSLDYFPDGQKLVSGSGDRSI 407

Query: 85  SIWTRXXXXXXXXXXXXXXXTTNSL---EMDLLA-----------------IIE------ 118
            IW                 TT ++   E  L+A                 ++E      
Sbjct: 408 RIWDLKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDN 467

Query: 119 ----GHENEVKGIAWSHDGALLSSCSRDKSVWIWET-DQDGEEYECISVLQEHSQDVKHV 173
               GH++ V  +A++ DG  + S S D++V +W   D      +C      H   V  V
Sbjct: 468 ESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSV 527

Query: 174 VWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWC-----SDFEKGKNGESI 228
               +   + S S D  + +W    D      +L GH  +V       S+ + GKN +  
Sbjct: 528 ATSNDDKYIFSGSKDRGVIIWD--KDSGNPILMLQGHRKSVISVATVNSNVDDGKNYK-- 583

Query: 229 RLCSGSDDSTVRVWRYI 245
              +GS D   R+W+Y 
Sbjct: 584 LFATGSGDCKARIWKYF 600

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 90/218 (41%), Gaps = 33/218 (15%)

Query: 26  LATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTVS 85
           +  GS D +I++ N     +       V+D   H   IR +A  P    + +GS D TV 
Sbjct: 70  IIVGSDDFRIRVFNYNTGEK-------VVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVK 122

Query: 86  IWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWS-HDGALLSSCSRDKS 144
           +W                         L    EGHE+ V  +A++  D +  +S   D++
Sbjct: 123 LWNWENNWA------------------LEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRT 164

Query: 145 VWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECA 204
           V +W   Q    +  ++  QE   +       P+ P + ++S D TI++W DY     C 
Sbjct: 165 VKVWSLGQSTPNF-TLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIW-DYQTK-SCV 221

Query: 205 AVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           A L GH   V  + F          + SGS+D T+++W
Sbjct: 222 ATLEGHMSNVSFAVFHP----TLPIIISGSEDGTLKIW 255

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 73/181 (40%), Gaps = 29/181 (16%)

Query: 59  HKKAIRCVAWRPH-SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
           H+  + CVA+ P   +  A+G  D TV +W+                T N        + 
Sbjct: 139 HEHFVMCVAFNPKDPSTFASGCLDRTVKVWS------------LGQSTPN------FTLT 180

Query: 118 EGHENEVKGIAWSH--DGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW 175
            G E  V  + +    D   + + S D ++ IW    D +   C++ L+ H  +V   V+
Sbjct: 181 TGQERGVNYVDYYPLPDKPYMITASDDLTIKIW----DYQTKSCVATLEGHMSNVSFAVF 236

Query: 176 HPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSD 235
           HP LP++ S S D T+++W      ++    LN      WC        G    + SG D
Sbjct: 237 HPTLPIIISGSEDGTLKIWN--SSTYKVEKTLNVGLERSWC--IATHPTGRKNYIASGFD 292

Query: 236 D 236
           +
Sbjct: 293 N 293

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 84/232 (36%), Gaps = 55/232 (23%)

Query: 158 ECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCS 217
           E +   + H   ++ +  HP  P + S S D T++LW +++++W       GHE  V C 
Sbjct: 88  EKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLW-NWENNWALEQTFEGHEHFVMCV 146

Query: 218 DFEK--------------------GKNGESIRLCSG----------------------SD 235
            F                      G++  +  L +G                      SD
Sbjct: 147 AFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASD 206

Query: 236 DSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEV 295
           D T+++W Y        Q   C A L        ++V   T  +I S   DGTL ++   
Sbjct: 207 DLTIKIWDY--------QTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNS- 257

Query: 296 SNGDDEHDWEVIAKQELC---HGVYEANIVKWIDINGNMMLATGGDDGCVNL 344
           S    E    V  ++  C   H     N +     NG  +L+ G D+  ++L
Sbjct: 258 STYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLGNDEPTLSL 309

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 6/82 (7%)

Query: 163 LQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG 222
               S  VK + +HP  P + ++ Y   + LW +Y+   E  ++    E  V    F   
Sbjct: 9   FSNRSDRVKGIDFHPTEPWVLTTLYSGRVELW-NYETQVEVRSI-QVTETPVRAGKFIAR 66

Query: 223 KNGESIRLCSGSDDSTVRVWRY 244
           KN     +  GSDD  +RV+ Y
Sbjct: 67  KN----WIIVGSDDFRIRVFNY 84

>Scas_624.11
          Length = 1205

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 66/264 (25%), Positives = 105/264 (39%), Gaps = 53/264 (20%)

Query: 111 MDLLAIIEGHENEVKGIAW--SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQ 168
           M +L   E      KGIA+  S    L++  S    +W +        +E      +H  
Sbjct: 1   MKMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFE------DHEG 54

Query: 169 DVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESI 228
            V+ V +HP  P+  S   D TI++W    +  +C   LNGH   +    F K    E  
Sbjct: 55  PVRSVDFHPTQPIFVSGGDDYTIKVWSLETN--KCLYTLNGHLDYIRTVFFHK----ELP 108

Query: 229 RLCSGSDDSTVRVWRYIDDDE----DGQQEWI-CEAILPKVHDRQIYSVSWSTNGLIAST 283
            + S SDD T+R+W + +  E     G   ++ C    P             T+ L+ S 
Sbjct: 109 WIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHP-------------TDDLVVSA 155

Query: 284 GSDGTLAVY-------KEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNM----- 331
             D T+ V+       K  + G    D ++ A+Q L  G +   +VK+I + G+      
Sbjct: 156 SLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFI-LEGHTRGVNW 214

Query: 332 --------MLATGGDDGCVNLWNW 347
                   M+ +G DD  V LW +
Sbjct: 215 ASFHPTLPMIVSGSDDRQVKLWKY 238

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 63/265 (23%), Positives = 105/265 (39%), Gaps = 67/265 (25%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMD-LLAII 117
           H+  +R V + P   +  +G  D T+ +W                    SLE +  L  +
Sbjct: 52  HEGPVRSVDFHPTQPIFVSGGDDYTIKVW--------------------SLETNKCLYTL 91

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
            GH + ++ + +  +   + S S D+++ IW   Q+ +E  C   L  H+  V    +HP
Sbjct: 92  NGHLDYIRTVFFHKELPWIISASDDQTIRIWNW-QNRKEIAC---LTGHNHFVMCAQFHP 147

Query: 178 ELPLLASSSYDDTIRLW--------------KDYDDDW------------ECAA--VLNG 209
              L+ S+S D+TIR+W                +DD              +C    +L G
Sbjct: 148 TDDLVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFILEG 207

Query: 210 H-EGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQ 268
           H  G  W S      +     + SGSDD  V++W+Y     +  + W  E    + H   
Sbjct: 208 HTRGVNWAS-----FHPTLPMIVSGSDDRQVKLWKY-----NSTKAW--EVDTCRGHTNN 255

Query: 269 IYSVSW-STNGLIASTGSDGTLAVY 292
           +  V +  T   I S G D TL ++
Sbjct: 256 VDCVIFHPTQKFILSVGEDKTLRIW 280

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 47/220 (21%), Positives = 86/220 (39%), Gaps = 52/220 (23%)

Query: 26  LATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTVS 85
           + + S D+ I+I N  N  R +++ +     T H   + C  + P  +L+ + S D T+ 
Sbjct: 110 IISASDDQTIRIWNWQN--RKEIACL-----TGHNHFVMCAQFHPTDDLVVSASLDETIR 162

Query: 86  IWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSV 145
           +W                                   ++ G+   H      + + D  +
Sbjct: 163 VW-----------------------------------DISGLRKKHSAP--GTSTFDDQM 185

Query: 146 WIWETDQDGEEYECIS--VLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK-DYDDDWE 202
              +   DG   +C+   +L+ H++ V    +HP LP++ S S D  ++LWK +    WE
Sbjct: 186 AAQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWE 245

Query: 203 CAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
                 GH   V C  F   +      + S  +D T+R+W
Sbjct: 246 -VDTCRGHTNNVDCVIFHPTQK----FILSVGEDKTLRIW 280

 Score = 31.2 bits (69), Expect = 1.6,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 38/94 (40%), Gaps = 17/94 (18%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H + +   ++ P   ++ +GS D  V +W                 +T + E+D      
Sbjct: 208 HTRGVNWASFHPTLPMIVSGSDDRQVKLWK--------------YNSTKAWEVD---TCR 250

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQ 152
           GH N V  + +      + S   DK++ IW+ D+
Sbjct: 251 GHTNNVDCVIFHPTQKFILSVGEDKTLRIWDLDK 284

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 96/243 (39%), Gaps = 40/243 (16%)

Query: 16  LWSLDYSH--GLLATGSTDRKIKI-------INVTNAPRGQVSLMDVLDDTVHK--KAIR 64
           +WSLD +     L TGS D+ ++        + V++     + ++ +  DT  +    I 
Sbjct: 473 IWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDIL 532

Query: 65  CVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEV 124
            V   P    +A    D+TV ++                       M     + GH+  V
Sbjct: 533 SVVISPDDKFIAVSLLDNTVKVFFLDS-------------------MKFFLSLYGHKLPV 573

Query: 125 KGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLAS 184
             +  S+D  L+ +CS DK++ IW  D      +C   L  H   + +V + PE     S
Sbjct: 574 LSMDISYDSKLIVTCSADKNIKIWGLDFG----DCHKSLFAHQDSIMNVKFLPESYNFFS 629

Query: 185 SSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRY 244
            S D T++ W      +EC   L  H+  VW        N  +  + +G D S +RVW  
Sbjct: 630 CSKDATVKYWD--GQKFECIQKLAAHQSEVWSISVS---NDGTFVISTGHDHS-IRVWEE 683

Query: 245 IDD 247
            +D
Sbjct: 684 TED 686

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 77/188 (40%), Gaps = 32/188 (17%)

Query: 66  VAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVK 125
           + + P +NLLAAG  D  + IW                   + +   +L    GH++ + 
Sbjct: 85  LKYHPETNLLAAGYADGVIKIW-------------------DLISKTVLISFNGHKSAIT 125

Query: 126 GIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASS 185
            +A+   G  L S S+D  + +W+   +   Y+    L+ H +D    +W  +   L S+
Sbjct: 126 VLAFDTTGTRLISASKDSDIIVWDLVGESGLYK----LRSH-KDAITGLWCEDENWLIST 180

Query: 186 SYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYI 245
           S D  +++W D     +C      H G  W      G   +    CS   DS V++W+  
Sbjct: 181 SKDGLVKIW-DLKSQ-QCVETHLAHTGECWSL----GIIEDMAVTCSA--DSQVKLWKLD 232

Query: 246 DDDEDGQQ 253
              E+G +
Sbjct: 233 LQAENGSK 240

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 82/331 (24%), Positives = 125/331 (37%), Gaps = 70/331 (21%)

Query: 37  IINVTNAPRGQVSLMDVLDDTVHKKA------------------IRCVAWRPHSNL-LAA 77
           +  V   P  Q+SLM+  + T   K                   +RCV   P  N   A 
Sbjct: 81  VRRVFQQPHQQISLMERYEKTRSYKPQWHAPWKLSKVINGHTGWVRCVCVDPVDNEWFAT 140

Query: 78  GSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLS 137
           GS D+T+ IW                     L++ L+    GH   V+ IA S     + 
Sbjct: 141 GSNDTTIKIW---------------DLAAGKLKITLI----GHVMSVRDIAISKRHPYMF 181

Query: 138 SCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDY 197
           S S DK V  W    D E    I     H   V  V  HP L ++A++  D  +RLW D 
Sbjct: 182 SASEDKLVKCW----DLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLW-DI 236

Query: 198 DDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWIC 257
               E   VL GH+  +  +  +       I  CSG  D+TVR+W  I     G+   + 
Sbjct: 237 RSRSEI-MVLPGHKSPI--NKVKCLPVDPQIISCSG--DATVRLWDII----AGKASKVL 287

Query: 258 EAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVY 317
                 + D  ++   +S                +  VS  +D   W++   Q L +   
Sbjct: 288 THHSRNIRDLTLHPAEFS----------------FASVST-NDVRSWKLPEGQLLTNFQS 330

Query: 318 E-ANIVKWIDINGNMMLATGGDDGCVNLWNW 347
           +   I+  + IN + +L  GGDDG +  +++
Sbjct: 331 QNTGILNTVSINHDNVLLAGGDDGTLCFYDY 361

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 3/75 (4%)

Query: 168 QDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGES 227
           Q V+ V   P   +     Y+ T      +   W+ + V+NGH G V C   +   N   
Sbjct: 79  QLVRRVFQQPHQQISLMERYEKTRSYKPQWHAPWKLSKVINGHTGWVRCVCVDPVDNEW- 137

Query: 228 IRLCSGSDDSTVRVW 242
               +GS+D+T+++W
Sbjct: 138 --FATGSNDTTIKIW 150

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 78/177 (44%), Gaps = 22/177 (12%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
            +GH + V+    +HDG    S S DK++ +W    D +  +CI     H  DV  V   
Sbjct: 77  FKGHSHIVQDCTVTHDGKYALSASWDKTLRLW----DLQSGKCIKRFVGHKSDVMSVSID 132

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG---KNGESIRLCSG 233
           P    + S+S D T+++W    D   C   L GH    W S+       K+ +++ + S 
Sbjct: 133 PRATQIVSASRDKTVKVWNTVGD---CVVTLLGHND--WVSNVRIAPSEKSDDAVTVISA 187

Query: 234 SDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTL 289
             D  V+VW          Q +  EA     H+  + +V+ S +G + AS G DG +
Sbjct: 188 GMDKVVKVWDL--------QSFTIEADFIG-HNNYVTTVTPSPDGSIFASAGKDGQI 235

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 99/243 (40%), Gaps = 37/243 (15%)

Query: 113 LLAIIEGHENEVKGIAWSHDGA-LLSSCSRDKSVWIWETDQDGEEYEC-ISVLQEHSQDV 170
           L   +EGH   V  ++ S     +L S SRDK++  W+   + ++Y   +   + HS  V
Sbjct: 25  LRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIV 84

Query: 171 KHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRL 230
           +      +     S+S+D T+RLW       +C     GH+  V     +      + ++
Sbjct: 85  QDCTVTHDGKYALSASWDKTLRLWDLQSG--KCIKRFVGHKSDVMSVSIDP----RATQI 138

Query: 231 CSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIA-STGSDGTL 289
            S S D TV+VW  + D         C   L   +D       W +N  IA S  SD  +
Sbjct: 139 VSASRDKTVKVWNTVGD---------CVVTLLGHND-------WVSNVRIAPSEKSDDAV 182

Query: 290 AVYKEVSNGDDE--HDWEV----IAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVN 343
            V   +S G D+    W++    I    + H  Y   +    D     + A+ G DG + 
Sbjct: 183 TV---ISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPD---GSIFASAGKDGQII 236

Query: 344 LWN 346
           LWN
Sbjct: 237 LWN 239

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 50/141 (35%), Gaps = 29/141 (20%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           HK  +  V+  P +  + + S D TV +W                        D +  + 
Sbjct: 122 HKSDVMSVSIDPRATQIVSASRDKTVKVWNTVG--------------------DCVVTLL 161

Query: 119 GHENEVKGIAW-----SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV 173
           GH + V  +       S D   + S   DK V +W+      E + I     H+  V  V
Sbjct: 162 GHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIG----HNNYVTTV 217

Query: 174 VWHPELPLLASSSYDDTIRLW 194
              P+  + AS+  D  I LW
Sbjct: 218 TPSPDGSIFASAGKDGQIILW 238

>Kwal_47.17465
          Length = 800

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 65/137 (47%), Gaps = 8/137 (5%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H  ++  V + P  N LA+GS D  + IW +                  ++   L+A   
Sbjct: 21  HTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRRLVA--- 77

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
            H+N+++ I W+ D ++L +   D+SV +W    +G  +E I     H   VK V++ P 
Sbjct: 78  -HDNDIQDICWAPDSSILVTVGLDRSVIVW----NGSTFEKIKRFDVHQSLVKGVIFDPA 132

Query: 179 LPLLASSSYDDTIRLWK 195
               A++S D T+R+++
Sbjct: 133 NKYFATASDDRTVRIFR 149

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 81/200 (40%), Gaps = 21/200 (10%)

Query: 114 LAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQ-----------DGEEYECISV 162
           LA +  H   V  + +S DG  L+S S D+ + IWE D+           D E +     
Sbjct: 15  LASMSRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRR 74

Query: 163 LQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG 222
           L  H  D++ + W P+  +L +   D ++ +W      +E     + H+  V    F+  
Sbjct: 75  LVAHDNDIQDICWAPDSSILVTVGLDRSVIVWN--GSTFEKIKRFDVHQSLVKGVIFDPA 132

Query: 223 KNGESIRLCSGSDDSTVRVWRY--IDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-- 278
                    + SDD TVR++RY    D     +  + E             +SWS +G  
Sbjct: 133 NK----YFATASDDRTVRIFRYHKAGDMSFSIEHVVSEPFKGSPITTYFRRLSWSPDGQH 188

Query: 279 LIASTGSDGTLAVYKEVSNG 298
           + A   ++G ++    ++ G
Sbjct: 189 IAAPNATNGPVSSVSIIARG 208

>Kwal_56.23920
          Length = 937

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 92/243 (37%), Gaps = 40/243 (16%)

Query: 16  LWSLDYSH--GLLATGSTDRKIKI--INVTNAP------RGQVSLMDVLDDTVH-KKAIR 64
           +WSLD +     L TGS D+ +      V   P      +    L    D T+     + 
Sbjct: 470 IWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVL 529

Query: 65  CVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEV 124
            V   P + LLA    D+TV ++                       M     + GH+  V
Sbjct: 530 AVKISPDNRLLAVSLLDNTVKVFFMD-------------------SMKFFLSLYGHKLPV 570

Query: 125 KGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLAS 184
             I  S D  LL + S DK++ IW  D      +C   L  H+  +  VV+ PE     S
Sbjct: 571 LSIDISFDSKLLITSSADKNIKIWGLDFG----DCHRSLFAHNDSIMKVVFVPESHNFFS 626

Query: 185 SSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRY 244
            S D  ++ W    D +EC   L  H+  VW        +G  +   S S D ++RVW  
Sbjct: 627 CSKDALVKYWD--GDKFECIQKLAAHQKEVWT--LAISSDGRFV--VSASHDQSIRVWSE 680

Query: 245 IDD 247
            DD
Sbjct: 681 TDD 683

 Score = 36.6 bits (83), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 12/96 (12%)

Query: 150 TDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVL-- 207
           T  DG     +        +  ++ +HPE  LLA    D  I++W     D    +VL  
Sbjct: 58  TLTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYNDGAIKIW-----DLLSKSVLIS 112

Query: 208 -NGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
            NGH+  +    F++       RL SGS DS + VW
Sbjct: 113 FNGHKSAITILTFDQ----TGTRLISGSRDSDIIVW 144

 Score = 35.4 bits (80), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 61/143 (42%), Gaps = 19/143 (13%)

Query: 113 LLAIIEG-HENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECIS---------- 161
           LL  IEG H   +  +  + DG  L + S DK+V  W+   + E     +          
Sbjct: 458 LLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMF 517

Query: 162 --VLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDF 219
                E + DV  V   P+  LLA S  D+T++++  + D  +    L GH+  V   D 
Sbjct: 518 HDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVF--FMDSMKFFLSLYGHKLPVLSIDI 575

Query: 220 EKGKNGESIRLCSGSDDSTVRVW 242
               + +S  L + S D  +++W
Sbjct: 576 ----SFDSKLLITSSADKNIKIW 594

 Score = 32.7 bits (73), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 53/133 (39%), Gaps = 22/133 (16%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDK-SVWIWETDQDGEEYECISVLQEHSQDVKHVVW 175
           I GH ++V+ I  S D  LL++ S     +W  +T+     +EC   L           +
Sbjct: 381 IRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALA--------CKF 432

Query: 176 HPELPLLASSSYDDTIRLWKDYDDDWECAAVLN----GHEGTVWCSDFEKGKNGESIRLC 231
            P   L+   +    + L+     D   + +LN     H G +W  D       +  RL 
Sbjct: 433 LPGGALVVLGTKTGDLHLY-----DLASSTLLNTIEGAHSGAIWSLDM----TTDGKRLV 483

Query: 232 SGSDDSTVRVWRY 244
           +GS D TV  W +
Sbjct: 484 TGSADKTVCFWDF 496

 Score = 32.0 bits (71), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 69/177 (38%), Gaps = 32/177 (18%)

Query: 66  VAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVK 125
           + + P + LLA G  D  + IW                   + L   +L    GH++ + 
Sbjct: 81  LQYHPETRLLAVGYNDGAIKIW-------------------DLLSKSVLISFNGHKSAIT 121

Query: 126 GIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASS 185
            + +   G  L S SRD  + +W+   +   Y+    L+ H   +   +W      L S+
Sbjct: 122 ILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYK----LRSHKDSITG-LWCEGEEWLIST 176

Query: 186 SYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           S D  I++W D     +C      H G  W          E + + +G+D+  +++W
Sbjct: 177 SKDGLIKVW-DLKVQ-QCVETHVAHVGECWSMGVH-----EDLVITAGADNQ-IKLW 225

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 83/178 (46%), Gaps = 16/178 (8%)

Query: 26  LATGSTDRKIKIINV---TNAPRGQVSL-----MDVLDDTVHKKAIRCVAWRPHSNLLAA 77
           +ATG  D KI+I +V    +A  G+  +       +   + H  ++ CV + P  N LA+
Sbjct: 32  VATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLASMSRHTGSVTCVKFSPDGNYLAS 91

Query: 78  GSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLS 137
           GS D  + IW                    ++   L+A    H+N+++ I W+ D ++L 
Sbjct: 92  GSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLVA----HDNDIQDICWAPDSSILV 147

Query: 138 SCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK 195
           +   D+SV +W    +G  +E +     H   VK V++ P     A++S D T+R+++
Sbjct: 148 TVGLDRSVIVW----NGLNFERLKRFDVHQSLVKGVIFDPANKYFATASDDRTMRVFR 201

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 76/193 (39%), Gaps = 39/193 (20%)

Query: 177 PELPLLASSSYDDTIRLWK--------------DYDDDWECAAVLNGHEGTVWCSDFEKG 222
           P+   +A+   D  IR+W               D D     A+ ++ H G+V C  F   
Sbjct: 27  PDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLAS-MSRHTGSVTCVKFSPD 85

Query: 223 KNGESIRLCSGSDDSTVRVWRYIDDDEDG-------QQEWICEAILPKVHDRQIYSVSWS 275
            N     L SGSDD  + +W   +++  G       ++ W     L   HD  I  + W+
Sbjct: 86  GN----YLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRL-VAHDNDIQDICWA 140

Query: 276 TN-GLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLA 334
            +  ++ + G D ++ V+  + N +    ++V   Q L  GV        I    N   A
Sbjct: 141 PDSSILVTVGLDRSVIVWNGL-NFERLKRFDV--HQSLVKGV--------IFDPANKYFA 189

Query: 335 TGGDDGCVNLWNW 347
           T  DD  + ++ +
Sbjct: 190 TASDDRTMRVFRY 202

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/97 (20%), Positives = 40/97 (41%), Gaps = 19/97 (19%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H   I+ + W P S++L     D +V +W                   N L  + L   +
Sbjct: 130 HDNDIQDICWAPDSSILVTVGLDRSVIVW-------------------NGLNFERLKRFD 170

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGE 155
            H++ VKG+ +       ++ S D+++ ++   + GE
Sbjct: 171 VHQSLVKGVIFDPANKYFATASDDRTMRVFRYHKTGE 207

>Scas_674.20
          Length = 297

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 124/294 (42%), Gaps = 74/294 (25%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           ++AI   H + +      + G  L++CS DK++ I+E +  GE ++ ++ L+ H   V  
Sbjct: 1   MVAIANAHNDLIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKEVATLEGHDGPVWR 58

Query: 173 VVW-HPEL-PLLASSSYDDTIRLWKDYDDDWE---CAAVLNGHEGTVWCSDFEKG----- 222
           V W HP+   +LAS SYD  + +WK+ +  W    C AV +    +V  +  E G     
Sbjct: 59  VDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIACHAVHSASVNSVQWAPHEYGALLLA 118

Query: 223 -------------KNG----------------------------------ESIRLCSGSD 235
                        +NG                                  ES R  +G  
Sbjct: 119 ASSDGKVSVVEFKENGTLTPIIIDAHNIGVNSASWAPATLQENKPTKSPEESRRFVTGGA 178

Query: 236 DSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGL----IASTGSDGTLAV 291
           D+ V++W+Y ++     Q ++ E  L + H   +  V+WS + L    IAS   D T  +
Sbjct: 179 DNLVKIWKYNNE----SQTYLLEDTL-QGHSDWVRDVAWSPSVLLRSYIASVSQDKTCII 233

Query: 292 YKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLW 345
           + +  N D       + K+     ++ A+   W  ++GN++  +GGD+  V LW
Sbjct: 234 WTQ-ENNDSSWKKTELQKERFPDVLWRAS---W-SLSGNILALSGGDNK-VTLW 281

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 79/178 (44%), Gaps = 22/178 (12%)

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           LA+ S D TI++++   +  +  A L GH+G VW  D+   K G  +  CS   D  V +
Sbjct: 24  LATCSSDKTIKIFEVEGETHKEVATLEGHDGPVWRVDWAHPKFGTILASCSY--DGKVLI 81

Query: 242 WRYIDDDEDGQQEWI-CEAILPKVHDRQIYSVSWSTN---GLIASTGSDGTLAVYKEVSN 297
           W+    +E+G+   I C A    VH   + SV W+ +    L+ +  SDG ++V +   N
Sbjct: 82  WK----EENGRWSQIACHA----VHSASVNSVQWAPHEYGALLLAASSDGKVSVVEFKEN 133

Query: 298 GD------DEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWNWTD 349
           G       D H+  V +       + E    K      +    TGG D  V +W + +
Sbjct: 134 GTLTPIIIDAHNIGVNSASWAPATLQENKPTK--SPEESRRFVTGGADNLVKIWKYNN 189

>Kwal_23.6324
          Length = 514

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 60/129 (46%), Gaps = 12/129 (9%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           + GH+  V  +A+S DG  + S S D S+ +W    DG     I+  + H   V  V W 
Sbjct: 397 MTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW----DGRNGTFIATFRGHVASVYQVAWS 452

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFE-KGKNGESIRLCSGSD 235
            +  LL S S D T+++W       + +  L GH   V+  D+   GK     R+CS   
Sbjct: 453 SDCRLLVSCSKDTTLKVWDVRTK--KLSVDLPGHNDEVYTVDWSVDGK-----RVCSAGK 505

Query: 236 DSTVRVWRY 244
           D  VR+W +
Sbjct: 506 DKMVRIWTH 514

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 80/191 (41%), Gaps = 26/191 (13%)

Query: 21  YSHGLLATGSTDRKIKIINV-TNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGS 79
           ++ G + TGS D   +I +  TN P      M  L    H   + CVAW P   L+A GS
Sbjct: 153 HTSGRMVTGSGDNTARIWDCNTNTP------MYTLKG--HFNWVLCVAWCPDGELIATGS 204

Query: 80  FDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSC 139
            D+T+ +W                    SL  + + +++           + D   L+S 
Sbjct: 205 MDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVK-----------AGDQPRLASA 253

Query: 140 SRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDD 199
           S+D ++ IW+T +      C+  L  H+  V  V W     +L S S+D TIR W D   
Sbjct: 254 SKDGTIKIWDTTR----RVCVLTLSGHTNSVSCVKWGGR-GILYSGSHDKTIRAW-DMAA 307

Query: 200 DWECAAVLNGH 210
             +C  +L  H
Sbjct: 308 GGKCINILKSH 318

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 78/186 (41%), Gaps = 18/186 (9%)

Query: 117 IEGHENEVKGIAWS-HDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW 175
           I GH + +   A++ H    + + S D +  IW+ + +   Y     L+ H   V  V W
Sbjct: 138 IAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCNTNTPMY----TLKGHFNWVLCVAW 193

Query: 176 HPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG---KNGESIRLCS 232
            P+  L+A+ S D+TIRLW D +        L GH   +    +E     K G+  RL S
Sbjct: 194 CPDGELIATGSMDNTIRLW-DSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLAS 252

Query: 233 GSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVY 292
            S D T+++W             +C   L   H   +  V W   G++ S   D T+  +
Sbjct: 253 ASKDGTIKIW--------DTTRRVCVLTLSG-HTNSVSCVKWGGRGILYSGSHDKTIRAW 303

Query: 293 KEVSNG 298
              + G
Sbjct: 304 DMAAGG 309

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 62/139 (44%), Gaps = 25/139 (17%)

Query: 57  TVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAI 116
           T H+K +  VA+ P    + + SFD+++ +W                   +      +A 
Sbjct: 398 TGHQKLVNHVAFSPDGRYIVSASFDNSIKLW-------------------DGRNGTFIAT 438

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISV-LQEHSQDVKHVVW 175
             GH   V  +AWS D  LL SCS+D ++ +W+        + +SV L  H+ +V  V W
Sbjct: 439 FRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV-----RTKKLSVDLPGHNDEVYTVDW 493

Query: 176 HPELPLLASSSYDDTIRLW 194
             +   + S+  D  +R+W
Sbjct: 494 SVDGKRVCSAGKDKMVRIW 512

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 78/167 (46%), Gaps = 35/167 (20%)

Query: 135 LLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
           L+ + S D ++++W+  +  +    I+ +  H + V HV + P+   + S+S+D++I+LW
Sbjct: 372 LMVTASDDFTMYLWDPLKASKP---ITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW 428

Query: 195 KDYDDDWECAAVLNGHEGTV----WCSDFEKGKNGESIRLCSGSDDSTVRVW----RYID 246
              +  +   A   GH  +V    W SD           L S S D+T++VW    + + 
Sbjct: 429 DGRNGTF--IATFRGHVASVYQVAWSSDCR--------LLVSCSKDTTLKVWDVRTKKLS 478

Query: 247 DDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVY 292
            D  G             H+ ++Y+V WS +G  + S G D  + ++
Sbjct: 479 VDLPG-------------HNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 63/154 (40%), Gaps = 32/154 (20%)

Query: 204 AAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILP- 262
           ++ + GH  T+ CS F    +G   R+ +GS D+T R+W              C    P 
Sbjct: 135 SSAIAGHGSTILCSAFAPHTSG---RMVTGSGDNTARIWD-------------CNTNTPM 178

Query: 263 ---KVHDRQIYSVSWSTNGLIASTGS-DGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYE 318
              K H   +  V+W  +G + +TGS D T+ ++       D +  E   +    H  + 
Sbjct: 179 YTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLW-------DSNKGESYGEALRGHAKWI 231

Query: 319 ANI----VKWIDINGNMMLATGGDDGCVNLWNWT 348
            ++    +  +       LA+   DG + +W+ T
Sbjct: 232 TSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTT 265

>Scas_702.16
          Length = 816

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 81/182 (44%), Gaps = 17/182 (9%)

Query: 15  KLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNL 74
           ++WS+D    ++   S   ++ I      P   +S         H  ++ C+ + P+   
Sbjct: 42  RIWSVDSIKQIVKILSLKDEVPIDKELKKPLASMSR--------HTGSVTCLKFSPNGKY 93

Query: 75  LAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTN-SLEMDLLAIIEGHENEVKGIAWSHDG 133
           LA+GS D  + IWT                    ++   L+A    H+N+++ I W+ D 
Sbjct: 94  LASGSDDRILLIWTLDEERPIQPIFGGESEKERWAVRKRLVA----HDNDIQDICWAPDS 149

Query: 134 ALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRL 193
           +LL S   D++V IW    +G  +E +     H   VK V++ P     A++S D T+++
Sbjct: 150 SLLVSVGLDRAVIIW----NGITFEKLKRFDVHQSHVKGVIFDPANKYFATASDDRTMKI 205

Query: 194 WK 195
           ++
Sbjct: 206 FR 207

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 63/153 (41%), Gaps = 27/153 (17%)

Query: 205 AVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW--------RYIDDDEDGQQEWI 256
           A ++ H G+V C  F    NG+   L SGSDD  + +W        + I   E  ++ W 
Sbjct: 73  ASMSRHTGSVTCLKF--SPNGKY--LASGSDDRILLIWTLDEERPIQPIFGGESEKERWA 128

Query: 257 CEAILPKVHDRQIYSVSWSTN-GLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHG 315
               L   HD  I  + W+ +  L+ S G D  + +            W  I  ++L   
Sbjct: 129 VRKRL-VAHDNDIQDICWAPDSSLLVSVGLDRAVII------------WNGITFEKLKRF 175

Query: 316 -VYEANIVKWIDINGNMMLATGGDDGCVNLWNW 347
            V+++++   I    N   AT  DD  + ++ +
Sbjct: 176 DVHQSHVKGVIFDPANKYFATASDDRTMKIFRY 208

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 47/119 (39%), Gaps = 29/119 (24%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H   I+ + W P S+LL +   D  V IW                   N +  + L   +
Sbjct: 136 HDNDIQDICWAPDSSLLVSVGLDRAVIIW-------------------NGITFEKLKRFD 176

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
            H++ VKG+ +       ++ S D+++ I+   + G+           S  ++HVV  P
Sbjct: 177 VHQSHVKGVIFDPANKYFATASDDRTMKIFRYHKIGDA----------SFTIEHVVTEP 225

>Kwal_27.12239
          Length = 316

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 80/200 (40%), Gaps = 43/200 (21%)

Query: 57  TVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAI 116
           T+H + +  + W P S  +A  S D T+ I                      +    L  
Sbjct: 55  TLHSRPLSDLCWSPDSQCIATASDDFTIII--------------------THIVFGELHR 94

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           + GH   V  + ++  G LL SCS D+S+ IW    D      +  L  HS+ V  +   
Sbjct: 95  LVGHTAPVTSVKYTMKGNLLCSCSMDESIKIW----DILSGTLLRTLSAHSEPVVSIDLP 150

Query: 177 PELP-LLASSSYDDTIRLWK----------DYDDDWECAAVLNGHEGTVWCSDFEKGKNG 225
           P  P +L+S SYD  IR++            YD DW+         G V  S  +  +NG
Sbjct: 151 PFDPSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQ------SENGVVPISQVKFSRNG 204

Query: 226 ESIRLCSGSDDSTVRVWRYI 245
           +   L   S D  +++W ++
Sbjct: 205 K--YLLVKSLDGILKIWDFV 222

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 93/198 (46%), Gaps = 23/198 (11%)

Query: 12  QNDKLWSLDYSH--GLLATGSTDRKIKIINVTNA----------PRGQVSLMDVLDD-TV 58
           +N +++++D S     +ATG  D KI+I +V +           P  +  L   L + + 
Sbjct: 16  RNYEIYTVDVSSDGQRVATGGLDGKIRIWSVADILVFAKPKVSWPAREEQLRKPLANMSR 75

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEM-DLLAII 117
           H  ++  + + P +  LA+GS D  + IW +                 N LE  ++   +
Sbjct: 76  HTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDME-----NDLEHWNVRRRL 130

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
             H+N+++ I W+ D ++L +   D+S+ +W    +G  +E I     H   VK VV+ P
Sbjct: 131 VAHDNDIQDICWAPDSSILVTVGLDRSIIVW----NGSTFEKIKRFDVHQSHVKGVVFDP 186

Query: 178 ELPLLASSSYDDTIRLWK 195
                A++S D T+++++
Sbjct: 187 ANKYFATASDDRTVKVFR 204

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 89/240 (37%), Gaps = 22/240 (9%)

Query: 75  LAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGA 134
           +A G  D  + IW+                    L   L A +  H   V  + +S D  
Sbjct: 32  VATGGLDGKIRIWSVADILVFAKPKVSWPAREEQLRKPL-ANMSRHTGSVTALKFSPDNK 90

Query: 135 LLSSCSRDKSVWIWETDQ-----------DGEEYECISVLQEHSQDVKHVVWHPELPLLA 183
            L+S S DK + IWE ++           D E +     L  H  D++ + W P+  +L 
Sbjct: 91  YLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRRLVAHDNDIQDICWAPDSSILV 150

Query: 184 SSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWR 243
           +   D +I +W      +E     + H+  V    F+           + SDD TV+V+R
Sbjct: 151 TVGLDRSIIVWNG--STFEKIKRFDVHQSHVKGVVFDPANK----YFATASDDRTVKVFR 204

Query: 244 YID--DDEDGQQEWICEAILPKVHDRQIYSVSWSTNG--LIASTGSDGTLAVYKEVSNGD 299
           Y    D     +  I E             +SWS +G  +     ++G ++    +S G+
Sbjct: 205 YHKGTDLSFTIEHIITEPFQGSPLTTYFRRLSWSPDGQHIAVPNATNGPVSTVAIISRGN 264

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 91/220 (41%), Gaps = 37/220 (16%)

Query: 26  LATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTVS 85
           +  GS D KI++ N     +       V+D   H   IR +A  P  + + + S D TV 
Sbjct: 70  IIVGSDDFKIRVFNYNTGEK-------VVDFEAHPDYIRALAVHPTRSYVLSASDDLTVK 122

Query: 86  IWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWS-HDGALLSSCSRDKS 144
           +W                         L    EGHE+ V  + ++  D    ++   D +
Sbjct: 123 LWNWEKNWA------------------LEQTFEGHEHFVMSVTFNPKDPNTFATACLDHT 164

Query: 145 VWIWETDQDGEEYECISVLQEHSQDVKHVVWHP--ELPLLASSSYDDTIRLWKDYDDDWE 202
           V IW   Q+   +   + L+   + V  V ++P  + P L +SS D T+++W DY     
Sbjct: 165 VKIWSLGQETSNFTLRAHLE---KGVNFVDYYPFQDKPYLITSSDDRTVKVW-DYQTK-S 219

Query: 203 CAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           C A L GH   V  + +          + SGS+D TV++W
Sbjct: 220 CVATLEGHLSNVSYAVYHPMLP----IIISGSEDGTVKIW 255

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 68/159 (42%), Gaps = 23/159 (14%)

Query: 59  HKKAIRCVAWRPH-SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
           H+  +  V + P   N  A    D TV IW+                T+N     L A +
Sbjct: 139 HEHFVMSVTFNPKDPNTFATACLDHTVKIWS------------LGQETSN---FTLRAHL 183

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           E   N V    +  D   L + S D++V +W    D +   C++ L+ H  +V + V+HP
Sbjct: 184 EKGVNFVDYYPF-QDKPYLITSSDDRTVKVW----DYQTKSCVATLEGHLSNVSYAVYHP 238

Query: 178 ELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWC 216
            LP++ S S D T+++W    + ++    LN      WC
Sbjct: 239 MLPIIISGSEDGTVKIWN--SNTYKLERTLNLGLERSWC 275

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 96/247 (38%), Gaps = 49/247 (19%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSV--WIWETDQDGEEYECISVLQEHSQDVKHVV 174
            E H + ++ +A     + + S S D +V  W WE +   E+       + H   V  V 
Sbjct: 93  FEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQ-----TFEGHEHFVMSVT 147

Query: 175 WHPELP-LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWC--SDFEKGKN------- 224
           ++P+ P   A++  D T+++W              G E + +   +  EKG N       
Sbjct: 148 FNPKDPNTFATACLDHTVKIWS------------LGQETSNFTLRAHLEKGVNFVDYYPF 195

Query: 225 GESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTG 284
            +   L + SDD TV+VW Y        Q   C A L        Y+V      +I S  
Sbjct: 196 QDKPYLITSSDDRTVKVWDY--------QTKSCVATLEGHLSNVSYAVYHPMLPIIISGS 247

Query: 285 SDGTLAV-----YK--EVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGG 337
            DGT+ +     YK     N   E  W V A     H   + N +     NG  +LA G 
Sbjct: 248 EDGTVKIWNSNTYKLERTLNLGLERSWCVAA-----HPTGKRNFIAAGFDNGFTVLAIGN 302

Query: 338 DDGCVNL 344
           D+  ++L
Sbjct: 303 DEPRLSL 309

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 89/220 (40%), Gaps = 37/220 (16%)

Query: 26  LATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTVS 85
           +  GS D K+++ N     +       V D   H   IR +A  P    +  GS D TV 
Sbjct: 70  IVVGSDDNKVRVFNYNTGEK-------VADFVAHPDYIRSIAVHPSKPYILTGSDDLTVK 122

Query: 86  IWTRXXXXXXXXXXXXXXXTTNSLEMD--LLAIIEGHENEVKGIAWS-HDGALLSSCSRD 142
           +W                    + E D  L    +GHE+ V  +A++  D  + +S   D
Sbjct: 123 LW--------------------NWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLD 162

Query: 143 KSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWE 202
             V +W   Q    +  +   QE   +       P+ P + +SS D T++++ DY     
Sbjct: 163 HKVKVWSLGQSTPNF-TLHTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIF-DYQTK-S 219

Query: 203 CAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           C A L GH   V  + F    +     + SGS+D TV++W
Sbjct: 220 CVATLEGHMSNVSFAVF----HPTLPIIISGSEDGTVKLW 255

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 69/164 (42%), Gaps = 33/164 (20%)

Query: 59  HKKAIRCVAWRPH-SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
           H+  + CVA+ P   N+ A+G  D  V +W+                +T +  +      
Sbjct: 139 HEHFVMCVAFNPKDPNVFASGCLDHKVKVWS-------------LGQSTPNFTL------ 179

Query: 118 EGHENEVKGIAWS-----HDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
             H  + KG+ +       D   + + S D +V I+    D +   C++ L+ H  +V  
Sbjct: 180 --HTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIF----DYQTKSCVATLEGHMSNVSF 233

Query: 173 VVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWC 216
            V+HP LP++ S S D T++LW      ++    LN      WC
Sbjct: 234 AVFHPTLPIIISGSEDGTVKLWN--SSTYKLEKTLNLGLERSWC 275

 Score = 29.3 bits (64), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 163 LQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG 222
             + S  VK +  HP  P + ++ Y   + +W +Y+   E  ++    +  V    F   
Sbjct: 9   FSKRSNRVKGIDLHPSEPWVLTTLYSGRVEIW-NYETQQEVRSI-QVTDTPVRAGKFITR 66

Query: 223 KNGESIRLCSGSDDSTVRVWRY 244
           KN     +  GSDD+ VRV+ Y
Sbjct: 67  KNW----IVVGSDDNKVRVFNY 84

>YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in
           complex with nuclear pore proteins, member of WD (WD-40)
           repeat family [1050 bp, 349 aa]
          Length = 349

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/248 (20%), Positives = 111/248 (44%), Gaps = 24/248 (9%)

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW-HP 177
           GH++ V  + +   G  +++CS D+ + +++ D+D   +E     + H   +  + W  P
Sbjct: 7   GHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASP 66

Query: 178 EL-PLLASSSYDDTIRLWKDYDDDWECAA-------VLNGHEGTVWCSDFEKGKNGESIR 229
           E   ++AS+SYD T++LW++  D  EC+         LN  +G+++   F     G  ++
Sbjct: 67  EYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLG--LK 124

Query: 230 LCSGSDDSTVRVWRYIDDDE----DGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGS 285
           L    +D  +R++  ++  +        E    +I P  H +  + +SW  +       +
Sbjct: 125 LACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLA 184

Query: 286 DGTLA---VYKEVSNGDDEHDWEVIAKQELCHGV-YEANIVKWIDINGNMMLATGGDDGC 341
              L    +Y+   +G      ++   + L   + +  +I +W       ++ATG  DG 
Sbjct: 185 VSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWY-----QLIATGCKDGR 239

Query: 342 VNLWNWTD 349
           + ++  T+
Sbjct: 240 IRIFKITE 247

 Score = 34.7 bits (78), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 107 NSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVL 163
           ++L+++LL+  + H  EV  ++W+  G +LSS   D  V +W+      E++C+SV+
Sbjct: 290 SNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATY-SNEFKCMSVI 345

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 152 QDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK-DYDDDWECAAVLNGH 210
           Q   + E +S   +H+ +V  V W+    +L+S+  D  +RLWK  Y ++++C +V+   
Sbjct: 289 QSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITAQ 348

Query: 211 E 211
           +
Sbjct: 349 Q 349

>Kwal_26.8776
          Length = 433

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 121/303 (39%), Gaps = 60/303 (19%)

Query: 50  LMDVLDDTVHKKAIRCVAWRPHSNL-LAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNS 108
           LM V++   H   +RCV   P  N   A GS D+T+ +W                  +  
Sbjct: 113 LMRVING--HNGWVRCVCPDPVDNAWFATGSNDTTIKVW---------------DMASGK 155

Query: 109 LEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQ 168
           L++ L     GH   V+ +A S    L+ S S DK V  W    D E    I     H  
Sbjct: 156 LKLTL----TGHVMTVRSVAVSQRHPLMFSASEDKMVKCW----DLERNAAIRDYHGHFS 207

Query: 169 DVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGT---VWCSDFEKGKNG 225
            V  V  HP L L+AS+  D  +RLW D          L GH+     V C   +     
Sbjct: 208 GVNTVDVHPTLDLIASAGRDAVVRLW-DIRTRLPV-MTLAGHKSPINQVKCFPVDP---- 261

Query: 226 ESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGS 285
              ++ S S D+TVR+W    D   G+   I        H + + +        IA+  +
Sbjct: 262 ---QIMSCSSDATVRLW----DIRAGKATKILTH-----HSKSVRA--------IAAHPA 301

Query: 286 DGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEA-NIVKWIDINGNMMLATGGDDGCVNL 344
           + ++A     ++  D   W     Q L +   E   I+  + +N + +L  GGDDG ++ 
Sbjct: 302 ESSVA----TASTSDVRSWRHSDGQLLTNYHSEGIGIINSLSVNADGVLFGGGDDGNLSF 357

Query: 345 WNW 347
           +++
Sbjct: 358 FDY 360

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 67/303 (22%), Positives = 119/303 (39%), Gaps = 45/303 (14%)

Query: 3   IKLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINV-TNAPRGQVSLMDVLDDTVHKK 61
           +KL  +  +   +  ++   H L+ + S D+ +K  ++  NA         + D   H  
Sbjct: 156 LKLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERNAA--------IRDYHGHFS 207

Query: 62  AIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHE 121
            +  V   P  +L+A+   D+ V +W                     L +  LA   GH+
Sbjct: 208 GVNTVDVHPTLDLIASAGRDAVVRLW----------------DIRTRLPVMTLA---GHK 248

Query: 122 NEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPL 181
           + +  +        + SCS D +V +W    D    +   +L  HS+ V+ +  HP    
Sbjct: 249 SPINQVKCFPVDPQIMSCSSDATVRLW----DIRAGKATKILTHHSKSVRAIAAHPAESS 304

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGH-EGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
           +A++S  D +R W+  D       + N H EG    +      +G    L  G DD  + 
Sbjct: 305 VATASTSD-VRSWRHSDGQL----LTNYHSEGIGIINSLSVNADGV---LFGGGDDGNLS 356

Query: 241 VWRYIDDDEDGQQEWICEAILPKV-HDRQIYSVSWSTNGLIASTG-SDGTLAVYKEVSNG 298
            + Y    +   QE     I   +  +R I S S+   GL   TG SD ++ ++K++   
Sbjct: 357 FFDYKSGHK--YQELPTTKIPGSLDSERGILSASFDQTGLRLITGESDKSIKMWKQIPEA 414

Query: 299 DDE 301
             E
Sbjct: 415 TPE 417

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 67/162 (41%), Gaps = 26/162 (16%)

Query: 187 YDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYID 246
           +   + L  ++   W+   V+NGH G V C   +   N       +GS+D+T++VW    
Sbjct: 97  HKQQLELQPEWHAPWKLMRVINGHNGWVRCVCPDPVDNA---WFATGSNDTTIKVW---- 149

Query: 247 DDEDGQQEWICEAILPKVHDRQIYSVSWST-NGLIASTGSDGTLAVYKEVSNGDDEHDWE 305
           D   G+ +          H   + SV+ S  + L+ S   D  +  +          D E
Sbjct: 150 DMASGKLKLTLTG-----HVMTVRSVAVSQRHPLMFSASEDKMVKCW----------DLE 194

Query: 306 VIAKQELCHGVYEANIVKWIDINGNM-MLATGGDDGCVNLWN 346
             A     HG +    V  +D++  + ++A+ G D  V LW+
Sbjct: 195 RNAAIRDYHGHFSG--VNTVDVHPTLDLIASAGRDAVVRLWD 234

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 100/213 (46%), Gaps = 24/213 (11%)

Query: 143 KSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW------KD 196
           K++ +W++  D   +     L+ H+ +V  V +     ++ S+S D  +R+W      + 
Sbjct: 33  KTIALWKS-MDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREG 91

Query: 197 YDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEW- 255
           + D+ EC  V+  H+ T+  + F   KN     L  G  D ++ VW +I+D    Q+E+ 
Sbjct: 92  HMDEVECIQVIKHHKHTI--TVFAVLKN----LLVVGCADGSISVWSFIEDQYVLQEEFS 145

Query: 256 ICEAILP---KVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQEL 312
           + + + P    +H+ +       T  ++A  G++  + +Y  VSN +     E   K E 
Sbjct: 146 VQKGVFPLCLSMHEIE------KTQFILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLE- 198

Query: 313 CHGVYEANIVKWIDINGNMMLATGGDDGCVNLW 345
            H  +  ++V    + G+ +LA+G  D  + LW
Sbjct: 199 GHEDWIKSLVFRETVPGDYLLASGSQDRYIRLW 231

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 67/318 (21%), Positives = 116/318 (36%), Gaps = 54/318 (16%)

Query: 19  LDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWR---PHSNLL 75
           ++ +  +LA G T+  + I ++ +   G   L        H+  I+ + +R   P   LL
Sbjct: 160 IEKTQFILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLEGHEDWIKSLVFRETVPGDYLL 219

Query: 76  AAGSFDSTVSIW---TRXXXXXXXXXXXXXXXTTNSL-----------EMDLLAIIEGHE 121
           A+GS D  + +W   T                 +N +            ++  A+I GH+
Sbjct: 220 ASGSQDRYIRLWRIRTNEKIDTSEEDEKKLTLLSNKIYKFDISADVHVAINFEALIMGHD 279

Query: 122 NEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPL 181
           + +  + W      L + + D +V +WE D     + C S L E S              
Sbjct: 280 DWISSLQWHKTKLQLLTSTADTAVMVWEPDTISGIWICSSRLGELSSKG----------- 328

Query: 182 LASSSYDDTIRLWKD--YDDDWECAAVLNGHEGT--VWCS------DFEKGKNGESIR-- 229
            AS++   +   W    +  D +   + NG  G+  +W S      D E G  G +    
Sbjct: 329 -ASTATGSSGGFWSCIWFTHDGKDVILTNGKTGSWRIWTSTDGLLWDQELGITGATKSVT 387

Query: 230 ----------LCSGSDDSTVRV---WRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWST 276
                     L S S D T R+   W+Y     + +    CE   P++H   +  V   +
Sbjct: 388 DVAWSIDGNYLLSTSLDQTTRLFAEWKYETSGVERKTPSWCEMARPQIHGYDMLCVEPIS 447

Query: 277 NGLIASTGSDGTLAVYKE 294
           N    S G +  L  + E
Sbjct: 448 NTRFVSGGDEKILRSFDE 465

 Score = 35.4 bits (80), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 58/144 (40%), Gaps = 6/144 (4%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQE-HSQDVK 171
           L  ++  H   +  + +S D   L S SRD+   +WE + D   +   S  ++ HS+ + 
Sbjct: 599 LPQVLPFHNLTITKLRFSKDNRYLLSVSRDRLWSLWERNFDNNSFVLRSFKEKPHSRIIW 658

Query: 172 HVVWHPELPLLA--SSSYDDTIRLWKDYDDDWECAAVLNG---HEGTVWCSDFEKGKNGE 226
              W P    LA  ++S D T++ W+   +D   +  L         V      K    E
Sbjct: 659 DADWVPLAKGLAFITASRDKTLKFWRLSKEDEATSVELENSIRFSEPVTSISVHKDLYNE 718

Query: 227 SIRLCSGSDDSTVRVWRYIDDDED 250
            + L  G +   +R+  Y +   D
Sbjct: 719 KVLLAVGFESGAIRILSYTESFND 742

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 64/165 (38%), Gaps = 19/165 (11%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGE----EYECISVLQEHSQ 168
           +   ++GH  EV  + +     ++ S S D  V +W   +  E    E ECI V++ H  
Sbjct: 48  VFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREGHMDEVECIQVIKHHKH 107

Query: 169 DVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTV-WCSDFEKGKNGES 227
            +   V+     LL     D +I +W   +D +      +  +G    C    + +  + 
Sbjct: 108 TI--TVFAVLKNLLVVGCADGSISVWSFIEDQYVLQEEFSVQKGVFPLCLSMHEIEKTQF 165

Query: 228 IRLCSGSDDSTVRVWRYIDDDE-----------DGQQEWICEAIL 261
           I L  G  +  V ++  + + E           +G ++WI   + 
Sbjct: 166 I-LAIGGTNVNVFIYSLVSNSEGVSKLEFATKLEGHEDWIKSLVF 209

>YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the
           COPII coat of vesicles involved in endoplasmic reticulum
           to Golgi transport, contains six WD (WD-40) repeats [894
           bp, 297 aa]
          Length = 297

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 82/190 (43%), Gaps = 13/190 (6%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           ++ I   H   +      + G  L++CS DK++ I+E   +GE ++ I  L  H   V  
Sbjct: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEV--EGETHKLIDTLTGHEGPVWR 58

Query: 173 VVW-HPEL-PLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRL 230
           V W HP+   +LAS SYD  + +WK+ +  W   AV   H  +V    +   + G    L
Sbjct: 59  VDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGP--LL 116

Query: 231 CSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLA 290
              S D  V V   ++  E+G        I+   H   + S SW+   +      +GT  
Sbjct: 117 LVASSDGKVSV---VEFKENG----TTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKE 169

Query: 291 VYKEVSNGDD 300
             K V+ G D
Sbjct: 170 SRKFVTGGAD 179

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 86/213 (40%), Gaps = 44/213 (20%)

Query: 4   KLAKSLKLQNDKLWSLDYSHG----LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVH 59
           KL  +L      +W +D++H     +LA+ S D K+ I    N    Q+++       VH
Sbjct: 44  KLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAV-----HAVH 98

Query: 60  KKAIRCVAWRPH--SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
             ++  V W PH    LL   S D  VS+                  TT+ +      II
Sbjct: 99  SASVNSVQWAPHEYGPLLLVASSDGKVSV-----------VEFKENGTTSPI------II 141

Query: 118 EGHENEVKGIAWS---------HDGALLS----SCSRDKSVWIWETDQDGEEYECISVLQ 164
           + H   V   +W+         H+G   S    +   D  V IW+ + D + Y   S L+
Sbjct: 142 DAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLE 201

Query: 165 EHSQDVKHVVWHPELPL---LASSSYDDTIRLW 194
            HS  V+ V W P + L   LAS S D T  +W
Sbjct: 202 GHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 121/309 (39%), Gaps = 51/309 (16%)

Query: 19  LDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAW--RPHSNLLA 76
           LDY    LAT S+D+ IKI  V         L+D L  T H+  +  V W       +LA
Sbjct: 17  LDYYGKRLATCSSDKTIKIFEVEGETH---KLIDTL--TGHEGPVWRVDWAHPKFGTILA 71

Query: 77  AGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWS-HD-GA 134
           + S+D  V IW                          +A+   H   V  + W+ H+ G 
Sbjct: 72  SCSYDGKVLIWKEENG-----------------RWSQIAVHAVHSASVNSVQWAPHEYGP 114

Query: 135 LLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP-------------ELPL 181
           LL   S D  V + E  ++G     I  +  H+  V    W P             E   
Sbjct: 115 LLLVASSDGKVSVVEFKENGTTSPII--IDAHAIGVNSASWAPATIEEDGEHNGTKESRK 172

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEG-TVWCSDFEKGKNGESIR--LCSGSDDST 238
             +   D+ +++WK Y+ D +   + +  EG + W  D         +R  L S S D T
Sbjct: 173 FVTGGADNLVKIWK-YNSDAQTYVLESTLEGHSDWVRDVAWSPT-VLLRSYLASVSQDRT 230

Query: 239 VRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVYKEVSN 297
             +W   ++    ++  + E   P V    ++  SWS +G ++A +G D  + ++KE   
Sbjct: 231 CIIWTQDNEQGPWKKTLLKEEKFPDV----LWRASWSLSGNVLALSGGDNKVTLWKENLE 286

Query: 298 GDDEHDWEV 306
           G  E   EV
Sbjct: 287 GKWEPAGEV 295

>Kwal_56.24596
          Length = 294

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 76/169 (44%), Gaps = 13/169 (7%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           ++ I   H   +      + G  L++CS DK++ I+E   +GE ++ +  L  H   V  
Sbjct: 1   MVTITNAHTELIHDAVLDYYGKRLATCSSDKTIKIFEV--EGETHKLVETLHGHEGPVWQ 58

Query: 173 VVW-HPELP-LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRL 230
           V W HP+   +LAS SYD  + +WK+ +  W   AV   H  +V    +   + G    L
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEENGRWTQIAVHAVHSASVNSVQWAPHEYGP--LL 116

Query: 231 CSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGL 279
            + S D  V V   ++  E+G        IL   H   + + SW++  L
Sbjct: 117 LAASSDGKVSV---VEFKENG----TTSPILVDAHSIGVNTASWASAAL 158

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 87/216 (40%), Gaps = 41/216 (18%)

Query: 4   KLAKSLKLQNDKLWSLDYSHG----LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVH 59
           KL ++L      +W +D++H     +LA+ S D K+ I    N    Q+++       VH
Sbjct: 44  KLVETLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEENGRWTQIAV-----HAVH 98

Query: 60  KKAIRCVAWRPH--SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
             ++  V W PH    LL A S D  VS+                  TT+ +      ++
Sbjct: 99  SASVNSVQWAPHEYGPLLLAASSDGKVSV-----------VEFKENGTTSPI------LV 141

Query: 118 EGHENEVKGIAWS----HDGALLSSCSR------DKSVWIWETDQDGEEYECISVLQEHS 167
           + H   V   +W+      GA+     R      D  V +W+ + D   Y     L+ H+
Sbjct: 142 DAHSIGVNTASWASAALQGGAVSQQMRRFVTGGADNLVKVWKFNPDANTYLLEDTLEGHT 201

Query: 168 QDVKHVVWHPELPL---LASSSYDDTIRLWKDYDDD 200
             V+ V W P + L   LAS S D T  +W   ++ 
Sbjct: 202 DWVRDVAWSPSVLLRSYLASVSQDRTCIIWTQENNQ 237

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 61/120 (50%), Gaps = 12/120 (10%)

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           LA+ S D TI++++   +  +    L+GHEG VW  D+   K G  + L S S D  V +
Sbjct: 24  LATCSSDKTIKIFEVEGETHKLVETLHGHEGPVWQVDWAHPKFG--VILASCSYDGKVLI 81

Query: 242 WRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTN---GLIASTGSDGTLAVYKEVSNG 298
           W+    +E+G+   I    +  VH   + SV W+ +    L+ +  SDG ++V +   NG
Sbjct: 82  WK----EENGRWTQIA---VHAVHSASVNSVQWAPHEYGPLLLAASSDGKVSVVEFKENG 134

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 117/307 (38%), Gaps = 50/307 (16%)

Query: 19  LDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAW-RPHSN-LLA 76
           LDY    LAT S+D+ IKI  V         L++ L    H+  +  V W  P    +LA
Sbjct: 17  LDYYGKRLATCSSDKTIKIFEVEGETH---KLVETLHG--HEGPVWQVDWAHPKFGVILA 71

Query: 77  AGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWS-HD-GA 134
           + S+D  V IW                          +A+   H   V  + W+ H+ G 
Sbjct: 72  SCSYDGKVLIWKEENG-----------------RWTQIAVHAVHSASVNSVQWAPHEYGP 114

Query: 135 LLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW----------HPELPLLAS 184
           LL + S D  V + E  ++G     +  +  HS  V    W            ++    +
Sbjct: 115 LLLAASSDGKVSVVEFKENGTTSPIL--VDAHSIGVNTASWASAALQGGAVSQQMRRFVT 172

Query: 185 SSYDDTIRLWKDYDD--DWECAAVLNGHEGTVWCSDFEKGKNGESIR--LCSGSDDSTVR 240
              D+ +++WK   D   +     L GH  T W  D     +   +R  L S S D T  
Sbjct: 173 GGADNLVKVWKFNPDANTYLLEDTLEGH--TDWVRDVAWSPS-VLLRSYLASVSQDRTCI 229

Query: 241 VWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVYKEVSNGD 299
           +W      E+ Q  W    +        ++  SWS +G ++A +G D  + ++KE   G 
Sbjct: 230 IW----TQENNQGPWKKTLLKEDKFSDVLWRASWSLSGNILALSGGDNKVTLWKENLEGK 285

Query: 300 DEHDWEV 306
            E   EV
Sbjct: 286 WEPAGEV 292

>Scas_673.11
          Length = 434

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/250 (21%), Positives = 106/250 (42%), Gaps = 45/250 (18%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H  ++  +A  P   L+  G  D+   +WT                 ++S        +E
Sbjct: 68  HTDSVFTIAHHPTLPLVVTGGGDNVAHLWT-----------------SHSQPPKFAGTLE 110

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW--- 175
           GH   V   A++HDG  L +      + + ++++ G ++   S LQE    V+ VVW   
Sbjct: 111 GHTESVVASAFTHDGQFLVTADMTGKIMVHKSNKSGSQWSLTSTLQE----VEEVVWLKC 166

Query: 176 HPELP-LLASSSYDDTIRLWKDYDDDWECAAVLNG--HEGTVWCSDFEKGKNGESI-RLC 231
           HP +  + A  + D ++  ++  D+D     +++G  H+      +F     GE++  L 
Sbjct: 167 HPVISGVFAFGATDGSVWCYQINDNDGSVEQLMSGFIHQQDCTMGEFINIDQGENVLELV 226

Query: 232 SGSDDSTVRVW---------RYIDDDEDG-QQEWICEAILPKVHDRQIYSVSWSTNGLIA 281
           + S DS++  W         +   D+  G +  W+  A+ P         ++   +G+IA
Sbjct: 227 TCSVDSSIVGWNCFTAQPTFKITKDEIKGLEAPWVSLAVAPS-------KMTNGNSGIIA 279

Query: 282 STGSDGTLAV 291
           +  ++G LA+
Sbjct: 280 AGANNGVLAI 289

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%)

Query: 160 ISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDF 219
           ++   +H+  V  +  HP LPL+ +   D+   LW  +    + A  L GH  +V  S F
Sbjct: 62  VAYFDKHTDSVFTIAHHPTLPLVVTGGGDNVAHLWTSHSQPPKFAGTLEGHTESVVASAF 121

>AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH]
           (367581..368573) [993 bp, 330 aa]
          Length = 330

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 105/254 (41%), Gaps = 24/254 (9%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           +     GHE+ V  I +   G  +++CS D+ + ++  D+D  E+      + H   V  
Sbjct: 1   MKPFTTGHEDLVHDICYDFYGRHVATCSSDQHIKVFRLDKDTNEWTLSDSWKGHDSSVVA 60

Query: 173 VVW-HPEL-PLLASSSYDDTIRLWKDYDD-------DWECAAVLNGHEGTVWCSDFEKGK 223
           + W  PE   +LAS SY+ TI++W++  D        W     LN   G ++   F  G 
Sbjct: 61  LDWASPEYGRILASVSYNKTIKVWEEDPDAPEGSGRRWTRLCTLNDATGPLYSVKFAPGH 120

Query: 224 NGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICE----AILPKVHDRQIYSVSWSTNGL 279
            G  +RL +  +D  +R++  ++  +        E    A  P  H +  +S+ W  +  
Sbjct: 121 LG--LRLGAIGNDGVLRIYDALEPSDLRSWTLTSEVKVLATPPASHLQSDFSLDWCPSRF 178

Query: 280 IASTGSDGTL---AVYKEVSNGDDEHDWEVIAKQELCHGV-YEANIVKWIDINGNMMLAT 335
            A       L    VY+    G       +   Q L   V +  +  +W     + ++AT
Sbjct: 179 SAERLVVCALDQAFVYERNKAGKLFQAARLPGHQGLIRSVSWAPSFGRW-----HQLIAT 233

Query: 336 GGDDGCVNLWNWTD 349
           G  DG V ++  T+
Sbjct: 234 GSKDGRVRIFQLTE 247

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 49/115 (42%), Gaps = 11/115 (9%)

Query: 59  HKKAIRCVAWRPH----SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXX------TTNS 108
           H+  IR V+W P       L+A GS D  V I+                           
Sbjct: 211 HQGLIRSVSWAPSFGRWHQLIATGSKDGRVRIFQLTEKLDATDDASTDDASTDDAGPAPH 270

Query: 109 LEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVL 163
           + + LL+    H+ EV  ++W+  G +LSS   D  V +W++     E++C+SV+
Sbjct: 271 ISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKSSFS-NEFKCMSVI 324

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 55/119 (46%), Gaps = 26/119 (21%)

Query: 115 AIIEGHENEVKGIAWSHDGA----LLSSCSRDKSVWIWETDQD----------------- 153
           A + GH+  ++ ++W+        L+++ S+D  V I++  +                  
Sbjct: 206 ARLPGHQGLIRSVSWAPSFGRWHQLIATGSKDGRVRIFQLTEKLDATDDASTDDASTDDA 265

Query: 154 -GEEYECISVLQEHSQ---DVKHVVWHPELPLLASSSYDDTIRLWK-DYDDDWECAAVL 207
               +  + +L EH+    +V  V W+    +L+SS  D  +RLWK  + ++++C +V+
Sbjct: 266 GPAPHISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKSSFSNEFKCMSVI 324

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 34/83 (40%), Gaps = 18/83 (21%)

Query: 23  HGLLATGSTDRKIKIINVTN------------------APRGQVSLMDVLDDTVHKKAIR 64
           H L+ATGS D +++I  +T                    P   +S+  + +   HK  + 
Sbjct: 228 HQLIATGSKDGRVRIFQLTEKLDATDDASTDDASTDDAGPAPHISVQLLSEHADHKGEVW 287

Query: 65  CVAWRPHSNLLAAGSFDSTVSIW 87
            V+W     +L++   D  V +W
Sbjct: 288 SVSWNLTGTILSSSGDDGKVRLW 310

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 82/180 (45%), Gaps = 17/180 (9%)

Query: 26  LATGSTDRKIKIINVT---------NAPRGQVSLMDVLDD-TVHKKAIRCVAWRPHSNLL 75
           LATG  D KI+I ++          NA   +  LM  L   + H  ++  V + P    L
Sbjct: 32  LATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLSTMSRHAGSVTTVKFSPDGKYL 91

Query: 76  AAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGAL 135
           A+GS D  + IW                 +T+    ++   +  H+N+++ I W+ D ++
Sbjct: 92  ASGSDDRILLIW---ELEGGTTQPMFGAESTDIEHWNVRRRLVAHDNDIQDICWAPDSSI 148

Query: 136 LSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK 195
           + S   D+++ IW    +G  +E +     H   VK VV+ P     A++S D TI++++
Sbjct: 149 MVSVGLDRAIIIW----NGSTFEKVKRFDVHQSHVKGVVFDPANKYFATASDDRTIKMFR 204

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 51/246 (20%), Positives = 89/246 (36%), Gaps = 65/246 (26%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H   I+ + W P S+++ +   D  + IW                   N    + +   +
Sbjct: 133 HDNDIQDICWAPDSSIMVSVGLDRAIIIW-------------------NGSTFEKVKRFD 173

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
            H++ VKG+ +       ++ S D+++ ++   + GE           S  V+HV+  P 
Sbjct: 174 VHQSHVKGVVFDPANKYFATASDDRTIKMFRYHKTGET----------SFSVEHVITEP- 222

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAA--VLNGHEGTVWCSDFEKGKNGESIRLCSGSDD 236
                 S      R      D    AA   +NG   TV     E+G     + L  G D 
Sbjct: 223 ---FKGSPLTTYFRRLSWSPDGQHIAAPNAMNGPVSTVAI--IERGTWESPVSLV-GHDQ 276

Query: 237 ST------VRVWRYIDDDE-----DGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGS 285
            T       R+++   DD      DG++  I + +                + ++AS+G 
Sbjct: 277 PTEVASFNPRIFKRQKDDSTTDTIDGKKTGISDEV----------------DCIVASSGQ 320

Query: 286 DGTLAV 291
           D TLAV
Sbjct: 321 DKTLAV 326

>Scas_679.28
          Length = 815

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 68/157 (43%), Gaps = 25/157 (15%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H+K I  +A  P+ ++ A  S+D T  IW                        +L A + 
Sbjct: 490 HEKDINALAISPNDSIFATASYDKTCKIWDLENG-------------------ELTATLS 530

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
            H+  +  +A+     L+++CS DK++ IW  D     +  +  L+ H+  V+  ++  +
Sbjct: 531 NHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDT----FSVMKTLEGHTNAVQRCMFINK 586

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVW 215
              L SS  D  I++W     D  C   L+GH+  +W
Sbjct: 587 QLQLVSSGADGLIKIWDCSTGD--CLKTLDGHDNRIW 621

 Score = 36.2 bits (82), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 104/248 (41%), Gaps = 46/248 (18%)

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW-- 175
           EGHE+ +  +  + DG  +++ S+D +  +W+ +    +++       HS  V  V    
Sbjct: 383 EGHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPN 442

Query: 176 -----HPELPLLASSSYDDTIRLWK------DYDDDWECAAVLNGHEGTVWCSDFEKGKN 224
                +PE  L AS+  D TI+ WK        ++D +   V    E T      EK  N
Sbjct: 443 VMLRGYPEFLLTASN--DLTIKKWKIPKPSTTVEEDCQIVKV---SEYTRRAH--EKDIN 495

Query: 225 GESIR-----LCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSW-STNG 278
             +I        + S D T ++W    D E+G+      A L   H R ++ V++   + 
Sbjct: 496 ALAISPNDSIFATASYDKTCKIW----DLENGE----LTATLSN-HKRGLWDVAFCQYDK 546

Query: 279 LIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGD 338
           LIA+   D T+ ++            +  +  +   G   A + + + IN  + L + G 
Sbjct: 547 LIATCSGDKTIKIWS----------LDTFSVMKTLEGHTNA-VQRCMFINKQLQLVSSGA 595

Query: 339 DGCVNLWN 346
           DG + +W+
Sbjct: 596 DGLIKIWD 603

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 57/133 (42%), Gaps = 2/133 (1%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           L +I    E E+  +  + D   LS  S+++ + I++ DQ+ ++   I    + S     
Sbjct: 52  LHSIANDDEQEITALKLTPDAQYLSFISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPCYI 111

Query: 173 VVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCS 232
           +       L+A    D +I +  D ++ +   + L GH  T+    F    N     LCS
Sbjct: 112 MDCDSTSTLVALGGTDGSITVV-DIENGFITHS-LKGHGATISALKFFGQANSNVWLLCS 169

Query: 233 GSDDSTVRVWRYI 245
           G  +  V+VW  +
Sbjct: 170 GDTNGMVKVWDLV 182

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 94/231 (40%), Gaps = 34/231 (14%)

Query: 120 HENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPEL 179
           H   ++ +A+S++ +   +CS D  + IW      +E     VL  H  DV+   WHPEL
Sbjct: 165 HTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQE----RVLSGHHWDVRSCDWHPEL 220

Query: 180 PLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTV 239
            L+ S S D+ ++LW       +C + L   + TV  + F+  K      L + S D + 
Sbjct: 221 GLIVSGSKDNLVKLWDPRSG--QCVSTLLKFKHTVLKTRFQPTKGN---LLAAISKDKSC 275

Query: 240 RVWRYIDDDEDGQQEWICEAILPKVHDR-QIYSVSWST-NGLIASTGS-DGTLAVYKEVS 296
           RV+    D      E +C      V D      + WST N  + + G  DG+L   K   
Sbjct: 276 RVF----DLRASMNELMC------VRDEVDFMELEWSTINESMFTVGCYDGSL---KHFD 322

Query: 297 NGDD-EHDWEVIA-KQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLW 345
            G D E    +I    E C      N V  I       LAT   D  +  W
Sbjct: 323 LGQDTEKPIHIIPFAHEKCISAIAYNPVGHI-------LATAAKDRTIRFW 366

 Score = 31.6 bits (70), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 58  VHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTR 89
            H+K I  +A+ P  ++LA  + D T+  WTR
Sbjct: 337 AHEKCISAIAYNPVGHILATAAKDRTIRFWTR 368

>KLLA0F06754g complement(650475..651509) similar to sp|P53011
           Saccharomyces cerevisiae YGL100w SEH1 nuclear pore
           protein, start by similarity
          Length = 344

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 55/256 (21%), Positives = 110/256 (42%), Gaps = 28/256 (10%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           +   + GH + V  I++   G  +++CS D+ + +++ D++  E+E     + H   +  
Sbjct: 1   MKPFLTGHSDLVHDISYDFYGRRVATCSSDQHIKVFKLDKETNEWELSESWKAHDSSIVS 60

Query: 173 VVW-HPEL-PLLASSSYDDTIRLWKDYDD-------DWECAAVLNGHEGTVWCSDFEKGK 223
           + W  PE   ++AS SYD TI+LW++  D        W+    LN   G ++   F    
Sbjct: 61  LDWAAPEFGRIIASVSYDKTIKLWEEDPDALELSGKRWQKLCTLNDATGPLFSVKFAPSH 120

Query: 224 NGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAIL----PKVHDRQIYSVSW----- 274
            G  +RL +  +D  +R++  ++  +        E  +    P  H +  + +SW     
Sbjct: 121 LG--LRLAALGNDGKLRLYDALESSDLRSWTLTSEITVLNTPPASHLQSDFCLSWCPSRF 178

Query: 275 STNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGV-YEANIVKWIDINGNMML 333
           ST  L+ S     T  +Y+    G       +     L   + +  ++ +W       ++
Sbjct: 179 STERLVISAMDQAT--IYQRNKQGKLVPAGHLKGHTGLIRSIAWAPSVGRWY-----QLI 231

Query: 334 ATGGDDGCVNLWNWTD 349
           ATG  DG + ++  T+
Sbjct: 232 ATGCKDGKLRIFKVTE 247

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 109 LEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQ 164
           L ++L++    H+ EV  ++W+  G +LSS   D  + +W+      E+ C+SV+Q
Sbjct: 287 LHVELISEHSDHQGEVWSVSWNLTGTILSSTGDDGKIRLWKASY-SNEFRCMSVVQ 341

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 158 ECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK-DYDDDWECAAVLNG 209
           E IS   +H  +V  V W+    +L+S+  D  IRLWK  Y +++ C +V+  
Sbjct: 290 ELISEHSDHQGEVWSVSWNLTGTILSSTGDDGKIRLWKASYSNEFRCMSVVQA 342

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 114/291 (39%), Gaps = 60/291 (20%)

Query: 63  IRCVAWRPHSNL-LAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHE 121
           +RCVA  P  N     GS D+T+ +W                  T  L+  L     GH 
Sbjct: 142 VRCVAIDPVDNEWFITGSNDTTMKVW---------------DLATGKLKTTL----AGHV 182

Query: 122 NEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPL 181
             V+ +A S     L S S DK+V  W    D E+ + I     H   V+ V  HP L L
Sbjct: 183 MTVRDVAVSDRHPYLFSVSEDKTVKCW----DLEKNQIIRDYYGHLSGVRTVSIHPTLDL 238

Query: 182 LASSSYDDTIRLWKDYDDDWECAAV-LNGHEGT---VWCSDFEKGKNGESIRLCSGSDDS 237
           +A++  D  I+LW   D       + L GH+G    V C+  +        ++ S S D+
Sbjct: 239 IATAGRDSVIKLW---DMRTRIPVITLVGHKGPINQVQCTPVDP-------QVVSSSTDA 288

Query: 238 TVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSN 297
           TVR+W    D   G+   +        H R + + +        ++              
Sbjct: 289 TVRLW----DVVAGKTMKVLTH-----HKRSVRATALHPKEFSVASACT----------- 328

Query: 298 GDDEHDWEVIAKQELCHGVYE-ANIVKWIDINGNMMLATGGDDGCVNLWNW 347
            DD   W +     L +   E   I+  + IN + +L  GGD+G ++ +++
Sbjct: 329 -DDIRSWGLAEGSLLTNFESEKTGIINTLSINQDDVLFAGGDNGVLSFYDY 378

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 55/136 (40%), Gaps = 24/136 (17%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H   +R V+  P  +L+A    DS + +W                       + ++ ++ 
Sbjct: 223 HLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRT------------------RIPVITLV- 263

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH+  +  +  +     + S S D +V +W    D    + + VL  H + V+    HP+
Sbjct: 264 GHKGPINQVQCTPVDPQVVSSSTDATVRLW----DVVAGKTMKVLTHHKRSVRATALHPK 319

Query: 179 LPLLASSSYDDTIRLW 194
              +AS+  DD IR W
Sbjct: 320 EFSVASACTDD-IRSW 334

 Score = 32.0 bits (71), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 166 HSQDVKHVVWHPELPL-LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKN 224
           H+    + ++ PE+   L  + Y+  +    ++   W+ + V+NGH G V C   +   N
Sbjct: 93  HASAFVNKIFQPEVAEELIVNRYEKLLSQRPEWHAPWKLSRVINGHLGWVRCVAIDPVDN 152

Query: 225 GESIRLCSGSDDSTVRVW 242
              I   +GS+D+T++VW
Sbjct: 153 EWFI---TGSNDTTMKVW 167

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 77/165 (46%), Gaps = 18/165 (10%)

Query: 124 VKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLA 183
           ++ + +S DG  L++ + DK + IW    D E  + +  L+ H QD+  + + P    L 
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIW----DLETKKIVMTLKGHEQDIYSLDYFPSGNKLV 464

Query: 184 SSSYDDTIRLWKDYDDDWECAAVLNGHEG--TVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           S S D T+R+W        C+  L+  +G  TV  S       GE   + +GS D TVRV
Sbjct: 465 SGSGDRTVRIWD--LTTGTCSLTLSIEDGVTTVAVSP------GEGKFIAAGSLDRTVRV 516

Query: 242 WRYIDDDEDGQQEWI-CEAILPKVHDRQIYSVSWSTNGLIASTGS 285
           W   D D     E +  E  L   H   +YSV ++ +G    +GS
Sbjct: 517 W---DSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGS 558

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 96/249 (38%), Gaps = 30/249 (12%)

Query: 4   KLAKSLKLQNDKLWSLDY--SHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKK 61
           K+  +LK     ++SLDY  S   L +GS DR ++I ++T    G  SL   ++D     
Sbjct: 439 KIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTT---GTCSLTLSIED----- 490

Query: 62  AIRCVAWRP-HSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGH 120
            +  VA  P     +AAGS D TV +W                  T            GH
Sbjct: 491 GVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGT------------GH 538

Query: 121 ENEVKGIAWSHDGALLSSCSRDKSVWIWETDQ-DGEE--YECISVLQEHSQDVKHVVWHP 177
            + V  + ++ DG  + S S D+SV +W  +   G++   EC      H   V  V    
Sbjct: 539 RDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQ 598

Query: 178 ELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGK--NGESIRLCSGSD 235
               + S S D  +  W     +     +L GH  +V       G     E     +GS 
Sbjct: 599 NDEYILSGSKDRGVLFWDTKSGN--PLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSG 656

Query: 236 DSTVRVWRY 244
           D   R+W+Y
Sbjct: 657 DCKARIWKY 665

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 73/189 (38%), Gaps = 40/189 (21%)

Query: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMD-LLAIIEGHE 121
           IR V + P    LA G+ D  + IW                     LE   ++  ++GHE
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIW--------------------DLETKKIVMTLKGHE 448

Query: 122 NEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPL 181
            ++  + +   G  L S S D++V IW    D     C   L          V   E   
Sbjct: 449 QDIYSLDYFPSGNKLVSGSGDRTVRIW----DLTTGTCSLTLSIEDGVTTVAVSPGEGKF 504

Query: 182 LASSSYDDTIRLW--------KDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSG 233
           +A+ S D T+R+W        +  D + E      GH  +V+   F +   G    + SG
Sbjct: 505 IAAGSLDRTVRVWDSDTGFLVERLDSENELGT---GHRDSVYSVVFTRDGKG----VVSG 557

Query: 234 SDDSTVRVW 242
           S D +V++W
Sbjct: 558 SLDRSVKLW 566

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 92/228 (40%), Gaps = 42/228 (18%)

Query: 25  LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTV 84
            LATG+ D+ I+I ++            V+    H++ I  + + P  N L +GS D TV
Sbjct: 420 FLATGAEDKLIRIWDLETK-------KIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTV 472

Query: 85  SIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSH-DGALLSSCSRDK 143
            IW                 TT +  + L       E+ V  +A S  +G  +++ S D+
Sbjct: 473 RIW---------------DLTTGTCSLTL-----SIEDGVTTVAVSPGEGKFIAAGSLDR 512

Query: 144 SVWIWETDQDGEEYECISVLQE----HSQDVKHVVWHPELPLLASSSYDDTIRLWK---- 195
           +V +W++D  G   E +    E    H   V  VV+  +   + S S D +++LW     
Sbjct: 513 TVRVWDSD-TGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGL 571

Query: 196 -DYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
                  EC     GH+  V        +N E I   SGS D  V  W
Sbjct: 572 SGQKSHAECEVTYTGHKDFVLS--VATTQNDEYI--LSGSKDRGVLFW 615

>Scas_713.50
          Length = 983

 Score = 54.7 bits (130), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 93/244 (38%), Gaps = 40/244 (16%)

Query: 16  LWSLDYSH--GLLATGSTDRKIKIIN-------VTNAPRGQVSLMDVLDDTVHKKA--IR 64
           +WSLD +     L TGS D+ +K  N       V       V  + +  DT  + +  I 
Sbjct: 514 IWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLELSDDIL 573

Query: 65  CVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEV 124
            V   P    LA    D+TV ++                       M     + GH+  V
Sbjct: 574 SVRVSPEDKFLAVSLLDNTVKVFFLDS-------------------MKFFLSLYGHKLPV 614

Query: 125 KGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLAS 184
             I  S D  ++ + S DK++ IW  D      +C   L  H   + +V + PE     S
Sbjct: 615 LSIDISFDSKMIITSSADKNIKIWGLDFG----DCHKSLFAHQDSIMNVKFVPESHNFFS 670

Query: 185 SSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRY 244
            S D  I+ W    D +EC   L  H+  VW          ++  + S S D ++R+W  
Sbjct: 671 CSKDGIIKYWD--GDKFECIQKLAAHQSEVWALAIA----NDASFVVSSSHDHSIRIWEE 724

Query: 245 IDDD 248
            +D+
Sbjct: 725 TEDE 728

 Score = 35.0 bits (79), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 63/139 (45%), Gaps = 18/139 (12%)

Query: 116 IIEGHENEVKGIAWSHDGALLSSCSRDKSV--WIWETDQD---GEEYECISVLQEH---- 166
           I E H+  +  +  + DG  L + S DKSV  W ++ +Q+   G   + +  L  H    
Sbjct: 506 IEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTT 565

Query: 167 ---SQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGK 223
              S D+  V   PE   LA S  D+T++++  + D  +    L GH+  V   D     
Sbjct: 566 LELSDDILSVRVSPEDKFLAVSLLDNTVKVF--FLDSMKFFLSLYGHKLPVLSIDI---- 619

Query: 224 NGESIRLCSGSDDSTVRVW 242
           + +S  + + S D  +++W
Sbjct: 620 SFDSKMIITSSADKNIKIW 638

 Score = 28.9 bits (63), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 70/185 (37%), Gaps = 48/185 (25%)

Query: 72  SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSH 131
           +NLLA G  D  V +W                   +     +L  + GH + +  + +  
Sbjct: 118 TNLLAVGYNDGVVKVW-------------------DLYSKTVLCNLNGHSSAITALKFDT 158

Query: 132 DGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW----------HPELPL 181
            G  L S SRD ++ +W+   +   Y+    L+ H +D    +W            EL  
Sbjct: 159 SGTRLISGSRDSNIIVWDLVSEVGLYK----LRSH-KDAITGIWCNEVTNNNQEENELDW 213

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIR---LCSGSDDST 238
           L S+S D  I++W D     +C      H G  W           ++R   + + S DS 
Sbjct: 214 LISTSKDGLIKIW-DLKIQ-QCVETHIAHTGECWSL---------AVRNDLVITTSSDSQ 262

Query: 239 VRVWR 243
           V+ W+
Sbjct: 263 VKFWQ 267

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 95/243 (39%), Gaps = 40/243 (16%)

Query: 16  LWSLDYSH--GLLATGSTDRKIKI--INVTNA--PRGQVSLMDVLD---DTVHKKA--IR 64
           +WSLD +     L TGS D+ +K     V N+  P  +   + VL    DT  +    I 
Sbjct: 476 IWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDIL 535

Query: 65  CVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEV 124
           CV   P    LA    D+TV ++                       M     + GH+  V
Sbjct: 536 CVRVSPDDRYLAISLLDNTVKVFFLD-------------------SMKFYLSLYGHKLPV 576

Query: 125 KGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLAS 184
             I  S D  ++ + S DK++ IW  D      +C   L  H   + +V + P+     S
Sbjct: 577 LSIDISFDSKMIITSSADKNIKIWGLDFG----DCHKSLFAHQDSIMNVKFLPQSHNFFS 632

Query: 185 SSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRY 244
            S D  ++ W    + +EC   L  H+  VW        +G  +   S S D ++R+W  
Sbjct: 633 CSKDAVVKYWD--GEKFECIQKLYAHQSEVWA--LAVATDGGFV--VSSSHDHSIRIWEE 686

Query: 245 IDD 247
            +D
Sbjct: 687 TED 689

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 48/122 (39%), Gaps = 18/122 (14%)

Query: 130 SHDGALLSSCSRDKSVWIWETD------QDGEEYECISVLQEHSQDVKHVVWHPELPLLA 183
           S  G L++S   D ++W  +T        DG              +  ++  H +  LLA
Sbjct: 36  SGPGQLITSALEDVNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLA 95

Query: 184 SSSYDDTIRLWKDYDDDWECAAVL---NGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
               D  I++W     D     VL   NGH+  +    F+    G   RL SGS DS + 
Sbjct: 96  VGYADGVIKVW-----DLMSKTVLLNFNGHKAAITLLQFD----GTGTRLISGSKDSNII 146

Query: 241 VW 242
           VW
Sbjct: 147 VW 148

 Score = 32.0 bits (71), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 65/143 (45%), Gaps = 19/143 (13%)

Query: 113 LLAIIE-GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQD-----GEEYECISVLQEH 166
           LL  IE  H+  +  +  + DG  L + S DK+V  W+   +     G + + + VL+ H
Sbjct: 464 LLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLH 523

Query: 167 -------SQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDF 219
                  + D+  V   P+   LA S  D+T++++  + D  +    L GH+  V   D 
Sbjct: 524 HDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVF--FLDSMKFYLSLYGHKLPVLSIDI 581

Query: 220 EKGKNGESIRLCSGSDDSTVRVW 242
               + +S  + + S D  +++W
Sbjct: 582 ----SFDSKMIITSSADKNIKIW 600

>KLLA0F10791g complement(991642..993279) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 545

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 82/184 (44%), Gaps = 20/184 (10%)

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           E H+ EV G+++  DG  L+S + D +V IW+T Q+ +    I   + H   VK + WHP
Sbjct: 330 ERHQGEVCGLSFREDGIQLASGANDNTVMIWDTRQNNDP---IWTKRNHKAAVKAISWHP 386

Query: 178 ELP-LLAS--SSYDDTIRLWKDYDDDWECAAVLNGHEGTV--WCSDFEK--GKNGESIRL 230
           E+  LLA+   S D  I  W     +     +  G + +   W   + K  G     I  
Sbjct: 387 EITNLLATGGGSLDKHIHFWNTTTGN-RLGTIDTGSQVSSLHWGQSYSKHSGCMDTEIVA 445

Query: 231 CSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTL 289
             G+ ++ + ++ Y        +     A + + HD +I S   S +G  IAS G D  L
Sbjct: 446 TGGTPNNCITIYNY--------ETKFKVAEIQQAHDSRIVSSQLSPDGTTIASVGGDENL 497

Query: 290 AVYK 293
             Y+
Sbjct: 498 KFYR 501

 Score = 28.5 bits (62), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 3/32 (9%)

Query: 59  HKKAIRCVAWRPH-SNLLA--AGSFDSTVSIW 87
           HK A++ ++W P  +NLLA   GS D  +  W
Sbjct: 375 HKAAVKAISWHPEITNLLATGGGSLDKHIHFW 406

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 53.5 bits (127), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 87/204 (42%), Gaps = 46/204 (22%)

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
            H   ++ +A+S + +   +CS D  + IW      +E     VL  H  DVK   WHPE
Sbjct: 175 AHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQE----RVLSGHHWDVKSCDWHPE 230

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
           + L+AS+S D+ ++LW     +  C + +   + TV  + F+  K      L + S D +
Sbjct: 231 MGLIASASKDNLVKLWDPRSGN--CISSILKFKHTVLKTRFQPTKGN---LLMAISKDKS 285

Query: 239 VRVW--RY-------IDDDEDGQQ-EW-------------------------ICEAIL-- 261
            RV+  RY       + D+ D    EW                         + E IL  
Sbjct: 286 CRVFDIRYSMKELMCVRDETDYMTLEWHPINESMFTLACYDGSLKHFDLLQNLNEPILTI 345

Query: 262 PKVHDRQIYSVSWSTNGLIASTGS 285
           P  HD+ I S+S++  G I +T +
Sbjct: 346 PYAHDKCITSLSYNPVGHIFATAA 369

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 64/124 (51%), Gaps = 7/124 (5%)

Query: 121 ENEVKGIAWSHDGALLSSCSRDKSVWIWETDQ--DGEEYECISVLQEHSQDVKHVVWHPE 178
           +  ++ ++ + DG++L++ +   + ++WE     D    + ++  + HS  +  ++   +
Sbjct: 159 DTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSD 218

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
           +  LA+ S D T R+W   DDD++    L+GH+  VW   F    + +S  L + S D  
Sbjct: 219 VKHLATCSADHTARVWS-IDDDFKLETTLDGHQRWVWDCAF----SADSAYLVTASSDHY 273

Query: 239 VRVW 242
           VR+W
Sbjct: 274 VRLW 277

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 5/81 (6%)

Query: 114 LAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV 173
           +A  EGH   V  +++  D   + + S D ++ +W+          I    +H+  V  V
Sbjct: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV-----RSPSIPRNYKHNAPVNEV 122

Query: 174 VWHPELPLLASSSYDDTIRLW 194
           V HP    L S   D  IR+W
Sbjct: 123 VIHPNQGELISCDRDGNIRIW 143

 Score = 31.6 bits (70), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 39/89 (43%), Gaps = 3/89 (3%)

Query: 106 TNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQE 165
           T++  +  +     H   +  I  S D   L++CS D +  +W  D D   ++  + L  
Sbjct: 192 TDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD---FKLETTLDG 248

Query: 166 HSQDVKHVVWHPELPLLASSSYDDTIRLW 194
           H + V    +  +   L ++S D  +RLW
Sbjct: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLW 277

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 96/208 (46%), Gaps = 34/208 (16%)

Query: 16  LWSLDYSHG-LLATGSTDRKIKIINV-----TNAPRGQVSLMDVLDDTVHKKAIRCVAWR 69
           +W+L Y+HG +L +GSTDR +++ ++     T+  +G            H   +RC+   
Sbjct: 425 VWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFKG------------HNSTVRCLDIV 472

Query: 70  PHSNL--LAAGSFDSTVSIW--TRXXXXXXXXXXXXXXXTTNSLEMD--LLAIIEGHENE 123
            + N+  +  GS D+T+ +W   +                 ++ E +   + ++ GH   
Sbjct: 473 EYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMAS 532

Query: 124 VKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLA 183
           V+ +  S  G ++ S S D ++ +W+  Q     +C+ +L  H+  +   ++  E     
Sbjct: 533 VRTV--SGHGNIVVSGSYDNTLIVWDVAQ----MKCLYILSGHTDRIYSTIYDHERKRCI 586

Query: 184 SSSYDDTIRLWKDYDDDW---ECAAVLN 208
           S+S D TIR+W D ++ W   EC+   N
Sbjct: 587 SASMDTTIRIW-DLENIWNNGECSYATN 613

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 70/158 (44%), Gaps = 34/158 (21%)

Query: 108 SLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHS 167
           S+    L  + GH+  V  + ++H G L+S  S D++V +W+  +      C  V + H+
Sbjct: 409 SINKKFLLQLSGHDGGVWALKYAHGGILVSG-STDRTVRVWDIKKGC----CTHVFKGHN 463

Query: 168 QDVK--HVVWHPELPLLASSSYDDTIRLWK--------------DY-------DDDWECA 204
             V+   +V +  +  + + S D+T+ +WK              DY       +++    
Sbjct: 464 STVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFV 523

Query: 205 AVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
            VL GH  +V      +  +G    + SGS D+T+ VW
Sbjct: 524 GVLRGHMASV------RTVSGHGNIVVSGSYDNTLIVW 555

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
           +L S S D T+R+W D      C  V  GH  TV C D  + KN + I   +GS D+T+ 
Sbjct: 435 ILVSGSTDRTVRVW-DIKKGC-CTHVFKGHNSTVRCLDIVEYKNIKYI--VTGSRDNTLH 490

Query: 241 VWR 243
           VW+
Sbjct: 491 VWK 493

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 102/232 (43%), Gaps = 24/232 (10%)

Query: 117 IEGHENEVKGIAWSHDGA-LLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW 175
           ++ H  ++  I W  D    + SC+ D  +  ++   +      +  L  H + +  V +
Sbjct: 214 LDSHVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSNEEGGLRLLGDLVGHERRISDVKY 273

Query: 176 HPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSD 235
           HP    + S+S+D T RLW D     E   +  GH+  V+   F+     +   +CSG  
Sbjct: 274 HPSGKFIGSASHDMTWRLW-DASTHQEL-LLQEGHDKGVFSLSFQ----CDGSLVCSGGM 327

Query: 236 DSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGL-IASTGSDGTLAVYKE 294
           DS   +W    D   G +           H + IY+V+WS NG  +A+ G DG + V+ +
Sbjct: 328 DSLSMLW----DIRSGSKVMTLAG-----HSKPIYTVAWSPNGYQVATGGGDGIINVW-D 377

Query: 295 VSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWN 346
           +   D+    +++A + +         V++   +G   L + G D  +N+++
Sbjct: 378 IRKRDEGQLNQILAHRNIV------TQVRFSKEDGGKKLVSCGYDNLINVYS 423

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 69/182 (37%), Gaps = 24/182 (13%)

Query: 51  MDVLDDTV-HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSL 109
           + +L D V H++ I  V + P    + + S D T  +W                    S 
Sbjct: 255 LRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLW------------------DAST 296

Query: 110 EMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQD 169
             +LL + EGH+  V  +++  DG+L+ S   D    +W+     +    +  L  HS+ 
Sbjct: 297 HQELL-LQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSK----VMTLAGHSKP 351

Query: 170 VKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIR 229
           +  V W P    +A+   D  I +W     D      +  H   V    F K   G+ + 
Sbjct: 352 IYTVAWSPNGYQVATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLV 411

Query: 230 LC 231
            C
Sbjct: 412 SC 413

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 52/138 (37%), Gaps = 23/138 (16%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H K I  VAW P+   +A G  D  +++W                      +   L  I 
Sbjct: 348 HSKPIYTVAWSPNGYQVATGGGDGIINVW-----------------DIRKRDEGQLNQIL 390

Query: 119 GHENEVKGIAWSHD--GALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
            H N V  + +S +  G  L SC  D  + ++ +D     +  +  L  H+  +  +   
Sbjct: 391 AHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYSSD----TWLKMGSLAGHTDKIISLDIS 446

Query: 177 PELPLLASSSYDDTIRLW 194
                L S  +D +I+LW
Sbjct: 447 NNSHFLVSGGWDRSIKLW 464

>Scas_652.16
          Length = 345

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 93/205 (45%), Gaps = 29/205 (14%)

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW-HP 177
           GHE+ +  + +   G  +++CS D+ + +++ D++  E+E     + H   +  V W  P
Sbjct: 10  GHEDLIHDVVYDFYGRHVATCSSDQHIKVFKLDKETSEWELSDSWKAHDSSIVSVDWASP 69

Query: 178 EL-PLLASSSYDDTIRLWKDYDDD-------WECAAVLNGHEGTVWCSDFEKGKNGESIR 229
           E   ++ S+SYD T++LW++  D        W     LN  +G+++   F     G  ++
Sbjct: 70  EYGRIIVSASYDKTVKLWEEDPDQPEGSGRRWTKLCTLNDSKGSLYTVKFAPPHLG--LK 127

Query: 230 LCSGSDDSTVRVWRYIDDDEDGQQEWICE----AILPKVHDRQIYSVSW-----STNGLI 280
           L    +D+T+R++  ++  +        E     + P  H +  + ++W     S   L+
Sbjct: 128 LACIGNDATLRIYEALEPSDLRSWTLTSEVKVLPVPPANHLQSDFCIAWCPSRFSPEKLV 187

Query: 281 AST---------GSDGTLAVYKEVS 296
            ST         G DG L +  +++
Sbjct: 188 VSTLDQASIYQRGKDGKLYIVAKLN 212

 Score = 34.7 bits (78), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 107 NSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEH 166
           +S+ ++LL+  + H  E+  ++W+  G +LSS   D  V +W++     E++C+SV+  +
Sbjct: 286 SSVSVELLSEHDDHNAEIWSVSWNLTGTILSSAGDDGKVRLWKSTY-SNEFKCMSVITSN 344

Query: 167 S 167
           S
Sbjct: 345 S 345

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 69/320 (21%), Positives = 118/320 (36%), Gaps = 58/320 (18%)

Query: 20  DYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDD-TVHKKAIRCVAWRP--HSNLLA 76
           D+    +AT S+D+ IK+  +      + S  ++ D    H  +I  V W    +  ++ 
Sbjct: 21  DFYGRHVATCSSDQHIKVFKLDK----ETSEWELSDSWKAHDSSIVSVDWASPEYGRIIV 76

Query: 77  AGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALL 136
           + S+D TV +W                  T       L   +G    VK  A  H G  L
Sbjct: 77  SASYDKTVKLWEEDPDQPEGSGRRWTKLCT-------LNDSKGSLYTVK-FAPPHLGLKL 128

Query: 137 SSCSRDKSVWIWETDQDGE--------EYECISVLQ-EHSQDVKHVVWHPEL---PLLAS 184
           +    D ++ I+E  +  +        E + + V    H Q    + W P       L  
Sbjct: 129 ACIGNDATLRIYEALEPSDLRSWTLTSEVKVLPVPPANHLQSDFCIAWCPSRFSPEKLVV 188

Query: 185 SSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRY 244
           S+ D      +  D      A LNGH+G +    +          + +G  D  +R++R 
Sbjct: 189 STLDQASIYQRGKDGKLYIVAKLNGHKGLIRDISWAPSIGRWYHLIATGCKDGKLRIFRL 248

Query: 245 ID---------------DDEDGQQEWICEAILPKV---------------HDRQIYSVSW 274
           ++               DDED   E I E     +               H+ +I+SVSW
Sbjct: 249 VEKLSDNSSKDAINDSYDDEDVDMEDIAENKEKSLLGSSVSVELLSEHDDHNAEIWSVSW 308

Query: 275 STNG-LIASTGSDGTLAVYK 293
           +  G +++S G DG + ++K
Sbjct: 309 NLTGTILSSAGDDGKVRLWK 328

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 32/157 (20%), Positives = 62/157 (39%), Gaps = 31/157 (19%)

Query: 59  HKKAIRCVAWRPH----SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLL 114
           HK  IR ++W P      +L+A G  D  + I+                 + +  ++D+ 
Sbjct: 214 HKGLIRDISWAPSIGRWYHLIATGCKDGKLRIFRLVEKLSDNSSKDAINDSYDDEDVDME 273

Query: 115 AIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVV 174
            I E  E  + G + S                           E +S   +H+ ++  V 
Sbjct: 274 DIAENKEKSLLGSSVS--------------------------VELLSEHDDHNAEIWSVS 307

Query: 175 WHPELPLLASSSYDDTIRLWKD-YDDDWECAAVLNGH 210
           W+    +L+S+  D  +RLWK  Y ++++C +V+  +
Sbjct: 308 WNLTGTILSSAGDDGKVRLWKSTYSNEFKCMSVITSN 344

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 80/169 (47%), Gaps = 26/169 (15%)

Query: 124 VKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLA 183
           ++ + +S DG  L++ + D+ + IW    D E  + + +LQ H QD+  + + P    L 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIW----DIENRKIVMILQGHEQDIYSLDYFPSGDKLV 501

Query: 184 SSSYDDTIRLWKDYDDDWECAAVLNGHEG--TVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           S S D T+R+W       +C+  L+  +G  TV  S       G+   + +GS D  VRV
Sbjct: 502 SGSGDRTVRIWDLR--TGQCSLTLSIEDGVTTVAVSP------GDGKYIAAGSLDRAVRV 553

Query: 242 WRYIDDDEDGQQEWICEAILPKV-----HDRQIYSVSWSTNGLIASTGS 285
           W    D E G   ++ E +  +      H   +YSV ++ +G    +GS
Sbjct: 554 W----DSETG---FLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGS 595

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 77/188 (40%), Gaps = 38/188 (20%)

Query: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHEN 122
           IR V + P    LA G+ D  + IW                   +     ++ I++GHE 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIW-------------------DIENRKIVMILQGHEQ 486

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182
           ++  + +   G  L S S D++V IW    D    +C   L          V   +   +
Sbjct: 487 DIYSLDYFPSGDKLVSGSGDRTVRIW----DLRTGQCSLTLSIEDGVTTVAVSPGDGKYI 542

Query: 183 ASSSYDDTIRLW--------KDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGS 234
           A+ S D  +R+W        +  D + E      GH+ +V+   F   ++G+S+   SGS
Sbjct: 543 AAGSLDRAVRVWDSETGFLVERLDSENESGT---GHKDSVYSVVFT--RDGQSV--VSGS 595

Query: 235 DDSTVRVW 242
            D +V++W
Sbjct: 596 LDRSVKLW 603

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 92/254 (36%), Gaps = 35/254 (13%)

Query: 4   KLAKSLKLQNDKLWSLDY--SHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKK 61
           K+   L+     ++SLDY  S   L +GS DR ++I ++     GQ SL   ++D     
Sbjct: 476 KIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRT---GQCSLTLSIED----- 527

Query: 62  AIRCVAWRP-HSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGH 120
            +  VA  P     +AAGS D  V +W                  T            GH
Sbjct: 528 GVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGT------------GH 575

Query: 121 ENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYE--------CISVLQEHSQDVKH 172
           ++ V  + ++ DG  + S S D+SV +W       + +        C      H   V  
Sbjct: 576 KDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLS 635

Query: 173 VVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGK--NGESIRL 230
           V        + S S D  +  W     +     +L GH  +V       G     E    
Sbjct: 636 VATTQNDEYILSGSKDRGVLFWDKKSGN--PLLMLQGHRNSVISVAVANGSPLGPEYNVF 693

Query: 231 CSGSDDSTVRVWRY 244
            +GS D   R+W+Y
Sbjct: 694 ATGSGDCKARIWKY 707

 Score = 36.6 bits (83), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 93/233 (39%), Gaps = 47/233 (20%)

Query: 25  LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTV 84
            LATG+ DR I+I ++ N  R  V ++       H++ I  + + P  + L +GS D TV
Sbjct: 457 FLATGAEDRLIRIWDIEN--RKIVMILQG-----HEQDIYSLDYFPSGDKLVSGSGDRTV 509

Query: 85  SIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSH-DGALLSSCSRDK 143
            IW                     L     ++    E+ V  +A S  DG  +++ S D+
Sbjct: 510 RIW--------------------DLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDR 549

Query: 144 SVWIWETDQDGEEYECISVLQE----HSQDVKHVVWHPELPLLASSSYDDTIRLWK---- 195
           +V +W+++  G   E +    E    H   V  VV+  +   + S S D +++LW     
Sbjct: 550 AVRVWDSET-GFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNA 608

Query: 196 ------DYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
                    +   C     GH+  V        +N E I   SGS D  V  W
Sbjct: 609 NNKSDSKTPNSGTCEVTYIGHKDFVLS--VATTQNDEYI--LSGSKDRGVLFW 657

>CAGL0J08778g 866175..867071 highly similar to sp|Q04491
           Saccharomyces cerevisiae YLR208w SEC13, start by
           similarity
          Length = 298

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 118/297 (39%), Gaps = 79/297 (26%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           ++ I   H + +      + G  L++CS DK++ I+E +  GE ++ +  L  H   V  
Sbjct: 1   MVEIANAHNDLIHDAVLDYYGKKLATCSSDKTIKIFEVE--GESHKLVDTLVGHEGPVWR 58

Query: 173 VVW-HPEL-PLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTV---------------- 214
           V W HP+   +LAS SYD  + +WK+ +D W   AV   H  +V                
Sbjct: 59  VDWAHPKFGTILASCSYDGKVIIWKEENDRWSQIAVHAVHTASVNSVQWAPHEYGALLLA 118

Query: 215 ----------------------------------WCSDFEKGKNG------ESIRLCSGS 234
                                             W     +G N       E  R  +G 
Sbjct: 119 ASSDGKVSVVEFKENGTATPLIFDAHAIGVNAASWAPATVEGGNNPGEAPKEVRRFVTGG 178

Query: 235 DDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGL----IASTGSDGTLA 290
            D+ V++WRY  +     Q ++ E  L + H   +  V+WS + L    IAS   D T  
Sbjct: 179 ADNLVKIWRYNPE----TQSYLVEDTL-EGHSDWVRDVAWSPSVLLRSYIASVSQDRTCN 233

Query: 291 VYKEVSNGDDEHDW--EVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLW 345
           ++ +    D+   W    +  +E    ++ A+   W  ++GN++  +GGD+  V LW
Sbjct: 234 IWTQ---EDNTGPWVKTQLTPEEFPDVLWRAS---W-SLSGNILAISGGDNK-VTLW 282

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 123/310 (39%), Gaps = 52/310 (16%)

Query: 19  LDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAW--RPHSNLLA 76
           LDY    LAT S+D+ IKI  V         L+D L    H+  +  V W       +LA
Sbjct: 17  LDYYGKKLATCSSDKTIKIFEVEGESH---KLVDTL--VGHEGPVWRVDWAHPKFGTILA 71

Query: 77  AGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWS-HD-GA 134
           + S+D  V IW                          +A+   H   V  + W+ H+ GA
Sbjct: 72  SCSYDGKVIIWKEEND-----------------RWSQIAVHAVHTASVNSVQWAPHEYGA 114

Query: 135 LLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP--------------ELP 180
           LL + S D  V + E  ++G     I     H+  V    W P              E+ 
Sbjct: 115 LLLAASSDGKVSVVEFKENGTATPLI--FDAHAIGVNAASWAPATVEGGNNPGEAPKEVR 172

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEG-TVWCSDFEKGKNGESIR--LCSGSDDS 237
              +   D+ +++W+ Y+ + +   V +  EG + W  D     +   +R  + S S D 
Sbjct: 173 RFVTGGADNLVKIWR-YNPETQSYLVEDTLEGHSDWVRDVAWSPS-VLLRSYIASVSQDR 230

Query: 238 TVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVYKEVS 296
           T  +W      ED    W+   + P+     ++  SWS +G ++A +G D  + ++KE  
Sbjct: 231 TCNIWT----QEDNTGPWVKTQLTPEEFPDVLWRASWSLSGNILAISGGDNKVTLWKENL 286

Query: 297 NGDDEHDWEV 306
           NG  E   EV
Sbjct: 287 NGKWESAGEV 296

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 112/288 (38%), Gaps = 42/288 (14%)

Query: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHEN 122
           + C+ +   + L AAG  DS + +W+                  N+        + GH  
Sbjct: 424 MTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINN------TTLIGHSG 477

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182
            V   ++S D   L S S DK+V +W  D     Y  +   + H+  V  V + P     
Sbjct: 478 TVYSTSFSPDNKYLLSASEDKTVRLWSMDT----YSSLVSYKGHNHPVWDVSFSPLGHYF 533

Query: 183 ASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           A++S+D T RLW    D      +  GH   V C  F    NG  +   +GS D T R+W
Sbjct: 534 ATASHDQTARLWS--CDHIYPLRIFAGHLNDVDCVSFH--PNGTYV--FTGSTDKTCRMW 587

Query: 243 RYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGS-DGTLAVYKEVSNGDDE 301
               D   G    +        H   + S + S +G   STGS DG + V+ ++  G   
Sbjct: 588 ----DIGTGDSVRLFLG-----HTAPVISTAVSPDGRWLSTGSEDGIINVW-DIGTGKR- 636

Query: 302 HDWEVIAKQELCHG---VYEANIVKWIDINGNMMLATGGDDGCVNLWN 346
                  KQ   HG   VY  +  K        +L +GG D  V +W+
Sbjct: 637 ------LKQMRGHGKNAVYSLSYSKE-----GTVLVSGGADHSVRVWD 673

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 96/238 (40%), Gaps = 46/238 (19%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDL---LA 115
           H   +   ++ P +  L + S D TV +W+                      MD    L 
Sbjct: 475 HSGTVYSTSFSPDNKYLLSASEDKTVRLWS----------------------MDTYSSLV 512

Query: 116 IIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW 175
             +GH + V  +++S  G   ++ S D++  +W  D        + +   H  DV  V +
Sbjct: 513 SYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDH----IYPLRIFAGHLNDVDCVSF 568

Query: 176 HPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSD 235
           HP    + + S D T R+W     D     +  GH   V  +      + +   L +GS+
Sbjct: 569 HPNGTYVFTGSTDKTCRMWDIGTGD--SVRLFLGHTAPVIST----AVSPDGRWLSTGSE 622

Query: 236 DSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQ-IYSVSWSTNG-LIASTGSDGTLAV 291
           D  + VW      + G  + + +    + H +  +YS+S+S  G ++ S G+D ++ V
Sbjct: 623 DGIINVW------DIGTGKRLKQM---RGHGKNAVYSLSYSKEGTVLVSGGADHSVRV 671

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 57/137 (41%), Gaps = 24/137 (17%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H   + CV++ P+   +  GS D T  +W                 T +S+ + L     
Sbjct: 559 HLNDVDCVSFHPNGTYVFTGSTDKTCRMW--------------DIGTGDSVRLFL----- 599

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQD-VKHVVWHP 177
           GH   V   A S DG  LS+ S D  + +W+        + +  ++ H ++ V  + +  
Sbjct: 600 GHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTG----KRLKQMRGHGKNAVYSLSYSK 655

Query: 178 ELPLLASSSYDDTIRLW 194
           E  +L S   D ++R+W
Sbjct: 656 EGTVLVSGGADHSVRVW 672

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 78/165 (47%), Gaps = 18/165 (10%)

Query: 124 VKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLA 183
           ++ + +S DG  L++ + DK + IW    D E+ + + VL+ H QD+  + + P    L 
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIW----DIEQKKIVMVLKGHEQDIYSLDYFPSGDKLV 613

Query: 184 SSSYDDTIRLWKDYDDDWECAAVLNGHEG--TVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           S S D T+R+W       +C   L+  +G  TV  S       G+   + +GS D  VRV
Sbjct: 614 SGSGDRTVRIWD--LKTGQCTLTLSIEDGVTTVAVSP------GDGKFIAAGSLDRAVRV 665

Query: 242 WRYIDDDEDGQQEWI-CEAILPKVHDRQIYSVSWSTNGLIASTGS 285
           W   D D     E +  E  L   H   +YSV ++ +G    +GS
Sbjct: 666 W---DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGS 707

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 77/188 (40%), Gaps = 38/188 (20%)

Query: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHEN 122
           IR V + P    LA G+ D  + IW                   +  +  ++ +++GHE 
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIW-------------------DIEQKKIVMVLKGHEQ 598

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182
           ++  + +   G  L S S D++V IW    D +  +C   L          V   +   +
Sbjct: 599 DIYSLDYFPSGDKLVSGSGDRTVRIW----DLKTGQCTLTLSIEDGVTTVAVSPGDGKFI 654

Query: 183 ASSSYDDTIRLW--------KDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGS 234
           A+ S D  +R+W        +  D + E      GH+ +V+   F +  NG    + SGS
Sbjct: 655 AAGSLDRAVRVWDSDTGFLVERLDSENELG---TGHKDSVYSVVFTRDGNG----VVSGS 707

Query: 235 DDSTVRVW 242
            D +V++W
Sbjct: 708 LDRSVKLW 715

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 63/255 (24%), Positives = 98/255 (38%), Gaps = 35/255 (13%)

Query: 4   KLAKSLKLQNDKLWSLDY--SHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKK 61
           K+   LK     ++SLDY  S   L +GS DR ++I ++     GQ +L   ++D     
Sbjct: 588 KIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKT---GQCTLTLSIED----- 639

Query: 62  AIRCVAWRP-HSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGH 120
            +  VA  P     +AAGS D  V +W                  T            GH
Sbjct: 640 GVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGT------------GH 687

Query: 121 ENEVKGIAWSHDGALLSSCSRDKSVWIWE------TDQDGEEYE--CISVLQEHSQDVKH 172
           ++ V  + ++ DG  + S S D+SV +W        + DG+     C      H   V  
Sbjct: 688 KDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLS 747

Query: 173 VVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKN-GESIRL- 230
           V    +   + S S D  +  W     +     +L GH  +V       G   G +  + 
Sbjct: 748 VATTEDDEYILSGSKDRGVLFWDKVSGNPLL--MLQGHRNSVISVAVNHGHPLGPNYHIF 805

Query: 231 CSGSDDSTVRVWRYI 245
            +GS D   R+W+YI
Sbjct: 806 ATGSGDCKARIWKYI 820

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 77/175 (44%), Gaps = 33/175 (18%)

Query: 25  LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTV 84
            LATG+ D+ I+I ++      Q  ++ VL    H++ I  + + P  + L +GS D TV
Sbjct: 569 FLATGAEDKLIRIWDIE-----QKKIVMVLKG--HEQDIYSLDYFPSGDKLVSGSGDRTV 621

Query: 85  SIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSH-DGALLSSCSRDK 143
            IW                     L+     +    E+ V  +A S  DG  +++ S D+
Sbjct: 622 RIW--------------------DLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDR 661

Query: 144 SVWIWETDQDGEEYECISVLQE----HSQDVKHVVWHPELPLLASSSYDDTIRLW 194
           +V +W++D  G   E +    E    H   V  VV+  +   + S S D +++LW
Sbjct: 662 AVRVWDSD-TGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLW 715

>Kwal_55.22067
          Length = 451

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 78/186 (41%), Gaps = 30/186 (16%)

Query: 58  VHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
            H  A+  + +    + L +G  D T+ IW                        +++ ++
Sbjct: 123 AHDSAVAVMKYSHAGDWLISGDSDGTIKIW--------------------QPNFNMVKVL 162

Query: 118 -EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
            E H   ++GI++S   +   +CS D  + IW      +E    S L  H  DV+   WH
Sbjct: 163 DEAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQE----STLSGHHWDVRSCDWH 218

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDD 236
           P + L+AS S D+ ++LW       +C + + G + T+  + F+  K      L   S D
Sbjct: 219 PTMGLIASGSKDNLVKLWDPRAG--QCISTILGCKHTIISTKFQPTKGN---MLAVISKD 273

Query: 237 STVRVW 242
            + R++
Sbjct: 274 KSCRIF 279

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 75/190 (39%), Gaps = 41/190 (21%)

Query: 167 SQDVKHVV----WHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG 222
           S  VKHV+    W PE   L  ++Y     LW     ++E  +++  H+  V    +   
Sbjct: 79  SNKVKHVIPALEWTPEGRRLVVATYSGEFSLWNGSTFNFE--SIMQAHDSAVAVMKYSHA 136

Query: 223 KNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWS-TNGLIA 281
            +     L SG  D T+++W         Q  +    +L + H + I  +S+S T+    
Sbjct: 137 GDW----LISGDSDGTIKIW---------QPNFNMVKVLDEAHTQCIRGISFSGTDSKFV 183

Query: 282 STGSDGTLAVYKEVSNGDDE-----HDWEVIAKQELCHGVYEANIVKWIDINGNMMLATG 336
           +   D  L ++   SNG  E     H W+V +               W    G  ++A+G
Sbjct: 184 TCSDDNILKIW-NFSNGQQESTLSGHHWDVRS-------------CDWHPTMG--LIASG 227

Query: 337 GDDGCVNLWN 346
             D  V LW+
Sbjct: 228 SKDNLVKLWD 237

 Score = 32.3 bits (72), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 86/228 (37%), Gaps = 32/228 (14%)

Query: 24  GLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRP-HSNLLAAGSFDS 82
           GL+A+GS D  +K+ +    PR    +  +L     K  I    ++P   N+LA  S D 
Sbjct: 222 GLIASGSKDNLVKLWD----PRAGQCISTILG---CKHTIISTKFQPTKGNMLAVISKDK 274

Query: 83  TVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRD 142
           +  I+                      E D +++     NE       +DG++       
Sbjct: 275 SCRIFDIRQNMKELAVYRD--------ESDYMSLTWHPINESMFTVGCYDGSM------- 319

Query: 143 KSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW---KDYDD 199
           K   + +  QD       ++   H + +  + ++P   +LAS+S D TIR W   + YD 
Sbjct: 320 KHFDLLQEPQDSSSGCFHNIPYAHDKCITSLAYNPVGHILASASKDRTIRFWTRARPYDP 379

Query: 200 DWECAAVLNGHEGTVWCSDFE------KGKNGESIRLCSGSDDSTVRV 241
           +       N  +   W           + K  + I L   S+DST  +
Sbjct: 380 NSFDDPTYNNKKVNAWYFGINNNINAIRPKTEDGIALPPASNDSTASI 427

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 95/219 (43%), Gaps = 36/219 (16%)

Query: 16  LWSLDYS-HGLLATGSTDRKIKIINV-----TNAPRGQVSLMDVLDDTVHKKAIRCVAWR 69
           +W+L Y+ +G+L +GSTDR ++I N+     T+  +G            H   +RC+   
Sbjct: 412 VWALKYAGNGILVSGSTDRSVRIWNIHLGKCTHVFKG------------HTSTVRCLDIV 459

Query: 70  PHSNL--LAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMD---------LLAIIE 118
            H  +  +  GS D+T+ IW                  +N+  +           + ++ 
Sbjct: 460 EHEGVKYIVTGSRDNTLHIWKLPQMSDSNIDEGMPNVYSNNGPLFFHSPEENPYFVGVLR 519

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH   V+ +  S  G ++ S S D ++ +W+  Q     +C+ +L  H+  +   ++  +
Sbjct: 520 GHIASVRTV--SGHGRIVISGSYDNNLIVWDIIQ----MKCLYILMGHTDRIYSTIYDYK 573

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCS 217
                S+S D TI++W D  + W     +N    TV C+
Sbjct: 574 RNRCISASMDSTIKIW-DLQNIWNNGECVNVTNATVPCT 611

 Score = 35.4 bits (80), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
           +L S S D ++R+W  +    +C  V  GH  TV C D  + +  + I   +GS D+T+ 
Sbjct: 422 ILVSGSTDRSVRIWNIHL--GKCTHVFKGHTSTVRCLDIVEHEGVKYI--VTGSRDNTLH 477

Query: 241 VWR 243
           +W+
Sbjct: 478 IWK 480

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 65/151 (43%), Gaps = 26/151 (17%)

Query: 197 YDDDW-ECAAVLNGH-EGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQE 254
           Y+ D+      L GH    V C  FE         + +G+DD  +R++  I       ++
Sbjct: 353 YNPDFIPQRTTLKGHMTSVVTCLQFEDN------YVITGADDKMIRIYDSI------TKK 400

Query: 255 WICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCH 314
           ++ E      HD  ++++ ++ NG++ S  +D ++ ++  +  G   H ++       C 
Sbjct: 401 FLIEL---SGHDGGVWALKYAGNGILVSGSTDRSVRIW-NIHLGKCTHVFKGHTSTVRCL 456

Query: 315 GVYEANIVKWIDINGNMMLATGGDDGCVNLW 345
            + E   VK+I         TG  D  +++W
Sbjct: 457 DIVEHEGVKYI--------VTGSRDNTLHIW 479

>Kwal_23.6429
          Length = 750

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 78/169 (46%), Gaps = 26/169 (15%)

Query: 124 VKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLA 183
           ++ + +S DG  L++ + DK + IW    D      +  LQ H QD+  + + P    L 
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIW----DLATRRIVMTLQGHEQDIYSLDYFPSGDKLV 528

Query: 184 SSSYDDTIRLWKDYDDDWECAAVLNGHEG--TVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           S S D T+R+W       +C+  L+  +G  TV  S       G+   + +GS D TVR+
Sbjct: 529 SGSGDRTVRIWDLR--TGQCSLTLSIEDGVTTVAVSP------GDGKLIAAGSLDRTVRI 580

Query: 242 WRYIDDDEDGQQEWICEAI-----LPKVHDRQIYSVSWSTNGLIASTGS 285
           W    D E G   ++ E +     L   H   +YSV ++ +G    +GS
Sbjct: 581 W----DSETG---FLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGS 622

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 76/188 (40%), Gaps = 38/188 (20%)

Query: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHEN 122
           IR V + P    LA G+ D  + IW                  T  + M L    +GHE 
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIW---------------DLATRRIVMTL----QGHEQ 513

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182
           ++  + +   G  L S S D++V IW    D    +C   L          V   +  L+
Sbjct: 514 DIYSLDYFPSGDKLVSGSGDRTVRIW----DLRTGQCSLTLSIEDGVTTVAVSPGDGKLI 569

Query: 183 ASSSYDDTIRLW--------KDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGS 234
           A+ S D T+R+W        +  D + E      GH+ +V+   F +  +G    + SGS
Sbjct: 570 AAGSLDRTVRIWDSETGFLVERLDSENELG---TGHKDSVYSVVFTRDGHG----VVSGS 622

Query: 235 DDSTVRVW 242
            D +V++W
Sbjct: 623 LDRSVKLW 630

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 98/256 (38%), Gaps = 39/256 (15%)

Query: 4   KLAKSLKLQNDKLWSLDY--SHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKK 61
           ++  +L+     ++SLDY  S   L +GS DR ++I ++     GQ SL   ++D     
Sbjct: 503 RIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRT---GQCSLTLSIED----- 554

Query: 62  AIRCVAWRPH-SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGH 120
            +  VA  P    L+AAGS D TV IW                  T            GH
Sbjct: 555 GVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGT------------GH 602

Query: 121 ENEVKGIAWSHDGALLSSCSRDKSVWIWETDQ------DGEEYECIS--VLQEHSQDVKH 172
           ++ V  + ++ DG  + S S D+SV +W          +G+     S      H   V  
Sbjct: 603 KDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLS 662

Query: 173 VVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVW----CSDFEKGKNGESI 228
           V        + S S D  +  W     +     +L GH  +V      +D   G   E  
Sbjct: 663 VATTQNDEFILSGSKDRGVLFWDTPSGNPLL--MLQGHRNSVISVAVANDHPLGP--EYG 718

Query: 229 RLCSGSDDSTVRVWRY 244
              +GS D   R+W+Y
Sbjct: 719 VFATGSGDCKARIWKY 734

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 76/175 (43%), Gaps = 33/175 (18%)

Query: 25  LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTV 84
            LATG+ D+ I+I ++        +   V+    H++ I  + + P  + L +GS D TV
Sbjct: 484 FLATGAEDKLIRIWDL-------ATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTV 536

Query: 85  SIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSH-DGALLSSCSRDK 143
            IW                     L     ++    E+ V  +A S  DG L+++ S D+
Sbjct: 537 RIW--------------------DLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDR 576

Query: 144 SVWIWETDQDGEEYECISVLQE----HSQDVKHVVWHPELPLLASSSYDDTIRLW 194
           +V IW+++  G   E +    E    H   V  VV+  +   + S S D +++LW
Sbjct: 577 TVRIWDSE-TGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLW 630

>Scas_721.115*
          Length = 318

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 81/180 (45%), Gaps = 22/180 (12%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
            +GH + V+    + DGA   S S DK++ +W+    GE Y+       H  DV  V   
Sbjct: 61  FKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDV-ATGETYQR---FVGHKSDVMSVAID 116

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG---KNGESIRLCSG 233
            +  ++ S S D TI++W       +C A L GH    W S        +N +S+ + S 
Sbjct: 117 RKASMIISGSRDKTIKVWTIKG---QCLATLLGHND--WVSQVRIAPTDQNDDSVTVISA 171

Query: 234 SDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVY 292
            +D  V+ W           ++  EA     H+  + +V+ S +G LIAS G DG + ++
Sbjct: 172 GNDKMVKAWNL--------NQFQIEADFVG-HNGNVNTVTASPDGTLIASAGKDGEIMLW 222

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 105/247 (42%), Gaps = 45/247 (18%)

Query: 113 LLAIIEGHENEVKGIAWSHDGA-LLSSCSRDKSVWIWETDQDGEEYEC-ISVLQEHSQDV 170
           L   +EGH   V  +A S     LL S SRDK++  W+   D +++   +   + HS  V
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 171 KHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRL 230
           +      +     S+S+D T+RLW       E      GH+  V     ++    ++  +
Sbjct: 69  QDCTLTQDGAYALSASWDKTLRLWDVATG--ETYQRFVGHKSDVMSVAIDR----KASMI 122

Query: 231 CSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIAST-GSDGTL 289
            SGS D T++VW        GQ    C A L   +D       W +   IA T  +D ++
Sbjct: 123 ISGSRDKTIKVWTI-----KGQ----CLATLLGHND-------WVSQVRIAPTDQNDDSV 166

Query: 290 AVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNM----------MLATGGDD 339
            V   +S G+D+    ++    L     EA+ V     NGN+          ++A+ G D
Sbjct: 167 TV---ISAGNDK----MVKAWNLNQFQIEADFVGH---NGNVNTVTASPDGTLIASAGKD 216

Query: 340 GCVNLWN 346
           G + LWN
Sbjct: 217 GEIMLWN 223

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 57/141 (40%), Gaps = 29/141 (20%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           HK  +  VA    ++++ +GS D T+ +WT                    ++   LA + 
Sbjct: 106 HKSDVMSVAIDRKASMIISGSRDKTIKVWT--------------------IKGQCLATLL 145

Query: 119 GHENEVKGIAWSH-----DGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV 173
           GH + V  +  +      D   + S   DK V  W  +Q   E + +     H+ +V  V
Sbjct: 146 GHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVG----HNGNVNTV 201

Query: 174 VWHPELPLLASSSYDDTIRLW 194
              P+  L+AS+  D  I LW
Sbjct: 202 TASPDGTLIASAGKDGEIMLW 222

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 54/150 (36%), Gaps = 32/150 (21%)

Query: 110 EMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQD 169
           +  + A   GH   V  +  S DG L++S  +D  + +W   +    Y           +
Sbjct: 184 QFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTL-----SAQDE 238

Query: 170 VKHVVWHPELPLLASSS--------------YDDTIRLWKDYDDDWECAAVLNGHEGTVW 215
           V  + + P    LA+++               DD    +  Y+   E  AV        W
Sbjct: 239 VFALAFSPNRYWLAAATASGIKIFCLDPQSLVDDLRPEFAGYNKSAEPHAV-----SLAW 293

Query: 216 CSDFEKGKNGESIRLCSGSDDSTVRVWRYI 245
            +D +         L +G  DS +RVW+ +
Sbjct: 294 SADGQT--------LFAGYTDSVIRVWQVM 315

>ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH]
           (698881..699768) [888 bp, 295 aa]
          Length = 295

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 60/125 (48%), Gaps = 5/125 (4%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           ++ I   H   +      + G  L++CS DK++ I+E   DG+ ++ +  L  H   V  
Sbjct: 1   MVTITNAHTELIHDAVLDYYGKRLATCSSDKTIQIFEV--DGDSHKLVDSLHGHEGPVWQ 58

Query: 173 VVW-HPELP-LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRL 230
           V W HP+   +LAS SYD  + +WK+ +  W   A    H  +V    +   + G  + L
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEENGRWSQIAAYEVHSASVNSVKWAPHEYG-PLLL 117

Query: 231 CSGSD 235
           CS SD
Sbjct: 118 CSSSD 122

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 85/199 (42%), Gaps = 26/199 (13%)

Query: 160 ISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDF 219
           +++   H++ +   V       LA+ S D TI++++   D  +    L+GHEG VW  D+
Sbjct: 2   VTITNAHTELIHDAVLDYYGKRLATCSSDKTIQIFEVDGDSHKLVDSLHGHEGPVWQVDW 61

Query: 220 EKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTN-- 277
              K G  + L S S D  V +W+    +E+G+   I      +VH   + SV W+ +  
Sbjct: 62  AHPKFG--VILASCSYDGKVLIWK----EENGRWSQIAAY---EVHSASVNSVKWAPHEY 112

Query: 278 -GLIASTGSDGTLAVYKEVSNGDDEH---DWEVIAKQELCHGVYEANIVKWIDINGNM-- 331
             L+  + SDG  +V +   NG       D   I     C           I+ +G    
Sbjct: 113 GPLLLCSSSDGKFSVVEFKENGTTSPIIIDAHAIGVNAACWAPAT------IEDDGQQSQ 166

Query: 332 ---MLATGGDDGCVNLWNW 347
               +ATGG D  V +W +
Sbjct: 167 HLRRIATGGADNLVKIWKY 185

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 79/211 (37%), Gaps = 42/211 (19%)

Query: 4   KLAKSLKLQNDKLWSLDYSHG----LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVH 59
           KL  SL      +W +D++H     +LA+ S D K+ I    N    Q++  +V     H
Sbjct: 44  KLVDSLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEENGRWSQIAAYEV-----H 98

Query: 60  KKAIRCVAWRPH--SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
             ++  V W PH    LL   S D   S+                  TT+ +      II
Sbjct: 99  SASVNSVKWAPHEYGPLLLCSSSDGKFSV-----------VEFKENGTTSPI------II 141

Query: 118 EGHENEVKGIAWSH-----DGALLSSCSR------DKSVWIWETDQDGEEYECISVLQEH 166
           + H   V    W+      DG       R      D  V IW+ + +   Y     L  H
Sbjct: 142 DAHAIGVNAACWAPATIEDDGQQSQHLRRIATGGADNLVKIWKYNPEANTYLLEDTLAAH 201

Query: 167 SQDVKHVVWHPE-LP--LLASSSYDDTIRLW 194
           +  V+ V W P  LP   LA+ S D T  +W
Sbjct: 202 ADWVRDVAWSPSVLPRAYLATVSQDRTCIIW 232

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 118/313 (37%), Gaps = 55/313 (17%)

Query: 19  LDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAW-RPHSN-LLA 76
           LDY    LAT S+D+ I+I  V         L+D L    H+  +  V W  P    +LA
Sbjct: 17  LDYYGKRLATCSSDKTIQIFEVDGDSH---KLVDSLHG--HEGPVWQVDWAHPKFGVILA 71

Query: 77  AGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWS-HD-GA 134
           + S+D  V IW                          +A  E H   V  + W+ H+ G 
Sbjct: 72  SCSYDGKVLIWKEENG-----------------RWSQIAAYEVHSASVNSVKWAPHEYGP 114

Query: 135 LLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP-----------ELPLLA 183
           LL   S D    + E  ++G     I  +  H+  V    W P            L  +A
Sbjct: 115 LLLCSSSDGKFSVVEFKENGTTSPII--IDAHAIGVNAACWAPATIEDDGQQSQHLRRIA 172

Query: 184 SSSYDDTIRLWKDYDDD---WECAAVLNGHEGTVWCSDFEKGKNG-ESIRLCSGSDDSTV 239
           +   D+ +++WK Y+ +   +     L  H    W  D     +      L + S D T 
Sbjct: 173 TGGADNLVKIWK-YNPEANTYLLEDTLAAHAD--WVRDVAWSPSVLPRAYLATVSQDRTC 229

Query: 240 RVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVYKEVSNG 298
            +W      E+ Q  W    +        ++  SWS +G ++A +G D  + ++KE    
Sbjct: 230 IIWT----QENNQGPWTKTLLKEDKFPDVLWRASWSLSGNILALSGGDNKVTLWKE---- 281

Query: 299 DDEHDWEVIAKQE 311
           + E  WE  A+ E
Sbjct: 282 NLEGKWESAAEIE 294

>Scas_721.32
          Length = 822

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 80/199 (40%), Gaps = 13/199 (6%)

Query: 47  QVSLMDVLDDTVHKK--AIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXX-X 103
           Q +L  V   T H     +  + +   S L+AAG  DS + +W+                
Sbjct: 472 QAALPSVCMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADS 531

Query: 104 XTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVL 163
             T  +  +    + GH   V   ++S D   L S S DK+V +W TD     Y  +   
Sbjct: 532 INTGDMNDNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDT----YTSLVSY 587

Query: 164 QEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGK 223
           + H+  V  V + P     A++S+D T RLW    D      +  GH   V C  F    
Sbjct: 588 KGHNHPVWDVQFSPLGHYFATASHDQTARLWS--CDHIYPLRIFAGHLSDVDCVSFH--P 643

Query: 224 NGESIRLCSGSDDSTVRVW 242
           NG    + +GS D T R+W
Sbjct: 644 NG--CYVFTGSSDKTCRMW 660

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 92/233 (39%), Gaps = 47/233 (20%)

Query: 15  KLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTV-----HKKAIRCVAWR 69
           KLWSLD        GS+ ++I+  +  +   G     D+ D+T      H  A+   ++ 
Sbjct: 512 KLWSLD--------GSSLKQIQEKSADSINTG-----DMNDNTSTTLIGHSGAVYSTSFS 558

Query: 70  PHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAW 129
           P +  L +GS D TV +W+                         L   +GH + V  + +
Sbjct: 559 PDNRYLLSGSEDKTVRLWSTDTYTS-------------------LVSYKGHNHPVWDVQF 599

Query: 130 SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDD 189
           S  G   ++ S D++  +W  D        + +   H  DV  V +HP    + + S D 
Sbjct: 600 SPLGHYFATASHDQTARLWSCDH----IYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDK 655

Query: 190 TIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           T R+W     D     +  GH   V C+      + +   L +GS+D  + +W
Sbjct: 656 TCRMWDISTGD--SVRLFLGHTAPVLCT----AVSPDGRWLATGSEDGIINLW 702

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 81/199 (40%), Gaps = 43/199 (21%)

Query: 57  TVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAI 116
           T HK+ I C+ W P S  +A+GS D TV I                      +    +  
Sbjct: 66  TTHKECINCLCWSPDSKCIASGSEDFTVEI--------------------THIIYGRIRR 105

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV-VW 175
           + GH   V  I +++ G +L S S D+S+  W           +  +  HS  V  + + 
Sbjct: 106 LMGHTAPVISICYNNKGNILCSSSMDESIKEWHVLSGTA----LKTMSAHSDAVVSIDIP 161

Query: 176 HPELPLLASSSYDDTIRLWK----------DYDDDWECAAVLNGHEGTVWCSDFEKGKNG 225
             +  +L+S SYD  IR++            YD DW         +G V  S  +  +NG
Sbjct: 162 KFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWI------AEDGVVPISTVKFSRNG 215

Query: 226 ESIRLCSGSDDSTVRVWRY 244
           + + +   S D+ V++W Y
Sbjct: 216 KFLLV--KSLDNVVKLWEY 232

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 79/169 (46%), Gaps = 26/169 (15%)

Query: 124 VKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLA 183
           ++ + +S DG  L++ + DK + IW    D    + +  LQ H QD+  + + P    L 
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIW----DLTTKKILMTLQGHEQDIYSLDYFPAGDKLV 410

Query: 184 SSSYDDTIRLWKDYDDDWECAAVLNGHEG--TVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           S S D T+R+W       +C+  L+  +G  TV  S       G+   + +GS D TVRV
Sbjct: 411 SGSGDRTVRIWD--LRTGQCSLTLSIEDGVTTVAVSP------GDGKYIAAGSLDRTVRV 462

Query: 242 WRYIDDDEDGQQEWICEAI-----LPKVHDRQIYSVSWSTNGLIASTGS 285
           W    D E G   ++ E +     L   H   +YSV ++ +G    +GS
Sbjct: 463 W----DSETG---FLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGS 504

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 76/188 (40%), Gaps = 38/188 (20%)

Query: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHEN 122
           IR V + P    LA G+ D  + IW                 TT  + M L    +GHE 
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIW---------------DLTTKKILMTL----QGHEQ 395

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182
           ++  + +   G  L S S D++V IW    D    +C   L          V   +   +
Sbjct: 396 DIYSLDYFPAGDKLVSGSGDRTVRIW----DLRTGQCSLTLSIEDGVTTVAVSPGDGKYI 451

Query: 183 ASSSYDDTIRLW--------KDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGS 234
           A+ S D T+R+W        +  D + E +    GH+ +V+   F +   G    + SGS
Sbjct: 452 AAGSLDRTVRVWDSETGFLVERLDSENELS---TGHKDSVYSVVFTRDGQG----VISGS 504

Query: 235 DDSTVRVW 242
            D +V++W
Sbjct: 505 LDRSVKLW 512

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 6/92 (6%)

Query: 151 DQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGH 210
           D  GE    I         ++ V + P+   LA+ + D  IR+W       +    L GH
Sbjct: 336 DNGGENSATIQPASSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTK--KILMTLQGH 393

Query: 211 EGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           E  ++  D+    +    +L SGS D TVR+W
Sbjct: 394 EQDIYSLDYFPAGD----KLVSGSGDRTVRIW 421

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 57/259 (22%), Positives = 98/259 (37%), Gaps = 54/259 (20%)

Query: 26  LATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTVS 85
           LATG+ D+ I+I ++T     +  LM +     H++ I  + + P  + L +GS D TV 
Sbjct: 367 LATGAEDKLIRIWDLTT----KKILMTLQG---HEQDIYSLDYFPAGDKLVSGSGDRTVR 419

Query: 86  IWTRXXXXXXXXXXXXXXXTTNSL----------------------EMDLLA-------- 115
           IW                 TT ++                      E   L         
Sbjct: 420 IWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENE 479

Query: 116 IIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW 175
           +  GH++ V  + ++ DG  + S S D+SV +W       +   ++  + H+        
Sbjct: 480 LSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLW-------DLRGLNGQKSHATCEVTYTG 532

Query: 176 HPELPLLASSSYDDTIRLWKDYDDD---WECAA-----VLNGHEGTVWCSDFEKG-KNGE 226
           H +  L  +++ DD   L    D     W+ A+     +L GH  +V       G   G 
Sbjct: 533 HKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGP 592

Query: 227 SIR-LCSGSDDSTVRVWRY 244
            +    +GS D   R+W+Y
Sbjct: 593 DVGVFATGSGDCKARIWKY 611

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 116/273 (42%), Gaps = 43/273 (15%)

Query: 25  LLATGSTDRKIKIINVTNAPRGQVSL---MDVL-DDTVHKKAIRCVAWRPHSNLLAAGSF 80
           + A  +  +   I NV N  R         D+L    V  + I  V +  + N +A+GS+
Sbjct: 173 IAAQKTISQTYSIQNVLNKRRAANKYWCSFDLLATQVVSTRPISTVTFCNNGNYVASGSW 232

Query: 81  DSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCS 140
           +  VSI                   +N+LE+     ++ H+ +V GIAW+ + ++L +  
Sbjct: 233 NGEVSI-----------------IDSNTLEV--TQTLQNHDGKVGGIAWTSNDSVLITGG 273

Query: 141 RDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDD 200
            D  + +  +++   E+   + +  H   +  +  HP    + +SS+D T RLW   D +
Sbjct: 274 EDHLITV--SNRSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLW---DIE 328

Query: 201 WECAAVLN-GHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEA 259
            +   +L  GH   ++C  F+     +   + +   D T  +W    D   G+     + 
Sbjct: 329 KQKQLLLQEGHSKELYCLAFQ----ADGALVSTAGTDKTAIIW----DLRSGKAVSQLQG 380

Query: 260 ILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAV 291
                H + IY + WS +G  +A+ G DG + +
Sbjct: 381 -----HAKTIYCMDWSIDGHTLATGGGDGVITI 408

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 103/236 (43%), Gaps = 27/236 (11%)

Query: 111 MDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDV 170
            DLLA        +  + + ++G  ++S S +  V I     D    E    LQ H   V
Sbjct: 202 FDLLATQVVSTRPISTVTFCNNGNYVASGSWNGEVSII----DSNTLEVTQTLQNHDGKV 257

Query: 171 KHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRL 230
             + W     +L +   D  I +    D ++  +  + GHEG +  +D +   +G+ I  
Sbjct: 258 GGIAWTSNDSVLITGGEDHLITVSNRSDGEFITSNSIGGHEGRI--TDLQVHPSGKFI-- 313

Query: 231 CSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLA 290
            + S DST R+W    D E  +Q      +L + H +++Y +++  +G + ST      A
Sbjct: 314 GTSSFDSTWRLW----DIEKQKQ-----LLLQEGHSKELYCLAFQADGALVSTAGTDKTA 364

Query: 291 VYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWN 346
           +  ++ +G      +  AK   C        + W  I+G+  LATGG DG + +W+
Sbjct: 365 IIWDLRSGKAVSQLQGHAKTIYC--------MDW-SIDGH-TLATGGGDGVITIWD 410

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 71/170 (41%), Gaps = 28/170 (16%)

Query: 25  LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTV 84
           +L TG  D    +I V+N   G+    + +    H+  I  +   P    +   SFDST 
Sbjct: 268 VLITGGEDH---LITVSNRSDGEFITSNSIGG--HEGRITDLQVHPSGKFIGTSSFDSTW 322

Query: 85  SIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKS 144
            +W                   +  +   L + EGH  E+  +A+  DGAL+S+   DK+
Sbjct: 323 RLW-------------------DIEKQKQLLLQEGHSKELYCLAFQADGALVSTAGTDKT 363

Query: 145 VWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
             IW    D    + +S LQ H++ +  + W  +   LA+   D  I +W
Sbjct: 364 AIIW----DLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIW 409

>Kwal_27.12053
          Length = 755

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 110/277 (39%), Gaps = 42/277 (15%)

Query: 74  LLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDG 133
           L AAG  DS + IW+                 TN+        + GH   V   ++S D 
Sbjct: 441 LAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNN------ETLVGHSGTVYSTSFSPDN 494

Query: 134 ALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRL 193
             L S S DK+V +W TD     Y  +   + H+  +  V + P     A++S+D T RL
Sbjct: 495 RYLLSASEDKTVRLWSTDT----YTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARL 550

Query: 194 WKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQ 253
           W    D      +  GH   V    F    NG  +   +GS D T R+W     D     
Sbjct: 551 WS--CDHIYPLRIFAGHLNDVDTVSFH--PNGTYV--FTGSSDKTCRMWDITSGD----- 599

Query: 254 EWICEAILPKVHDRQIYSVSWSTNGLIASTGS-DGTLAVYKEVSNGDDEHDWEVIAKQEL 312
                  L   H   + S + S +G   STGS DG + V+ ++  G          KQ  
Sbjct: 600 ----SVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVW-DIGTGKR-------LKQMR 647

Query: 313 CHG---VYEANIVKWIDINGNMMLATGGDDGCVNLWN 346
            HG   VY  +  K     G+++++ GG D  V +W+
Sbjct: 648 GHGKNAVYSLSYSK----EGHVLIS-GGADHSVRVWD 679

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 118/291 (40%), Gaps = 52/291 (17%)

Query: 13  NDKLWSLDYSH--GLLATGSTDRKIKIINVTNAP--------RGQVSLMDVLDDTVHKKA 62
           N ++ SL++S    L A G  D  IKI ++   P        +G+ +  + L    H   
Sbjct: 427 NSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETL--VGHSGT 484

Query: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHEN 122
           +   ++ P +  L + S D TV +W+                         L   +GH +
Sbjct: 485 VYSTSFSPDNRYLLSASEDKTVRLWSTDTYTS-------------------LVNYKGHNH 525

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182
            +  +A+S  G   ++ S D++  +W  D        + +   H  DV  V +HP    +
Sbjct: 526 PIWDVAFSPLGHYFATASHDQTARLWSCDH----IYPLRIFAGHLNDVDTVSFHPNGTYV 581

Query: 183 ASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
            + S D T R+W     D     +  GH   V  +      + +   L +GS+D  + VW
Sbjct: 582 FTGSSDKTCRMWDITSGD--SVRLFLGHTAPVTST----AVSPDGRWLSTGSEDGVINVW 635

Query: 243 RYIDDDEDGQQEWICEAILPKVHDRQ-IYSVSWSTNG-LIASTGSDGTLAV 291
                 + G  + + +    + H +  +YS+S+S  G ++ S G+D ++ V
Sbjct: 636 ------DIGTGKRLKQM---RGHGKNAVYSLSYSKEGHVLISGGADHSVRV 677

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 69/184 (37%), Gaps = 28/184 (15%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H   I  VA+ P  +  A  S D T  +W+                      +  L I  
Sbjct: 523 HNHPIWDVAFSPLGHYFATASHDQTARLWSCD-------------------HIYPLRIFA 563

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH N+V  +++  +G  + + S DK+  +W    D    + + +   H+  V      P+
Sbjct: 564 GHLNDVDTVSFHPNGTYVFTGSSDKTCRMW----DITSGDSVRLFLGHTAPVTSTAVSPD 619

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
              L++ S D  I +W D         +    +  V+   + K    E   L SG  D +
Sbjct: 620 GRWLSTGSEDGVINVW-DIGTGKRLKQMRGHGKNAVYSLSYSK----EGHVLISGGADHS 674

Query: 239 VRVW 242
           VRVW
Sbjct: 675 VRVW 678

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 59/129 (45%), Gaps = 10/129 (7%)

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH+  V  I +S D  +L + S DK++ IW  D      +C   +  H   +  V +  +
Sbjct: 562 GHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFG----DCHKSIFAHQDSIMSVRFEAD 617

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
                S   D  ++ W    D ++C   LNGH+  VWC       +G ++   S S D +
Sbjct: 618 THNFFSCGKDGAVKRWDG--DKFDCIQKLNGHQSEVWC--IAVSPDGRTV--VSTSHDHS 671

Query: 239 VRVWRYIDD 247
           +RVW+  DD
Sbjct: 672 IRVWQETDD 680

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 45/83 (54%), Gaps = 4/83 (4%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           I  H++ +  + +  D     SC +D +V  W    DG++++CI  L  H  +V  +   
Sbjct: 602 IFAHQDSIMSVRFEADTHNFFSCGKDGAVKRW----DGDKFDCIQKLNGHQSEVWCIAVS 657

Query: 177 PELPLLASSSYDDTIRLWKDYDD 199
           P+   + S+S+D +IR+W++ DD
Sbjct: 658 PDGRTVVSTSHDHSIRVWQETDD 680

 Score = 32.0 bits (71), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 62/142 (43%), Gaps = 18/142 (12%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETD-----QDGEEYECISVLQ--- 164
           LL+  E H   +  +  + +G  L + S DKS   W+ +       G + + I  L+   
Sbjct: 456 LLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVH 515

Query: 165 ----EHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFE 220
               E + D+  V    E   LA S  D+T++++  + D  +    L GH+  V   DF 
Sbjct: 516 DTTLELTDDILAVKISSEDRYLAVSLLDNTVKVF--FFDSLKFYLSLYGHKLPVLSIDF- 572

Query: 221 KGKNGESIRLCSGSDDSTVRVW 242
              + +S  L + S D  +++W
Sbjct: 573 ---SVDSKMLITSSADKNIKIW 591

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 110 EMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQD 153
           + D +  + GH++EV  IA S DG  + S S D S+ +W+   D
Sbjct: 637 KFDCIQKLNGHQSEVWCIAVSPDGRTVVSTSHDHSIRVWQETDD 680

>Scas_707.22
          Length = 730

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 94/216 (43%), Gaps = 31/216 (14%)

Query: 4   KLAKSLKLQNDKLWSLDY-SHGLLATGSTDRKIKIINV-----TNAPRGQVSLMDVLDDT 57
           K  K L      +W+L Y + G++ +GSTDR ++I ++     T+  +G           
Sbjct: 387 KFLKELSGHEGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHVFKG----------- 435

Query: 58  VHKKAIRCVAWRPHSNL--LAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLA 115
            H   +RC+    + N+  +  GS D+T+ +W +                T       + 
Sbjct: 436 -HTSTVRCLEIVTYKNMKYIVTGSRDNTLHVW-KLIKEEKFDGELPMVYNTPEENPYFVG 493

Query: 116 IIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW 175
           ++ GH   V+ I  S  G ++ S S D ++ +W+  Q     +C+ VL  H+  +   ++
Sbjct: 494 VLRGHMASVRTI--SGHGNIVISGSYDNNLMVWDIAQ----MKCLYVLIGHTDRIYSTIY 547

Query: 176 HPELPLLASSSYDDTIRLWKDYDDDW---ECAAVLN 208
             +     S+S D TI++W D D+ W    C  + N
Sbjct: 548 DHKRQRCISASMDSTIKVW-DLDNIWNNGNCTIITN 582

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 63/143 (44%), Gaps = 24/143 (16%)

Query: 116 IIEGHENEVK--GIAWSHDGALLSSCSRDKSVWIW----ETDQDGE----------EYEC 159
           + +GH + V+   I    +   + + SRD ++ +W    E   DGE              
Sbjct: 432 VFKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLIKEEKFDGELPMVYNTPEENPYF 491

Query: 160 ISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDF 219
           + VL+ H   V+ +  H  +  + S SYD+ + +W       +C  VL GH   ++ + +
Sbjct: 492 VGVLRGHMASVRTISGHGNI--VISGSYDNNLMVWDIAQ--MKCLYVLIGHTDRIYSTIY 547

Query: 220 EKGKNGESIRLCSGSDDSTVRVW 242
           +  +     R  S S DST++VW
Sbjct: 548 DHKRQ----RCISASMDSTIKVW 566

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 11/80 (13%)

Query: 181 LLASSSYDDTIRLWKDYDDDWE---CAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDS 237
           ++ S S D ++R+W     D +   C  V  GH  TV C +    KN + I   +GS D+
Sbjct: 409 IIVSGSTDRSVRIW-----DIKRGCCTHVFKGHTSTVRCLEIVTYKNMKYI--VTGSRDN 461

Query: 238 TVRVWRYIDDDE-DGQQEWI 256
           T+ VW+ I +++ DG+   +
Sbjct: 462 TLHVWKLIKEEKFDGELPMV 481

 Score = 28.5 bits (62), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 5/36 (13%)

Query: 207 LNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           L+GHEG VW   ++     + I + SGS D +VR+W
Sbjct: 392 LSGHEGGVWALKYD----ADGI-IVSGSTDRSVRIW 422

>Scas_592.4*
          Length = 318

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 81/180 (45%), Gaps = 22/180 (12%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
            +GH + V+    + DGA   S S DK++ +W+    GE Y+       H  DV  V   
Sbjct: 61  FKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDV-ATGETYQR---FVGHKSDVMSVAID 116

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG---KNGESIRLCSG 233
            +  ++ S S D TI++W       +C A L GH    W S        +N +++ + S 
Sbjct: 117 RKASMIISGSRDKTIKVWTIKG---QCLATLLGHND--WVSQVRIAPTDQNDDAVTVISA 171

Query: 234 SDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVY 292
            +D  V+ W           ++  EA     H+  + +V+ S +G LIAS G DG + ++
Sbjct: 172 GNDKMVKAWNL--------NQFQIEADFVG-HNGNVNAVTASPDGTLIASAGKDGEIMLW 222

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 104/247 (42%), Gaps = 45/247 (18%)

Query: 113 LLAIIEGHENEVKGIAWSHDGA-LLSSCSRDKSVWIWETDQDGEEYEC-ISVLQEHSQDV 170
           L   +EGH   V  +A S     LL S SRDK++  W+   D +++   +   + HS  V
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 171 KHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRL 230
           +      +     S+S+D T+RLW       E      GH+  V     ++    ++  +
Sbjct: 69  QDCTLTQDGAYALSASWDKTLRLWDVATG--ETYQRFVGHKSDVMSVAIDR----KASMI 122

Query: 231 CSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIAST-GSDGTL 289
            SGS D T++VW        GQ    C A L   +D       W +   IA T  +D  +
Sbjct: 123 ISGSRDKTIKVWTI-----KGQ----CLATLLGHND-------WVSQVRIAPTDQNDDAV 166

Query: 290 AVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNM----------MLATGGDD 339
            V   +S G+D+    ++    L     EA+ V     NGN+          ++A+ G D
Sbjct: 167 TV---ISAGNDK----MVKAWNLNQFQIEADFVGH---NGNVNAVTASPDGTLIASAGKD 216

Query: 340 GCVNLWN 346
           G + LWN
Sbjct: 217 GEIMLWN 223

 Score = 35.8 bits (81), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 57/141 (40%), Gaps = 29/141 (20%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           HK  +  VA    ++++ +GS D T+ +WT                    ++   LA + 
Sbjct: 106 HKSDVMSVAIDRKASMIISGSRDKTIKVWT--------------------IKGQCLATLL 145

Query: 119 GHENEVKGIAWSH-----DGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV 173
           GH + V  +  +      D   + S   DK V  W  +Q   E + +     H+ +V  V
Sbjct: 146 GHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVG----HNGNVNAV 201

Query: 174 VWHPELPLLASSSYDDTIRLW 194
              P+  L+AS+  D  I LW
Sbjct: 202 TASPDGTLIASAGKDGEIMLW 222

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 54/150 (36%), Gaps = 32/150 (21%)

Query: 110 EMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQD 169
           +  + A   GH   V  +  S DG L++S  +D  + +W   +    Y           +
Sbjct: 184 QFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTL-----SAQDE 238

Query: 170 VKHVVWHPELPLLASSS--------------YDDTIRLWKDYDDDWECAAVLNGHEGTVW 215
           V  + + P    LA+++               DD    +  Y+   E  AV        W
Sbjct: 239 VFSLAFSPNRYWLAAATASGIKIFCLDPQSLIDDLRPEFAGYNKSAEPHAV-----SLAW 293

Query: 216 CSDFEKGKNGESIRLCSGSDDSTVRVWRYI 245
            +D +         L +G  DS +RVW+ +
Sbjct: 294 SADGQT--------LFAGYTDSVIRVWQVM 315

>CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces
           cerevisiae YLR208w SEC13 protein transport protein,
           start by similarity
          Length = 303

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 126/304 (41%), Gaps = 46/304 (15%)

Query: 18  SLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHS---NL 74
           +L+Y    LAT S+D+ +KI  + N      SL++ L    H+  +    W   S   NL
Sbjct: 16  ALNYYGTRLATCSSDKTVKIFEI-NDVNNSSSLLETL--VGHEGPVWYADWCHPSLGENL 72

Query: 75  LAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWS-HDG 133
           LA   +D  V IW                 + +  +M ++     H   V  + W+ H+ 
Sbjct: 73  LATCGYDGKVLIWKE---------------SGHGGKMQIIGKHAVHSASVNCVKWAPHEY 117

Query: 134 ALLSSC-SRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPL----------- 181
            L+  C S D  + + E  +DG+      +   H   V  + W P +             
Sbjct: 118 GLILLCGSADGKISVVEL-KDGQIASTKILDNAHKFGVNSISWAPLMKTDSSDDGDETTA 176

Query: 182 ---LASSSYDDTIRLWKDYDDDWECAAV---LNGHEGTVWCSDFEKGKNGESIRLCSGSD 235
                S   D+ +++WK +DDD E   V   L GH+  V   D+      +S  + S S+
Sbjct: 177 VKQFISGGNDNLVKIWK-FDDDQETYVVADTLEGHKDAVTAVDWSPTTLLQS-YVASVSN 234

Query: 236 DSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVYKE 294
           D    VW    D    + +W   ++     ++++ SVSWS +G L+A +  D  + ++KE
Sbjct: 235 DKQCLVWT--QDHSSKKNDWKKISVNEGKFEQKLGSVSWSLSGNLLAVSDDDKNVTIWKE 292

Query: 295 VSNG 298
             +G
Sbjct: 293 SGDG 296

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 87/196 (44%), Gaps = 18/196 (9%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           ++ I   HE  +   A ++ G  L++CS DK+V I+E +        +  L  H   V +
Sbjct: 1   MVKIENAHEGVIHHAALNYYGTRLATCSSDKTVKIFEINDVNNSSSLLETLVGHEGPVWY 60

Query: 173 VVW-HPELP--LLASSSYDDTIRLWKD--YDDDWECAAVLNGHEGTVWCSDFEKGKNGES 227
             W HP L   LLA+  YD  + +WK+  +    +       H  +V C  +   + G  
Sbjct: 61  ADWCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAVHSASVNCVKWAPHEYG-L 119

Query: 228 IRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDG 287
           I LC GS D  + V       +DGQ       IL   H   + S+SW+   L+ +  SD 
Sbjct: 120 ILLC-GSADGKISVVEL----KDGQIA--STKILDNAHKFGVNSISWAP--LMKTDSSDD 170

Query: 288 ---TLAVYKEVSNGDD 300
              T AV + +S G+D
Sbjct: 171 GDETTAVKQFISGGND 186

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 84/209 (40%), Gaps = 33/209 (15%)

Query: 160 ISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK--DYDDDWECAAVLNGHEGTVWCS 217
           + +   H   + H   +     LA+ S D T+++++  D ++       L GHEG VW +
Sbjct: 2   VKIENAHEGVIHHAALNYYGTRLATCSSDKTVKIFEINDVNNSSSLLETLVGHEGPVWYA 61

Query: 218 DFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTN 277
           D+     GE++    G D   V +W+  +    G+ + I +     VH   +  V W+ +
Sbjct: 62  DWCHPSLGENLLATCGYD-GKVLIWK--ESGHGGKMQIIGK---HAVHSASVNCVKWAPH 115

Query: 278 --GLIASTGS-----------DGTLAVYKEVSN----GDDEHDWEVIAKQELCHGVYEAN 320
             GLI   GS           DG +A  K + N    G +   W  + K +      E  
Sbjct: 116 EYGLILLCGSADGKISVVELKDGQIASTKILDNAHKFGVNSISWAPLMKTDSSDDGDETT 175

Query: 321 IVKWIDINGNMMLATGGDDGCVNLWNWTD 349
            VK           +GG+D  V +W + D
Sbjct: 176 AVK--------QFISGGNDNLVKIWKFDD 196

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 55/115 (47%), Gaps = 19/115 (16%)

Query: 53  VLDDTV--HKKAIRCVAWRPHSNL---LAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTN 107
           V+ DT+  HK A+  V W P + L   +A+ S D    +WT+               ++ 
Sbjct: 202 VVADTLEGHKDAVTAVDWSPTTLLQSYVASVSNDKQCLVWTQDH-------------SSK 248

Query: 108 SLEMDLLAIIEG-HENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECIS 161
             +   +++ EG  E ++  ++WS  G LL+    DK+V IW+   DG+  E ++
Sbjct: 249 KNDWKKISVNEGKFEQKLGSVSWSLSGNLLAVSDDDKNVTIWKESGDGKWEEVVN 303

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 88/190 (46%), Gaps = 18/190 (9%)

Query: 105 TTNSLEMDLLAIIEGHENEVKGIAWSH-DGALLSSCSRDKSVWIWETDQDGEEYEC-ISV 162
           +++++ + L   +EGH   V  ++ S     LL S SRDK++  W   ++ +++   +  
Sbjct: 2   SSSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRS 61

Query: 163 LQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG 222
            + HS  V+ VV   +     S+S+D T+RLW     + E   V  GH G V        
Sbjct: 62  YKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFV--GHTGDV----LSVA 115

Query: 223 KNGESIRLCSGSDDSTVRVWRYIDDDED---GQQEWICEA-ILPK------VHDRQIYSV 272
            +  S ++ S S D T+RVW  + D      G  +W+ +  + PK      V D +I  V
Sbjct: 116 IDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFV 175

Query: 273 SWSTNGLIAS 282
           S   + ++ S
Sbjct: 176 SAGMDKIVRS 185

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 91/232 (39%), Gaps = 41/232 (17%)

Query: 71  HSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDL-LAIIEGHENEVKGIAW 129
             NLL +GS D T+  W                 T N  +  + +   +GH + V+ +  
Sbjct: 30  QPNLLVSGSRDKTLISW---------------RLTENEQQFGVPVRSYKGHSHIVQDVVV 74

Query: 130 SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDD 189
           S DG    S S DK++ +W       E   +     H+ DV  V        + S+S D 
Sbjct: 75  SADGNYAVSASWDKTLRLWNLATGNSEARFVG----HTGDVLSVAIDANSSKIISASRDK 130

Query: 190 TIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG-KNGE-------SIRLCSGSDDSTVRV 241
           TIR+W    D   CA VL GH  T W +      KN E        I   S   D  VR 
Sbjct: 131 TIRVWNTVGD---CAYVLLGH--TDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVRS 185

Query: 242 WRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVY 292
           W   +D    + ++I        H+  I  V  S +G L AS G DG + V+
Sbjct: 186 WSLNEDSYRIEADFIG-------HNNYINVVQPSPDGSLAASAGKDGQIYVW 230

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 113/291 (38%), Gaps = 60/291 (20%)

Query: 63  IRCVAWRPHSNL-LAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHE 121
           +RCV   P  N   A GS DST+ +W                  T  L++ L    +GH 
Sbjct: 116 VRCVCVDPVDNAWFATGSNDSTIRVW---------------DLATGKLKVTL----QGHI 156

Query: 122 NEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQE-HSQDVKHVVWHPELP 180
             V+ I  S     + S S+DK V  W+ +++    +    L   HS D+     HP L 
Sbjct: 157 MTVRDICISARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDL-----HPSLD 211

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGT---VWCSDFEKGKNGESIRLCSGSDDS 237
           L+ S+  D  +R+W        C   L GH G    V C   +        ++ S S D+
Sbjct: 212 LIVSAGRDSVVRVWDIRSR--SCVLTLAGHRGPINKVRCLPVDP-------QIVSCSTDA 262

Query: 238 TVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSN 297
           TV++W  +                   H R +  ++++      ++              
Sbjct: 263 TVKLWDLVAGKPMKTLTH---------HKRNVRDLAFNPTEFSFASACT----------- 302

Query: 298 GDDEHDWEVIAKQELCHGVYEA-NIVKWIDINGNMMLATGGDDGCVNLWNW 347
            DD   W+++  Q L +   EA  IV  +  N + +L  GGD G ++ +++
Sbjct: 303 -DDIRSWKLVDGQLLTNFNSEALGIVNTLACNQDGVLFAGGDTGELSFFDY 352

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 183 ASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           A + Y++ +     +   W+   V+NGH G V C   +   N       +GS+DST+RVW
Sbjct: 85  ALARYEEVVSQKPQWHAPWKLTRVINGHTGWVRCVCVDPVDNAW---FATGSNDSTIRVW 141

>Scas_704.40
          Length = 608

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 77/169 (45%), Gaps = 34/169 (20%)

Query: 74  LLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDG 133
           LL  GS+DSTV+IW                   +     L+  + GH + VK + +  D 
Sbjct: 265 LLFTGSYDSTVAIW-------------------DLCSNKLIRRLSGHTDGVKTLYF--DE 303

Query: 134 ALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRL 193
           A L + S DK++ +W    + +  ECIS  + H+  V  V    +  ++ S S D T+++
Sbjct: 304 AKLVTGSLDKTIRVW----NYKTGECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKI 357

Query: 194 WKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           W  + +   C   L GH   V C         +S    SGSDD+T+R+W
Sbjct: 358 W--HVESRTCYT-LRGHTEWVNCVKLHP----KSFTCFSGSDDTTIRMW 399

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 90/229 (39%), Gaps = 30/229 (13%)

Query: 14  DKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSN 73
           D + S+D    ++ +GS D+ +KI +V +  R   +L        H + + CV   P S 
Sbjct: 334 DSVMSVDAFKKIIVSGSADKTVKIWHVES--RTCYTLRG------HTEWVNCVKLHPKSF 385

Query: 74  LLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDG 133
              +GS D+T+ +W                     +    L II+     V  I+ S++G
Sbjct: 386 TCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIP---LTIIDAENLVVDNISGSNEG 442

Query: 134 ALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRL 193
               + +   +  I       +E          +Q +   + +P    L S S D+TI+L
Sbjct: 443 DDEPASTTTPTAAIAAEAATNDE---------ENQTLDKSIPYPTH--LLSCSLDNTIKL 491

Query: 194 WKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           W       +C     GH   VW          ++ R+ SGS D ++++W
Sbjct: 492 WDV--QTGQCIRTQFGHVEGVW------DIAADNFRIISGSHDGSIKIW 532

 Score = 32.0 bits (71), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
           LL + SYD T+ +W    +  +    L+GH   V    F++ K      L +GS D T+R
Sbjct: 265 LLFTGSYDSTVAIWDLCSN--KLIRRLSGHTDGVKTLYFDEAK------LVTGSLDKTIR 316

Query: 241 VWRY 244
           VW Y
Sbjct: 317 VWNY 320

>Scas_720.45
          Length = 755

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 57/133 (42%), Gaps = 25/133 (18%)

Query: 65  CVAWRPH-SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENE 123
           CVA+ P   N  A+G  D TV +W+                T NS          G E  
Sbjct: 2   CVAFNPKDPNTFASGCLDRTVKVWS--------LGQATPNFTLNS----------GQEKG 43

Query: 124 VKGIAWSH--DGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPL 181
           V  + +    D   L + S D +  +W    D +   C++ L+ H  +V   V+HP LP+
Sbjct: 44  VNYVDYYPLPDKPYLITSSDDLTCKVW----DYQTKSCVATLEGHMANVSFAVFHPTLPI 99

Query: 182 LASSSYDDTIRLW 194
           + S S D T+++W
Sbjct: 100 IISGSEDGTLKIW 112

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 11/113 (9%)

Query: 132 DGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP--ELPLLASSSYDD 189
           D    +S   D++V +W   Q    +   S      + V +V ++P  + P L +SS D 
Sbjct: 9   DPNTFASGCLDRTVKVWSLGQATPNFTLNS---GQEKGVNYVDYYPLPDKPYLITSSDDL 65

Query: 190 TIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           T ++W DY     C A L GH   V  + F          + SGS+D T+++W
Sbjct: 66  TCKVW-DYQTK-SCVATLEGHMANVSFAVFHPTLP----IIISGSEDGTLKIW 112

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 81/198 (40%), Gaps = 31/198 (15%)

Query: 25  LLATGSTDRKIKIINVTNAP-RGQVSLMDVLDDT-----VHKKAIRCVAWRPHSNLLAAG 78
            L T S D  IK   V N   R  + L  ++  +      H+K I  ++  P+ ++ A  
Sbjct: 447 FLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPNDSIFATA 506

Query: 79  SFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSS 138
           S+D T  IW                  T  +E    A +  H+  + G+A+     LL++
Sbjct: 507 SYDKTCKIWN---------------VDTGEVE----ATLANHKRGLWGVAFCEYDWLLAT 547

Query: 139 CSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYD 198
           CS D+S+ +W      E +  +  L+ H+  V+ V +      L S+  D  +++W    
Sbjct: 548 CSGDRSINLWSL----ESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWD--C 601

Query: 199 DDWECAAVLNGHEGTVWC 216
              EC   L+ H   +W 
Sbjct: 602 STGECVRTLDAHNNRIWA 619

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 104/249 (41%), Gaps = 43/249 (17%)

Query: 116 IIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW 175
           + EGH + +  +  + DG  L++ S+D SV +W  ++    +E  +    H+  V  +  
Sbjct: 377 MYEGHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIAL 436

Query: 176 H-------PELPLLASSSYDDTIRLWKDYDDD----WECAAVLNGHEGTVWCSDFEKGKN 224
                   PE  L AS+  D TI+ WK  + +     E   ++   E T      EK  N
Sbjct: 437 PNVMNRNWPEFLLTASN--DLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAH--EKDIN 492

Query: 225 GESIR-----LCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG- 278
             S+        + S D T ++W  +D  E        EA L   H R ++ V++     
Sbjct: 493 AISMSPNDSIFATASYDKTCKIWN-VDTGE-------VEATLAN-HKRGLWGVAFCEYDW 543

Query: 279 LIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWID-INGNMMLATGG 337
           L+A+   D ++ ++   S       + V+   E        N V+ +  INGN  L + G
Sbjct: 544 LLATCSGDRSINLWSLES-------FTVLKTLE-----GHTNAVQRVSFINGNKQLVSTG 591

Query: 338 DDGCVNLWN 346
            DG V +W+
Sbjct: 592 ADGLVKIWD 600

>Scas_629.12
          Length = 671

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 79/169 (46%), Gaps = 26/169 (15%)

Query: 124 VKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLA 183
           ++ + +S DG  L++ + DK + IW    D +E + + VL+ H QDV  + + P    L 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIW----DIQERKIVMVLKGHEQDVYSLDYFPNGEKLV 445

Query: 184 SSSYDDTIRLWKDYDDDWECAAVLNGHEG--TVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           S S D T+R+W       +C+  L+   G  TV  S      +G+ I   +GS D  VRV
Sbjct: 446 SGSGDRTVRIWDLR--TGQCSLTLSIEYGVTTVAVSP----NDGKFI--AAGSLDRAVRV 497

Query: 242 WRYIDDDEDGQQEWICEAI-----LPKVHDRQIYSVSWSTNGLIASTGS 285
           W       D    ++ E +     L   H   +YSV ++ +G    +GS
Sbjct: 498 W-------DSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGS 539

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 78/189 (41%), Gaps = 40/189 (21%)

Query: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHEN 122
           IR V + P    LA G+ D  + IW                   +  E  ++ +++GHE 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIW-------------------DIQERKIVMVLKGHEQ 430

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP-ELPL 181
           +V  + +  +G  L S S D++V IW    D    +C S+       V  V   P +   
Sbjct: 431 DVYSLDYFPNGEKLVSGSGDRTVRIW----DLRTGQC-SLTLSIEYGVTTVAVSPNDGKF 485

Query: 182 LASSSYDDTIRLW--------KDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSG 233
           +A+ S D  +R+W        +  D + E      GH  +V+   F +  N     + SG
Sbjct: 486 IAAGSLDRAVRVWDSTTGFLVERLDSENELGT---GHRDSVYSVVFTRDGN----EVVSG 538

Query: 234 SDDSTVRVW 242
           S D TV++W
Sbjct: 539 SLDKTVKLW 547

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 102/274 (37%), Gaps = 46/274 (16%)

Query: 4   KLAKSLKLQNDKLWSLDYSHG--LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKK 61
           K+   LK     ++SLDY      L +GS DR ++I ++     GQ SL   ++      
Sbjct: 420 KIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRT---GQCSLTLSIE-----Y 471

Query: 62  AIRCVAWRPH-SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE-- 118
            +  VA  P+    +AAGS D  V +W                 TT  L   L +  E  
Sbjct: 472 GVTTVAVSPNDGKFIAAGSLDRAVRVW---------------DSTTGFLVERLDSENELG 516

Query: 119 -GHENEVKGIAWSHDGALLSSCSRDKSVWIW-----------ETDQDGEEYECISVLQEH 166
            GH + V  + ++ DG  + S S DK+V +W             D+      C      H
Sbjct: 517 TGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGH 576

Query: 167 SQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKN-G 225
              V  V    +   + S S D  I  W    +      +L GH  +V       G   G
Sbjct: 577 KDFVLSVTTSQDDKYILSGSKDRGILFWD--KESGNPLLMLQGHRNSVISVAVANGSALG 634

Query: 226 ESIR-LCSGSDDSTVRVWRYIDDDEDGQQEWICE 258
                  +GS D   R+W+Y      G++E I E
Sbjct: 635 PKYNVFATGSGDCKARIWKY--SKISGEEEKIKE 666

>Kwal_23.5035
          Length = 744

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 85/209 (40%), Gaps = 19/209 (9%)

Query: 4   KLAKSLKLQNDKLWSLDYSH-GLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKA 62
           K    L   +  +W+L Y H G+L +GSTDR +++ N+ +     V          H   
Sbjct: 401 KFITQLSGHDGGVWALKYGHDGILVSGSTDRSVRVWNIKSGKCTHVF-------KGHTST 453

Query: 63  IRCVAWRPHS--NLLAAGSFDSTVSIWTRXX-XXXXXXXXXXXXXTTNSLEMDLLAIIEG 119
           +RC+    H+    +  GS D T+ +W                   T       + ++ G
Sbjct: 454 VRCLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANPYFVGVLRG 513

Query: 120 HENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPEL 179
           H   V+ +  S  G ++ S S D ++ +W+  Q     +C+ VL  H+  +   ++  + 
Sbjct: 514 HMAAVRTV--SGHGNIVVSGSYDFNLMVWDIAQ----MKCLYVLTGHTDRIYSTIYDYQR 567

Query: 180 PLLASSSYDDTIRLW--KDYDDDWECAAV 206
               S+  D T+++W   D   +  C  +
Sbjct: 568 NRCISAGMDSTVKVWDLADVSKNGPCTTI 596

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 89/219 (40%), Gaps = 42/219 (19%)

Query: 137 SSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVV---WHPELPLLASSSYDDTIRL 193
           +S  RD S ++W T    E +  +    ++SQ  + +     H +   L        ++ 
Sbjct: 294 NSLIRDTS-YLWRTLLVTENFITVEEYHKYSQGPQQLNSGHLHEDFFRLHFMENRAYLKN 352

Query: 194 WKDYDDDWEC-AAVLNGHE-GTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDG 251
           W  YD  ++     L GH    V C  FE         + +G+DD  +RV+       D 
Sbjct: 353 W--YDSKFKPHRTTLRGHTMKIVTCLQFEDD------YVITGADDKMIRVY-------DA 397

Query: 252 QQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQE 311
           + E     +    HD  ++++ +  +G++ S  +D ++ V            W +  K  
Sbjct: 398 KTEKFITQL--SGHDGGVWALKYGHDGILVSGSTDRSVRV------------WNI--KSG 441

Query: 312 LCHGVYEANI--VKWIDI---NGNMMLATGGDDGCVNLW 345
            C  V++ +   V+ +DI   NG   + TG  D  +++W
Sbjct: 442 KCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVW 480

>Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement
          Length = 587

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 78/180 (43%), Gaps = 19/180 (10%)

Query: 120 HENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPEL 179
           H  EV G+++  DG  L+S S D SV IW+T     ++    V + H+  VK + W P++
Sbjct: 374 HSGEVCGLSYRKDGLQLASGSNDNSVMIWDTRTSMPQF----VKRNHTAAVKAISWCPDV 429

Query: 180 P-LLAS--SSYDDTIRLWKDYDDDWECAAVLNGHE--GTVWCSDFEKGKNGESIRLCSGS 234
           P LLA+     D  I  W +       +++  G +     W   +        I    G+
Sbjct: 430 PNLLATGGGQTDKYIHFW-NTTTGARVSSINTGSQVSSLQWGQSYNGDIMNREIVATGGN 488

Query: 235 DDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVYK 293
            ++ + V+ Y        +     A + + HD +I S   S +G  +A+ G D  L  YK
Sbjct: 489 PENAISVYNY--------ETRFKVAEIVQAHDSRICSSQLSPDGTTLATVGGDENLKFYK 540

>Kwal_26.7570
          Length = 218

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 64/137 (46%), Gaps = 8/137 (5%)

Query: 113 LLAIIEGHENEVKGIAWSHDGA-LLSSCSRDKSVWIWETDQDGEEYEC-ISVLQEHSQDV 170
           L   +EGH   V  +A S     LL S SRDKS+  W+   D ++Y   +   + HS  V
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIV 68

Query: 171 KHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRL 230
           +     P+     S+S+D T+RLW+      +C     GH+  V     ++     + ++
Sbjct: 69  QDCTVTPDGEYALSASWDKTVRLWELATG--KCIQRFVGHKSDVLSVTIDR----RASQI 122

Query: 231 CSGSDDSTVRVWRYIDD 247
            S S D TV+VW  + +
Sbjct: 123 VSASRDKTVKVWNTLGE 139

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 51/129 (39%), Gaps = 13/129 (10%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
             GH + V+    + DG    S S DK+V +WE        +CI     H  DV  V   
Sbjct: 61  FRGHSHIVQDCTVTPDGEYALSASWDKTVRLWELATG----KCIQRFVGHKSDVLSVTID 116

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKN----GESIRLCS 232
                + S+S D T+++W       EC   L GH    W S      N     E++ + S
Sbjct: 117 RRASQIVSASRDKTVKVWNTLG---ECMVTLLGHND--WVSQVRVAPNESPEDETVTVIS 171

Query: 233 GSDDSTVRV 241
              D  V+V
Sbjct: 172 AGMDKVVKV 180

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 70/314 (22%), Positives = 119/314 (37%), Gaps = 70/314 (22%)

Query: 56  DTVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLA 115
           +T H + I  + W P S  +A+GS D TV I                      LE   L 
Sbjct: 51  ETTHTEPINDICWSPDSACVASGSEDFTVEI--------------------THLEYGRLH 90

Query: 116 IIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV-V 174
            + GH   V  + ++  G LL + S D+S+  W    D      +  +  HS  V  +  
Sbjct: 91  KLRGHSAPVLSVVFNCKGNLLCTASVDESIKQW----DVLSGTLLKTMSAHSDPVVSIDT 146

Query: 175 WHPELPLLASSSYDDTIRLWK----------DYDDDWECAAVLNGHEGTVWCSDFEKGKN 224
              +  +L+S SYD  IR++            YD DW+        +G V  S  +  +N
Sbjct: 147 PDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQ------TDDGVVPISQVKFSRN 200

Query: 225 GESIRLCSGSDDSTVRVWRYI---------DDDEDGQQEWICEAILPKVHDRQIYSVSWS 275
           G+ + +   S D  V++W +I         D   + + ++ C           +Y  S +
Sbjct: 201 GKFLLV--RSLDGVVKLWDFIRGCVVRTFKDASGESRMKYSCGMDF-------LYPDSEA 251

Query: 276 TNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLAT 335
            + ++   G DG + V+   S           A  +   G +E + V  +      ++ T
Sbjct: 252 ADVMVVVGGEDGNICVWNAQSK----------AVAQTLKGQHEDSPVIAVSCK-ETLVCT 300

Query: 336 GGDDGCVNLWNWTD 349
              +G  +LW W D
Sbjct: 301 LSLNGICHLWRWVD 314

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 104/245 (42%), Gaps = 27/245 (11%)

Query: 105 TTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQ 164
           T  ++ +  + I++GH N++    WS D  L+ S S+D  + +W++    +     S + 
Sbjct: 69  TPGAINLKPVGILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLKR----SAIP 124

Query: 165 EHSQDVKHVVWHPELPLLASSSYDDT---IRLWKDYDDDWECAAVLNGHEGTVWCSDFEK 221
             SQ V      P   L AS+  ++     R+ +         ++  GH G +   +F  
Sbjct: 125 LDSQWVLTCALSPSGALAASAGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFVS 184

Query: 222 GKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIA 281
               ES R+ + S D T  +W    D    ++       L  V    I   + S N + A
Sbjct: 185 ----ES-RVVTSSGDMTCALW----DIPKAKRVREYSDHLGDVLAISIPVTNLSKNNMFA 235

Query: 282 STGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGC 341
           S GSDG   ++   S           A Q+   G  ++N +K+   +GN  +A G DDG 
Sbjct: 236 SCGSDGYTFIWDVRSPS---------AVQQFSIGSCDSNCLKFFP-DGN-SVAVGNDDGT 284

Query: 342 VNLWN 346
           ++L++
Sbjct: 285 ISLFD 289

>KLLA0C16643g complement(1457590..1458498) highly similar to
           sp|Q04491 Saccharomyces cerevisiae YLR208w SEC13 protein
           transport protein, start by similarity
          Length = 302

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 88/209 (42%), Gaps = 29/209 (13%)

Query: 113 LLAIIEGHENEVKGIAWSHD--GALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDV 170
           L+  ++GHE  V  + W+H   G +L+SCS D  V IW+  +    +  I+  + HS  V
Sbjct: 45  LVDTLQGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWK--EVNGRWSQIAAHEVHSASV 102

Query: 171 KHVVWHPEL--PLLASSSYDDTIRLWKDYDDDWECAAVLNGHE----GTVWCS-----DF 219
             + W P    PLL ++S D  + + +  ++      +++ H        W         
Sbjct: 103 NSIQWAPHEYGPLLLAASSDGKVSVVEFKENGTTSPIIIDAHSIGANTACWAPATLQQQS 162

Query: 220 EKGKNGESI-----RLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSW 274
            +G +G +      R  +G  D+ V++W+Y  D      E   E      H   +  V+W
Sbjct: 163 NQGTSGSASPQQVRRFVTGGADNLVKIWKYNSDAATYLLEHTLEG-----HSDWVRDVAW 217

Query: 275 STNGL----IASTGSDGTLAVYKEVSNGD 299
           S   L    +AS   D T  ++ + S  D
Sbjct: 218 SPTVLSRSYLASVSQDRTCIIWTQDSKED 246

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 77/201 (38%), Gaps = 15/201 (7%)

Query: 4   KLAKSLKLQNDKLWSLDYSHG----LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVH 59
           KL  +L+     +W +D++H     +LA+ S D K+ I    N    Q++  +V     H
Sbjct: 44  KLVDTLQGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEVNGRWSQIAAHEV-----H 98

Query: 60  KKAIRCVAWRPH--SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
             ++  + W PH    LL A S D  VS+                     +      A +
Sbjct: 99  SASVNSIQWAPHEYGPLLLAASSDGKVSVVEFKENGTTSPIIIDAHSIGANTACWAPATL 158

Query: 118 EGHENE-VKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           +   N+   G A         +   D  V IW+ + D   Y     L+ HS  V+ V W 
Sbjct: 159 QQQSNQGTSGSASPQQVRRFVTGGADNLVKIWKYNSDAATYLLEHTLEGHSDWVRDVAWS 218

Query: 177 PEL---PLLASSSYDDTIRLW 194
           P +     LAS S D T  +W
Sbjct: 219 PTVLSRSYLASVSQDRTCIIW 239

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 58/120 (48%), Gaps = 12/120 (10%)

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           LA+ S D T+++++   +  +    L GHEG VW  D+   K G  + L S S D  V +
Sbjct: 24  LATCSSDHTVKIFEVEGETHKLVDTLQGHEGPVWQVDWAHPKFG--VILASCSYDGKVLI 81

Query: 242 WRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTN---GLIASTGSDGTLAVYKEVSNG 298
           W+ ++        W  +    +VH   + S+ W+ +    L+ +  SDG ++V +   NG
Sbjct: 82  WKEVNG------RW-SQIAAHEVHSASVNSIQWAPHEYGPLLLAASSDGKVSVVEFKENG 134

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 114/303 (37%), Gaps = 58/303 (19%)

Query: 19  LDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAW-RPHSN-LLA 76
           LDY    LAT S+D  +KI  V         L+D L    H+  +  V W  P    +LA
Sbjct: 17  LDYYGKRLATCSSDHTVKIFEVEGETH---KLVDTLQG--HEGPVWQVDWAHPKFGVILA 71

Query: 77  AGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWS-HD-GA 134
           + S+D  V IW                          +A  E H   V  I W+ H+ G 
Sbjct: 72  SCSYDGKVLIWKEVNG-----------------RWSQIAAHEVHSASVNSIQWAPHEYGP 114

Query: 135 LLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP----------------- 177
           LL + S D  V + E  ++G     I  +  HS       W P                 
Sbjct: 115 LLLAASSDGKVSVVEFKENGTTSPII--IDAHSIGANTACWAPATLQQQSNQGTSGSASP 172

Query: 178 -ELPLLASSSYDDTIRLWKDYDDD---WECAAVLNGHEGTVWCSDFEKGKNGESIR-LCS 232
            ++    +   D+ +++WK Y+ D   +     L GH    W  D        S   L S
Sbjct: 173 QQVRRFVTGGADNLVKIWK-YNSDAATYLLEHTLEGHSD--WVRDVAWSPTVLSRSYLAS 229

Query: 233 GSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAV 291
            S D T  +W     ++  ++  + E   P V    ++  SWS +G ++A +  D T+ +
Sbjct: 230 VSQDRTCIIWTQDSKEDTWKKTLLKEDKFPDV----LWRASWSLSGNILALSCGDNTVTL 285

Query: 292 YKE 294
           +KE
Sbjct: 286 WKE 288

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 60/161 (37%), Gaps = 26/161 (16%)

Query: 56  DTVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXT---------- 105
           D  H+  I  + W P  N L +G  D+ V +W                 +          
Sbjct: 211 DAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFEELRGHAGRVSRVKVHPSGRL 270

Query: 106 TNSLEMDL------------LAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQD 153
             S   DL            L + EGH   V  IA+  DGALL+S   D    IW    D
Sbjct: 271 AASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIW----D 326

Query: 154 GEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
               E I  L+ H+  +  V W P    LA++  D T+R+W
Sbjct: 327 LRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVW 367

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 79/184 (42%), Gaps = 28/184 (15%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H KA+  +A++    LLA+   D+  +IW                   +    + +  +E
Sbjct: 297 HSKAVYTIAFQSDGALLASAGLDAVCAIW-------------------DLRSGEPIMKLE 337

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH   + G+ WS +G  L++   D +V +W+    G E   ++  Q  + DVK       
Sbjct: 338 GHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLA-HQVAALDVK--FKKNN 394

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
              L S  +D  + ++    D+W+  A L GH   V+  D    ++G +I   SG  D +
Sbjct: 395 GTFLVSCGHDRLVNIFN--ADNWQKLASLEGHTDRVFTVDIT--EDGSTI--YSGGKDRS 448

Query: 239 VRVW 242
           ++ W
Sbjct: 449 LKQW 452

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 81/189 (42%), Gaps = 32/189 (16%)

Query: 161 SVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFE 220
           S+   H   +  + WHP+   L S   D+ ++LW    + +E    L GH G V      
Sbjct: 209 SIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFE---ELRGHAGRV-----S 260

Query: 221 KGKNGESIRLC-SGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG- 278
           + K   S RL  S S D T  +W           E   E  L + H + +Y++++ ++G 
Sbjct: 261 RVKVHPSGRLAASASFDLTWILWDL---------ERKVELQLQEGHSKAVYTIAFQSDGA 311

Query: 279 LIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGN-MMLATGG 337
           L+AS G D   A++       D    E I K E       A  +  +D + N   LAT G
Sbjct: 312 LLASAGLDAVCAIW-------DLRSGEPIMKLE-----GHAGAISGVDWSPNGYQLATAG 359

Query: 338 DDGCVNLWN 346
            DG V +W+
Sbjct: 360 ADGTVRVWD 368

>Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement
          Length = 1140

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 64/141 (45%), Gaps = 12/141 (8%)

Query: 105 TTNSLEMDLLAIIEGHENEVKGIAW-SHDGALLSSCSRDKSVWIWETDQDGEEYECISVL 163
           +TN++E     I+ GH   +  I +  H   +L++CS D  V  W+       Y   S  
Sbjct: 102 STNAIEH----ILHGHFRAITDINFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEW 157

Query: 164 QEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGK 223
           +  +  VK   W+     + +SS+ D + +W D          L GHEG+V   DF K K
Sbjct: 158 RAGASQVK---WNFRNSNIMASSHSDHVCIW-DLRKGCTPLYTLQGHEGSVNNIDFNKAK 213

Query: 224 NGESIRLCSGSDDSTVRVWRY 244
             E   + S S+D TV+ W Y
Sbjct: 214 ETE---IMSSSNDGTVKFWDY 231

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 79/205 (38%), Gaps = 41/205 (20%)

Query: 51  MDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLE 110
           +     T H +++  + W P S  +A  S D T+ I                    N + 
Sbjct: 47  LSAFIPTSHVESMSDICWSPDSQCIATASDDFTIEI--------------------NHIT 86

Query: 111 MDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDV 170
              L  + GH   V  + ++  G LL S S D+S+ IW+    G   + IS   E    +
Sbjct: 87  YGRLHRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDV-LTGTLLKTISAHSEPVVSI 145

Query: 171 KHVVWHPELPLLASSSYDDTIRLWK----------DYDDDWECAAVLNGHEGTVWCSDFE 220
              V  P   +L+S SYD  IR++            YD DW+         G V  S  +
Sbjct: 146 DMPVCDPS--ILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWK------SENGVVPISQVK 197

Query: 221 KGKNGESIRLCSGSDDSTVRVWRYI 245
              NG+   L   S D  +++W +I
Sbjct: 198 FSVNGK--YLLVKSLDGVLKIWDFI 220

>Kwal_56.24163
          Length = 729

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 67/157 (42%), Gaps = 33/157 (21%)

Query: 66  VAWRPH-SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEV 124
           VA+ P   +  A+   D TV IW+                T N         ++ HE   
Sbjct: 3   VAFNPKDPSTFASACLDHTVKIWS------------LGQPTAN-------FTLQAHE--T 41

Query: 125 KGIAWS-----HDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPEL 179
           +G+ +       D   L + S D++V IW    D +   C++ L+ H  +V + V+HP L
Sbjct: 42  RGVNYVDYYPLQDKPYLITSSDDRTVKIW----DYQTKSCVATLEGHMANVSYAVFHPSL 97

Query: 180 PLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWC 216
           P++ S S D T+++W    + ++    LN      WC
Sbjct: 98  PIILSGSEDGTLKVWN--SNTYKLEKTLNLGLERSWC 132

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 49/120 (40%), Gaps = 12/120 (10%)

Query: 173 VVWHPELP-LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLC 231
           V ++P+ P   AS+  D T+++W            L  HE T   +  +     +   L 
Sbjct: 3   VAFNPKDPSTFASACLDHTVKIWSL--GQPTANFTLQAHE-TRGVNYVDYYPLQDKPYLI 59

Query: 232 SGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAV 291
           + SDD TV++W Y        Q   C A L        Y+V   +  +I S   DGTL V
Sbjct: 60  TSSDDRTVKIWDY--------QTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKV 111

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 67/167 (40%), Gaps = 50/167 (29%)

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           +GH +    +A+S DG+ + + S D  + +W+         C++  +EH+  V  V +  
Sbjct: 342 QGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGF----CLATFEEHTSSVTAVQFAK 397

Query: 178 ELPLLASSSYDDTIRLW-----KDYDD-------DWECAAV------------------- 206
              ++ SSS D T+R W     +++          + C AV                   
Sbjct: 398 RGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHV 457

Query: 207 -----------LNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
                      L+GHEG V C  F +    E+  L S S D T+R+W
Sbjct: 458 WSVQTGQLLDALSGHEGPVSCLSFSQ----ENSVLASASWDKTIRIW 500

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 75/198 (37%), Gaps = 43/198 (21%)

Query: 15  KLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVH--------------- 59
           K+W  D + G       +    +  V  A RGQV     LD TV                
Sbjct: 370 KVW--DITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTG 427

Query: 60  --KKAIRCVAWRPHSNLLAAGSFDST-VSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAI 116
             +    C+A  P   ++ AGS D+  + +W+                        LL  
Sbjct: 428 TERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTG-------------------QLLDA 468

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           + GHE  V  +++S + ++L+S S DK++ IW      ++ E I V      DV  +   
Sbjct: 469 LSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPIEVY----SDVLALSMR 524

Query: 177 PELPLLASSSYDDTIRLW 194
           P+   +A S+    I ++
Sbjct: 525 PDGKEVAVSTLKGQISIF 542

 Score = 36.6 bits (83), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 55/125 (44%), Gaps = 11/125 (8%)

Query: 126 GIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQE-----HSQDVKHVVWHPELP 180
            + +S DG L +  S  + + IW+T    ++ +    ++      H QD+  + W  +  
Sbjct: 101 AVKFSPDGRLFALAS-GRFLQIWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSR 159

Query: 181 LLASSSYDDTIRLWK-DYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTV 239
            + ++S D + ++W  D ++    A   NGH   V  + F   +     ++ + S D  V
Sbjct: 160 FILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQE----KIYTVSKDGAV 215

Query: 240 RVWRY 244
            VW +
Sbjct: 216 FVWEF 220

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 33/77 (42%), Gaps = 1/77 (1%)

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH  ++  + WS D   + + S+D S  IW  D + E+    +    H   V    +  +
Sbjct: 144 GHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSE-EKNLAATTFNGHRDYVMGAFFSHD 202

Query: 179 LPLLASSSYDDTIRLWK 195
              + + S D  + +W+
Sbjct: 203 QEKIYTVSKDGAVFVWE 219

>Scas_720.83d
          Length = 915

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 66/167 (39%), Gaps = 50/167 (29%)

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           +GH +    + +S DG+ + + + D  + +W    D     C++  QEH+  V  V +  
Sbjct: 340 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVW----DVVSGFCLATFQEHTSSVTQVQFAK 395

Query: 178 ELPLLASSSYDDTIRLW-----KDYDD-------DWECAAV------------------- 206
              +L SSS D T+R W     +++          + C AV                   
Sbjct: 396 RGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHV 455

Query: 207 -----------LNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
                      L+GHEG V C  F +    E+  L S S D TVRVW
Sbjct: 456 WSVQTGQLLDTLSGHEGPVSCLAFSQ----ENSVLASASWDKTVRVW 498

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 55/144 (38%), Gaps = 37/144 (25%)

Query: 37  IINVTNAPRGQVSLMDVLDDTVH-----------------KKAIRCVAWRPHSNLLAAGS 79
           +  V  A RGQV     LD TV                  +    C+A  P   ++ AGS
Sbjct: 388 VTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGS 447

Query: 80  FDST-VSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSS 138
            D+  + +W+                        LL  + GHE  V  +A+S + ++L+S
Sbjct: 448 LDNFDIHVWSVQTG-------------------QLLDTLSGHEGPVSCLAFSQENSVLAS 488

Query: 139 CSRDKSVWIWETDQDGEEYECISV 162
            S DK+V +W      ++ E   V
Sbjct: 489 ASWDKTVRVWSIFGRSQQVEPFDV 512

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 56/124 (45%), Gaps = 11/124 (8%)

Query: 127 IAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQE-----HSQDVKHVVWHPELPL 181
           + +S DG L +  +  + + IW+T    E+ +    ++      H QD+  + W  +   
Sbjct: 102 VKFSPDGKLFA-LATGRFLQIWKTPDATEDRQFAPFVRYRVHAGHFQDILSLTWSLDSRF 160

Query: 182 LASSSYDDTIRLWKDYDDDWECAAV-LNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
           + S+S D T R+W    ++ + A++   GH   V  + F   +     ++ + S D  + 
Sbjct: 161 IISTSKDLTARIWSIDSEEKDLASMTFAGHRDYVMGAFFSADQE----KIYTVSKDGALF 216

Query: 241 VWRY 244
           VW +
Sbjct: 217 VWEF 220

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 18/92 (19%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAI-I 117
           H + I  + W   S  + + S D T  IW                 + +S E DL ++  
Sbjct: 145 HFQDILSLTWSLDSRFIISTSKDLTARIW-----------------SIDSEEKDLASMTF 187

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWE 149
            GH + V G  +S D   + + S+D ++++WE
Sbjct: 188 AGHRDYVMGAFFSADQEKIYTVSKDGALFVWE 219

>Scas_721.7
          Length = 325

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 78/198 (39%), Gaps = 44/198 (22%)

Query: 57  TVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAI 116
           T H   I  VAW P +  LA+ S D T+ I                      L    L  
Sbjct: 54  TSHVAPISEVAWSPDNQCLASASDDFTIEI--------------------THLTHGCLHR 93

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           + GH   V  + ++  G LL + S D+S+ IW+T         +  +  HS+ V  +   
Sbjct: 94  LMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGA----ILKTISAHSESVVSLSIC 149

Query: 177 PEL--PLLASSSYDDTIRLWK----------DYDDDWECAAVLNGHEGTVWCSDFEKGKN 224
           P+    +LAS S+D  IRL+            YD DW+        +G V  S      N
Sbjct: 150 PDRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWK------SDDGVVPISQVRFSPN 203

Query: 225 GESIRLCSGSDDSTVRVW 242
           G+ + +   S D  V++W
Sbjct: 204 GKFLLV--SSFDGIVKIW 219

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/221 (20%), Positives = 80/221 (36%), Gaps = 62/221 (28%)

Query: 60  KKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEG 119
           K  I  + W P    L   +++   S+W+                       +  +I++ 
Sbjct: 81  KHVIPALTWTPEGRRLVVATYNGEFSLWSGS-------------------SFNFESIMQA 121

Query: 120 HENEVKGIAWSHDGALLSSCSRDKSVWIWETD------QDGEEYECI------------- 160
           H++ V  + +SH G  + S S D  + IW+ +       D    EC+             
Sbjct: 122 HDSAVTVMTYSHTGDWMVSGSADGELKIWQPNFNMVKVMDQAHMECVREISFSPTDQKFV 181

Query: 161 -------------------SVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDW 201
                               VL  H  DVK   WHP++ L+ S S D+ I+ W       
Sbjct: 182 SCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKFWDPRSG-- 239

Query: 202 ECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
            C + + G + T+  + F+  K G  + +   S D T +V+
Sbjct: 240 SCVSTMLGFKHTIISTKFQP-KQGNLLSVI--SKDKTCKVY 277

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 58  VHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTR 89
            H+K +  +A+ P  +++A+ S D T+  WTR
Sbjct: 338 AHEKCVTSLAYSPIGHIMASASKDRTIRFWTR 369

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 70/179 (39%), Gaps = 33/179 (18%)

Query: 19  LDYSHGL--LATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLA 76
           + YSH    + +GS D ++KI       +   +++ V+D   H + +R +++ P      
Sbjct: 129 MTYSHTGDWMVSGSADGELKIW------QPNFNMVKVMDQ-AHMECVREISFSPTDQKFV 181

Query: 77  AGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALL 136
           + S D+ + IW                   N        ++ GH  +VK   W     L+
Sbjct: 182 SCSDDNVLKIW-------------------NFSNGQQERVLSGHHWDVKSCDWHPKMGLI 222

Query: 137 SSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPEL-PLLASSSYDDTIRLW 194
            S S+D  +  W    D     C+S +      +    + P+   LL+  S D T +++
Sbjct: 223 VSGSKDNLIKFW----DPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVY 277

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 65/168 (38%), Gaps = 22/168 (13%)

Query: 124 VKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLA 183
           +  + W+ +G  L   + +    +W     G  +   S++Q H   V  + +      + 
Sbjct: 84  IPALTWTPEGRRLVVATYNGEFSLWS----GSSFNFESIMQAHDSAVTVMTYSHTGDWMV 139

Query: 184 SSSYDDTIRLWKDYDDDWECAAVLN-GHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           S S D  +++W+    ++    V++  H   V    F         +  S SDD+ +++W
Sbjct: 140 SGSADGELKIWQP---NFNMVKVMDQAHMECVREISFSPTDQ----KFVSCSDDNVLKIW 192

Query: 243 RYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTN-GLIASTGSDGTL 289
            +     +GQQE +        H   + S  W    GLI S   D  +
Sbjct: 193 NF----SNGQQERVLSG-----HHWDVKSCDWHPKMGLIVSGSKDNLI 231

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 79/187 (42%), Gaps = 37/187 (19%)

Query: 57  TVHKKAIRCVAWRPH-SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLA 115
           T H+  +  VA+ P   N  A+G  D T+ +W                    S+  D+  
Sbjct: 137 TGHEHFVMSVAFNPKDPNQFASGCLDHTIKVW--------------------SIGQDVPN 176

Query: 116 I-IEGHENEVKGIAWS-----HDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQD 169
             ++ H  E KG+ +       D   L + S D ++ +W    D +    ++ L+ H  +
Sbjct: 177 FTLKAH--ETKGVNYVDYYPLQDKPYLITTSDDGTIKVW----DYQTKSNVATLEGHMAN 230

Query: 170 VKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIR 229
           V + V+HP LP++ S S D T+++W    + ++    LN      WC       +G+   
Sbjct: 231 VSYAVFHPTLPIIISGSEDGTLKIWN--ANTYKLEKTLNIGLERSWC--IATHPSGKRNY 286

Query: 230 LCSGSDD 236
           + SG D+
Sbjct: 287 IASGFDN 293

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 6/86 (6%)

Query: 158 ECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCS 217
           E ++  + H   ++ +  HP  P + + S D TI+LW +++ +W C     GHE  V   
Sbjct: 88  EKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLW-NWEKNWGCQQTFTGHEHFVMSV 146

Query: 218 DF-EKGKNGESIRLCSGSDDSTVRVW 242
            F  K  N    +  SG  D T++VW
Sbjct: 147 AFNPKDPN----QFASGCLDHTIKVW 168

 Score = 32.3 bits (72), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 54/120 (45%), Gaps = 18/120 (15%)

Query: 230 LCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTN--GLIASTGSDG 287
           + +GSDD T+++W +       ++ W C+      H+  + SV+++       AS   D 
Sbjct: 112 VLTGSDDLTIKLWNW-------EKNWGCQQTFTG-HEHFVMSVAFNPKDPNQFASGCLDH 163

Query: 288 TLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWNW 347
           T+ V+   S G D  ++ + A     H     N V +  +     L T  DDG + +W++
Sbjct: 164 TIKVW---SIGQDVPNFTLKA-----HETKGVNYVDYYPLQDKPYLITTSDDGTIKVWDY 215

>Scas_585.8
          Length = 460

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 81/201 (40%), Gaps = 34/201 (16%)

Query: 58  VHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
            H  A+ C+ +    + + +G  D  + IW                        +++   
Sbjct: 129 AHDSAVSCIQYSHAGDWMCSGDADGGIKIW--------------------QPNFNMVKEF 168

Query: 118 E-GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           E  H   ++ I++S++ +   +CS D  + IW       E      L  H  D+K   WH
Sbjct: 169 ENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVE----RTLSGHHWDIKSCDWH 224

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDD 236
           PE+ L+ S+S D+ ++LW       +C + +   + TV  + F+  +      L + S D
Sbjct: 225 PEMGLIVSASKDNLVKLWDPRSG--QCISTIIKFKHTVLKTRFQPTRGN---LLAAISKD 279

Query: 237 STVRVWRYIDDDEDGQQEWIC 257
            + RV+    D     +E +C
Sbjct: 280 KSCRVF----DIRHSMKELMC 296

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 74/177 (41%), Gaps = 21/177 (11%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           + GH  ++K   W  +  L+ S S+D  V +W    D    +CIS + +    V    + 
Sbjct: 211 LSGHHWDIKSCDWHPEMGLIVSASKDNLVKLW----DPRSGQCISTIIKFKHTVLKTRFQ 266

Query: 177 PEL-PLLASSSYDDTIRLWKDYDDDWECAAVLN--GHEGTVWCSDFEKGKNGESIRLCSG 233
           P    LLA+ S D + R++       E   V +   +    W          ES+    G
Sbjct: 267 PTRGNLLAAISKDKSCRVFDIRHSMKELMCVRDEVDYMTLTW------NPINESM-FTVG 319

Query: 234 SDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTL 289
           + D  ++ +  + D E          ++P  HD+ + S++++  G ++AS   D T+
Sbjct: 320 NYDGAMKYFDLLQDLEGPSH------VIPYAHDKCVTSMAYNPAGNILASASKDRTI 370

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 9/53 (16%)

Query: 46  GQVSLMDVLDDT---------VHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTR 89
           G +   D+L D           H K +  +A+ P  N+LA+ S D T+  WTR
Sbjct: 323 GAMKYFDLLQDLEGPSHVIPYAHDKCVTSMAYNPAGNILASASKDRTIRFWTR 375

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 80/181 (44%), Gaps = 23/181 (12%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
            +GH + V+    + DGA   S S DK++ +W+    GE Y+       H  DV  V   
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDV-ATGETYQR---FVGHKSDVMSVDID 116

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKN----GESIRLCS 232
            +  ++ S S D TI++W       +C A L GH    W S      N     +S+ + S
Sbjct: 117 KKASMIISGSRDKTIKVWTIKG---QCLATLLGHND--WVSQVRVVPNEKADDDSVTIIS 171

Query: 233 GSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAV 291
             +D  V+ W           ++  EA     H+  I +++ S +G LIAS G DG + +
Sbjct: 172 AGNDKMVKAWNL--------NQFQIEADFIG-HNSNINTLTASPDGTLIASAGKDGEIML 222

Query: 292 Y 292
           +
Sbjct: 223 W 223

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 61/132 (46%), Gaps = 8/132 (6%)

Query: 113 LLAIIEGHENEVKGIAWSHDGA-LLSSCSRDKSVWIWETDQDGEEYEC-ISVLQEHSQDV 170
           L   +EGH   V  +A S     LL S SRDK++  W+   D +++   +   + HS  V
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 171 KHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRL 230
           +      +     S+S+D T+RLW       E      GH+  V   D +K    ++  +
Sbjct: 69  QDCTLTADGAYALSASWDKTLRLWDVATG--ETYQRFVGHKSDVMSVDIDK----KASMI 122

Query: 231 CSGSDDSTVRVW 242
            SGS D T++VW
Sbjct: 123 ISGSRDKTIKVW 134

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 55/142 (38%), Gaps = 30/142 (21%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           HK  +  V     ++++ +GS D T+ +WT                    ++   LA + 
Sbjct: 106 HKSDVMSVDIDKKASMIISGSRDKTIKVWT--------------------IKGQCLATLL 145

Query: 119 GHENEVKGI------AWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           GH + V  +          D   + S   DK V  W  +Q   E + I     H+ ++  
Sbjct: 146 GHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIG----HNSNINT 201

Query: 173 VVWHPELPLLASSSYDDTIRLW 194
           +   P+  L+AS+  D  I LW
Sbjct: 202 LTASPDGTLIASAGKDGEIMLW 223

>Kwal_14.1611
          Length = 334

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 69/143 (48%), Gaps = 11/143 (7%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           +   I GHE+ V  I++   G  +++CS D+ + ++   ++  E++     + H   V  
Sbjct: 1   MKPFITGHEDLVHDISYDFYGRHVATCSSDQHIKVFRLVRETNEWQLSDSWKAHDSSVVG 60

Query: 173 VVW-HPEL-PLLASSSYDDTIRLWKDYDDDWECAA-------VLNGHEGTVWCSDFEKGK 223
           + W  PE   ++AS SYD  + LW++  D  EC+         LN   G ++   F  G 
Sbjct: 61  LDWASPEYGRIIASVSYDKQVNLWEEEPDAAECSGRRWTKLCTLNDATGPLFSVKFAPGH 120

Query: 224 NGESIRLCSGSDDSTVRVWRYID 246
            G  ++L +  +D  +R++  ++
Sbjct: 121 LG--LKLGAIGNDGILRIYEAME 141

 Score = 35.4 bits (80), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 107 NSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEH 166
           +SL+++L++  + H  EV  ++W+  G +LSS   D  V +W+      E++C+SV+   
Sbjct: 274 SSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGDDGKVRLWKASY-SSEFKCMSVISAQ 332

Query: 167 SQ 168
            +
Sbjct: 333 QK 334

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 60/133 (45%), Gaps = 31/133 (23%)

Query: 110 EMDLLAIIEGHENEVKGIAWSHDGA----LLSSCSRDKSVWIW---ETDQDGE------- 155
           ++ + A +EGH   ++ ++W+        L+++  +D  V I+   ET QD +       
Sbjct: 201 KLYVAAKLEGHAGLIRSVSWAPSVGRWYQLIATACKDGKVRIFKLMETAQDDQDAMSVDQ 260

Query: 156 ----------------EYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK-DYD 198
                           + E +S   +H  +V  V W+    +L+S+  D  +RLWK  Y 
Sbjct: 261 VEEESENGSESIPSSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGDDGKVRLWKASYS 320

Query: 199 DDWECAAVLNGHE 211
            +++C +V++  +
Sbjct: 321 SEFKCMSVISAQQ 333

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 65/167 (38%), Gaps = 50/167 (29%)

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           +GH + +  +A+S DGA + + + D  + IW    D     C++  +EH+  V  V +  
Sbjct: 353 QGHFDALNALAYSPDGARIVTAAEDGKIKIW----DIVSGFCLATFEEHTSSVTSVQFAK 408

Query: 178 ELPLLASSSYDDTIRLW-----------------------KDYDDDWECAA--------- 205
              ++ SSS D T++ W                        D   +  CA          
Sbjct: 409 NGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEVVCAGSLDNYDIQV 468

Query: 206 ----------VLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
                      L+GHEG V C  F +    E+  L S S D T+RVW
Sbjct: 469 WSVQTGQLLDTLSGHEGPVSCLSFSR----ENSILASASWDKTIRVW 511

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 68/176 (38%), Gaps = 41/176 (23%)

Query: 37  IINVTNAPRGQVSLMDVLDDTV-----------------HKKAIRCVAWRPHSNLLAAGS 79
           + +V  A  GQ+     LD TV                  +    C+A  P   ++ AGS
Sbjct: 401 VTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEVVCAGS 460

Query: 80  FDST-VSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSS 138
            D+  + +W+                        LL  + GHE  V  +++S + ++L+S
Sbjct: 461 LDNYDIQVWSVQTG-------------------QLLDTLSGHEGPVSCLSFSRENSILAS 501

Query: 139 CSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
            S DK++ +W      ++ E I    E   DV  +   P+   +A S+ +  +  +
Sbjct: 502 ASWDKTIRVWSIFGRSQQVEPI----EAYSDVLDISMRPDGKQVAVSTLNGQLSFF 553

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 63/121 (52%), Gaps = 7/121 (5%)

Query: 124 VKGIAWSHDGALLSSCSRDKSVWIWETDQ--DGEEYECISVLQEHSQDVKHVVWHPELPL 181
           ++ ++ + DG++L + +   + ++W+     D    E ++  + H++ +  V+   ++  
Sbjct: 162 LQSLSVASDGSMLVAGNNKGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKH 221

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           LA+ S D T R+W + +D++E    L+GH+  VW   F    + +S  L +   D  VR+
Sbjct: 222 LATCSADHTARVW-NIEDNFELETTLDGHQRWVWDCAF----SADSAYLVTACSDHYVRL 276

Query: 242 W 242
           W
Sbjct: 277 W 277

 Score = 35.0 bits (79), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 5/78 (6%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
            EGH+  V  IA+  +   + S S D ++ +W+      +        +H+  V  V  H
Sbjct: 71  FEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRN-----YKHNAPVNEVAIH 125

Query: 177 PELPLLASSSYDDTIRLW 194
           P    L S   D  IR+W
Sbjct: 126 PNQGELISCDQDGNIRIW 143

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 118/303 (38%), Gaps = 60/303 (19%)

Query: 50  LMDVLDDTVHKKAIRCVAWRPHSNL-LAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNS 108
           LM V++   H   +R VA  P  N   A GS D+T+ IW                  T  
Sbjct: 121 LMRVING--HNGWVRTVAVDPIDNEWFATGSNDTTIKIW---------------DLATGK 163

Query: 109 LEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQ 168
           L++ L     GH   VK I  S     + S S DK V  W    D E+   I     H  
Sbjct: 164 LKLTL----SGHIMTVKDICISKRHPYMFSASEDKLVKCW----DLEKNRVIRDYHGHLS 215

Query: 169 DVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGT---VWCSDFEKGKNG 225
            V  V  HP L L+A++  D  +RLW D          + GH+     V C   +     
Sbjct: 216 GVHTVDIHPTLNLIATAGRDSVVRLW-DIRTKLPVMT-MAGHKSPINRVKCLPVDP---- 269

Query: 226 ESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGS 285
              ++ S S D+TVR+W    D   G+   +       V D  I+   +S    I+S  +
Sbjct: 270 ---QVVSCSADATVRLW----DITAGKTLKVLTHHKRSVRDIGIHPGEFS----ISSACT 318

Query: 286 DGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYE-ANIVKWIDINGNMMLATGGDDGCVNL 344
                        DD   W++   Q L +   E   I+  + IN + +L  G D+G ++ 
Sbjct: 319 -------------DDIRSWKLPEGQLLTNFQSEKTGIINTLSINQDDVLFAGSDNGVLSF 365

Query: 345 WNW 347
           +++
Sbjct: 366 YDY 368

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 76/186 (40%), Gaps = 31/186 (16%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H+K I  ++  P+ ++ A  S+D T  +W                   N    + +A + 
Sbjct: 494 HEKDINAISMAPNDSIFATASYDKTCKLW-------------------NVDTGEPVATLA 534

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
            H+  +  +++      +++CS DK+V IW      E +  +  L+ H+  V+   +  +
Sbjct: 535 NHKRGLWDVSFCESEKWIATCSGDKTVKIWSL----ESFTVLKTLEGHTNAVQRCSFMNK 590

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWC-SDFEKGKNGESIRLCSGSDDS 237
              L S+  D  I++W     D  C   L+GH   +W  S  E G       + S   DS
Sbjct: 591 QKQLVSAGADGLIKVWDIASGD--CIKNLDGHSNRIWALSVLEDGD-----LIISADADS 643

Query: 238 TVRVWR 243
             + W+
Sbjct: 644 VFQFWK 649

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 116 IIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV-- 173
           + EGH + +  +A + DG  L++ S+DK+  +W  +   + +   +    H+  V  V  
Sbjct: 385 LYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCL 444

Query: 174 --VWHPELP-LLASSSYDDTIRLWK 195
             V     P  + ++S D T++ W+
Sbjct: 445 PNVMEKNYPKYIITASNDLTVKKWE 469

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 70/202 (34%), Gaps = 59/202 (29%)

Query: 60  KKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEG 119
           K  I  + W P    L   ++    S+W                   N    +  +I++ 
Sbjct: 81  KHVIPAIKWTPEGRRLVVATYSGEFSLW-------------------NGSTFNFESIMQA 121

Query: 120 HENEVKGIAWSHDGALLSSCSRDKSVWIWETD------QDGEEYECIS------------ 161
           H++ V  + +SH G  L S   D  + IW+ +       D    EC+             
Sbjct: 122 HDSAVTTMEYSHAGDWLISGDSDGIIKIWQPNFNMVKVLDQAHMECVRDVSFSGTDSKFV 181

Query: 162 --------------------VLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDW 201
                               VL  H  DVK   WHP + L+ S S D+ I+LW       
Sbjct: 182 TCSDDNILKIWNFSNGQQERVLSGHHWDVKSCDWHPTMGLIVSGSKDNLIKLWDPRSG-- 239

Query: 202 ECAAVLNGHEGTVWCSDFEKGK 223
           +C + + G + T+  + F+  K
Sbjct: 240 QCISTILGFKHTIIKTKFQPTK 261

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 11/55 (20%)

Query: 46  GQVSLMDVLDDT-----------VHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTR 89
           G +   D+L DT            H K I  +++ P  ++LA+ S D T+  WTR
Sbjct: 315 GSLKHFDLLQDTGSSNSFHDIPYAHDKCITSLSYNPVGHILASASKDRTIRFWTR 369

>Scas_695.15
          Length = 327

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 87/212 (41%), Gaps = 30/212 (14%)

Query: 40  VTNAPRGQVSLMDVLDDTV-----HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXX 94
           VT++  G + + DV   +V     H   +  V   P+   L +   D T+ IW       
Sbjct: 111 VTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGTIKIW------- 163

Query: 95  XXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQ-- 152
                      T+ L      I +     ++ ++ + DG++L + +     ++WE     
Sbjct: 164 ----DLGENQCTHQL------IPDDDNTSLQSLSVASDGSMLVAANNKGDCYVWEMPNHT 213

Query: 153 DGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK--DYDDDWECAAVLNGH 210
           D    + I+    H   +  VV   ++  +A+ S D T ++W   + +DD+     L+GH
Sbjct: 214 DASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDDFNLETTLDGH 273

Query: 211 EGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           +  VW   F    + +S  L + S D  VR+W
Sbjct: 274 QRWVWDCAF----SADSAYLVTASSDHYVRLW 301

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 8/90 (8%)

Query: 105 TTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQ 164
           TTN    + +A  EGH+  V  +++  D   + + S D ++ +W+          +    
Sbjct: 82  TTNP---NAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDV-----RSPSVPRNY 133

Query: 165 EHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
           +H+  V  VV HP    L S   D TI++W
Sbjct: 134 KHNAPVNEVVIHPNQGELISCDRDGTIKIW 163

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 90/238 (37%), Gaps = 36/238 (15%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H+K I  ++  P+ +L A  S+D T  IW                   N  + +  A + 
Sbjct: 494 HEKDINAISISPNDSLFATASYDKTCKIW-------------------NLDDGEFQATLA 534

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
            H+  +  +A+     LL++CS DK++ IW      E Y  +  L+ H+  V+   +  +
Sbjct: 535 NHKRGLWDVAFCQYDKLLATCSGDKTIKIWSL----ESYAVVKTLEGHTNAVQRCSFINK 590

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
              L S+  D  + +W       E    L+ H   +W        +GES    +   D  
Sbjct: 591 NKQLISTGADGLVIIWD--LSTGESVKTLDAHNNRIWA--LAVMNDGES--FVTADADGF 644

Query: 239 VRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWS----TNGLIASTGSDGTLAVY 292
              WR   D+ + + E   E    K+   Q      S    TN  + +   D  + +Y
Sbjct: 645 FEFWR---DNSEEEHERNLEQEKLKIEQEQSLQNYLSEGDWTNAFLLAMTLDHPMRLY 699

 Score = 36.6 bits (83), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 103/249 (41%), Gaps = 36/249 (14%)

Query: 114 LAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV 173
           + + EGH + +  +  + DG  +++ S+D SV +W      E++   +    H   V  V
Sbjct: 383 VKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAV 442

Query: 174 VWHPELP-----LLASSSYDDTIRLW---KDYDDDWECAAVLNGHEGTVWCSDFEKGKNG 225
                +P      + ++S D TI+ W   K   D+ E   ++   E T      EK  N 
Sbjct: 443 GLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAH--EKDINA 500

Query: 226 ESIR-----LCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSW-STNGL 279
            SI        + S D T ++W  +DD E        +A L   H R ++ V++   + L
Sbjct: 501 ISISPNDSLFATASYDKTCKIWN-LDDGE-------FQATLAN-HKRGLWDVAFCQYDKL 551

Query: 280 IASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDD 339
           +A+   D T+ ++            E  A  +   G   A + +   IN N  L + G D
Sbjct: 552 LATCSGDKTIKIWS----------LESYAVVKTLEGHTNA-VQRCSFINKNKQLISTGAD 600

Query: 340 GCVNLWNWT 348
           G V +W+ +
Sbjct: 601 GLVIIWDLS 609

>Kwal_14.1710
          Length = 574

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 80/182 (43%), Gaps = 19/182 (10%)

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           E H+ EV GIA+  DG  L+S S D +V IW+T     ++    + ++H+  VK + W P
Sbjct: 359 EEHKGEVCGIAYRPDGLQLASGSNDNTVAIWDTRTSLPQH----IKRQHTAAVKALAWSP 414

Query: 178 ELP-LLAS--SSYDDTIRLWKDYDDDWECAAVLNGHEGTV--WCSDFEKGKNGESIRLCS 232
           ++  LLA+     D  I  W +        ++  G + +   W   +        I    
Sbjct: 415 DISNLLATGGGQTDKHIHFW-NTTTGARTGSINTGSQVSSLHWGQSYNSNAIQREIVATG 473

Query: 233 GSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAV 291
           G  ++ V ++ Y   D   +   I  A     H+ +I S   S +G ++A+ G D  L  
Sbjct: 474 GIPENAVSIYNY---DTKFKVAEIVHA-----HEARICSSQLSPDGTVLATVGGDENLKF 525

Query: 292 YK 293
           YK
Sbjct: 526 YK 527

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 86/208 (41%), Gaps = 46/208 (22%)

Query: 25  LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTV 84
           L+ATGS   +I I +V    R +  ++   ++  HK  +  +A+RP    LA+GS D+TV
Sbjct: 333 LIATGSKSGEIHINDV----RIKNHIVSTWEE--HKGEVCGIAYRPDGLQLASGSNDNTV 386

Query: 85  SIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHD-GALLSS--CSR 141
           +IW                 T  SL      I   H   VK +AWS D   LL++     
Sbjct: 387 AIW----------------DTRTSLPQH---IKRQHTAAVKALAWSPDISNLLATGGGQT 427

Query: 142 DKSVWIWETD--------QDGEEYECISVLQEHSQDV--KHVVWHPELPLLASSSYDDTI 191
           DK +  W T           G +   +   Q ++ +   + +V    +P  A S Y    
Sbjct: 428 DKHIHFWNTTTGARTGSINTGSQVSSLHWGQSYNSNAIQREIVATGGIPENAVSIY---- 483

Query: 192 RLWKDYDDDWECAAVLNGHEGTVWCSDF 219
               +YD  ++ A +++ HE  +  S  
Sbjct: 484 ----NYDTKFKVAEIVHAHEARICSSQL 507

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 74/171 (43%), Gaps = 34/171 (19%)

Query: 72  SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSH 131
           + LL  GS+DSTV+IW                   +     L+  + GH + VK + +  
Sbjct: 269 NKLLLTGSYDSTVAIW-------------------DLATGKLIRRLSGHTDGVKALRF-- 307

Query: 132 DGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTI 191
           D   L + S DK++ +W          C+S  + H   V  V    +  L+ S S D T+
Sbjct: 308 DDQKLITGSLDKTIRVWNYVTGA----CVSTYRGHQDSVLSVDSFRK--LIVSGSADKTV 361

Query: 192 RLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           ++W  + +   C   L GH G V C       + +S    SGSDD T+R+W
Sbjct: 362 KVW--HVESRTC-YTLRGHTGWVNCVKL----HPKSFTCFSGSDDMTIRMW 405

 Score = 35.4 bits (80), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 87/234 (37%), Gaps = 50/234 (21%)

Query: 12  QNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPH 71
             D + S+D    L+ +GS D+ +K+ +V +  R   +L        H   + CV   P 
Sbjct: 338 HQDSVLSVDSFRKLIVSGSADKTVKVWHVES--RTCYTLRG------HTGWVNCVKLHPK 389

Query: 72  SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSH 131
           S    +GS D T+ +W                  TN+     + +  GH  +V+ +    
Sbjct: 390 SFTCFSGSDDMTIRMW---------------DIRTNT----CVRVFHGHVGQVQKVIPLT 430

Query: 132 DGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPL---LASSSYD 188
            G+ L    +D  V     D         +    H   V+   +   LP    L S S D
Sbjct: 431 LGSDLIEDPKDAVV---PPD---------ATAPAHDPSVQAANFDHSLPYPTHLLSCSLD 478

Query: 189 DTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           +TI+LW        C     GH   VW          ++ R+ SGS D + +VW
Sbjct: 479 NTIKLWN--VKTGACIRTQFGHVEGVW------DIAADNFRIVSGSHDRSCKVW 524

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 8/65 (12%)

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
           LL + SYD T+ +W       +    L+GH   V    F+  K      L +GS D T+R
Sbjct: 271 LLLTGSYDSTVAIWDLATG--KLIRRLSGHTDGVKALRFDDQK------LITGSLDKTIR 322

Query: 241 VWRYI 245
           VW Y+
Sbjct: 323 VWNYV 327

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 100/226 (44%), Gaps = 32/226 (14%)

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182
           ++ G+ WS D   +  C+ D  + I+++   G+E   + +L ++      V  HP    +
Sbjct: 223 KISGLDWSVDSKNIFVCTHDGRIVIYDS---GDE-TTVKILYKNDARFAQVRCHPCNSFI 278

Query: 183 ASSSYDDTIRLWKDYDDDWECAAVLN-GHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
            S+S+D T   W   D   +   ++  GH   V+   F    N  S+   +G D +   +
Sbjct: 279 GSTSFDKT---WILIDTVKQAPILIQEGHSAEVFSLSFH---NDGSLVSTAGLD-AIALI 331

Query: 242 WRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGS-DGTLAVYKEVSNGDD 300
           W    D   G+     +      H + IYSV WS NG   ++GS DGT+ V+     G+ 
Sbjct: 332 W----DIRSGKNIMSLQG-----HSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNV 382

Query: 301 EHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWN 346
           E    ++A   +         VK+   NG  ++++G D   VN++N
Sbjct: 383 E---TILAHNSIVSQ------VKFNKQNGGYLVSSGYDKK-VNIFN 418

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 83/203 (40%), Gaps = 34/203 (16%)

Query: 46  GQVSLMDVLDDT----VHKKAIRCVAWR--PHSNLLAAGSFDSTVSIWTRXXXXXXXXXX 99
           G++ + D  D+T    ++K   R    R  P ++ + + SFD T   W            
Sbjct: 243 GRIVIYDSGDETTVKILYKNDARFAQVRCHPCNSFIGSTSFDKT---WI----------- 288

Query: 100 XXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYEC 159
                  ++++   + I EGH  EV  +++ +DG+L+S+   D    IW    D    + 
Sbjct: 289 -----LIDTVKQAPILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIW----DIRSGKN 339

Query: 160 ISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDF 219
           I  LQ HS+ +  V W      LAS S D TI++W D         +L  H   V    F
Sbjct: 340 IMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVW-DIRKKGNVETIL-AHNSIVSQVKF 397

Query: 220 EKGKNGESIRLCSGSDDSTVRVW 242
            K   G    L S   D  V ++
Sbjct: 398 NKQNGG---YLVSSGYDKKVNIF 417

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 7/104 (6%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           ++GH   +  + WS +G  L+S S D ++ +W+  + G     +  +  H+  V  V ++
Sbjct: 343 LQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGN----VETILAHNSIVSQVKFN 398

Query: 177 PEL-PLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDF 219
            +    L SS YD  + ++   D +W     L GH   V   D 
Sbjct: 399 KQNGGYLVSSGYDKKVNIFN--DGNWIKERSLEGHLDKVMSIDI 440

>Scas_605.18
          Length = 424

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 104/248 (41%), Gaps = 34/248 (13%)

Query: 107 NSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEH 166
           N + +     ++GH N++    WS D   + S S+D  + IW+T   G +   I +    
Sbjct: 77  NKINLQSTLTLKGHNNKISDFRWSRDSKSILSASQDGFMLIWDT-ASGLKRNAIPL---D 132

Query: 167 SQDVKHVVWHPELPLLASSSYDDT---IRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGK 223
           SQ V      P   L AS+  ++     R+ K+        ++  GH  T + SD E   
Sbjct: 133 SQWVLSCALSPSGNLAASAGLNNNCTIYRVSKENRVQQNVVSIFKGH--TCYISDIEFLD 190

Query: 224 NGESIRLCSGSDDSTVRVW-----RYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG 278
           N   I   + S D T  +W     + + +  D   + +  A+ P   D        +   
Sbjct: 191 NSHII---TSSGDMTCALWDIPKAKRVREYADHLGDVLALALPPPSADEN------TGAN 241

Query: 279 LIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGD 338
           + AS GSDG   ++   ++          A Q+      + N +++   +GN ++ TGGD
Sbjct: 242 IFASCGSDGYTYIWDTRTSA---------AVQKFFASDTDVNAIQFFK-DGNSIV-TGGD 290

Query: 339 DGCVNLWN 346
           DG +N+++
Sbjct: 291 DGVINMFD 298

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 124 VKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLA 183
           V  + +S+ G L+ +C  D    IW    D  + E +  L+ HS  V  V   P+   + 
Sbjct: 353 VVSLDFSNSGRLMFACYTDLGCIIW----DVLKAEIVGKLEGHSNRVSSVRTSPDGLGVC 408

Query: 184 SSSYDDTIRLW 194
           + S+D T+R+W
Sbjct: 409 TGSWDSTMRIW 419

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 76/169 (44%), Gaps = 34/169 (20%)

Query: 74  LLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDG 133
           LL  GS+DSTV+IW                   ++   +L+  + GH + VKGI +  D 
Sbjct: 324 LLFTGSYDSTVAIW-------------------DTKSGNLIRRLTGHTDGVKGIYF--DD 362

Query: 134 ALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRL 193
             + + S DK++ +W          CIS  + H   V  V  + ++  + S+S D T+++
Sbjct: 363 QKMITASLDKTIRVWNYITGS----CISTYRGHQDSVLSVDSYKKI--IVSASADKTVKV 416

Query: 194 WKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           W  + +   C   L GH   V C       + +S    S SDD T+R+W
Sbjct: 417 W--HVESRTCYT-LRGHTEWVNCVKL----HPKSFTCYSSSDDKTLRMW 458

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 86/206 (41%), Gaps = 37/206 (17%)

Query: 9   LKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAW 68
            K   D + SL ++H LL TGS D  + I +  +      +L+  L  T H   ++ + +
Sbjct: 308 FKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSG-----NLIRRL--TGHTDGVKGIYF 360

Query: 69  RPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIA 128
                + A  S D T+ +W                   N +    ++   GH++ V  ++
Sbjct: 361 DDQKMITA--SLDKTIRVW-------------------NYITGSCISTYRGHQDSV--LS 397

Query: 129 WSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYD 188
                 ++ S S DK+V +W      E   C + L+ H++ V  V  HP+     SSS D
Sbjct: 398 VDSYKKIIVSASADKTVKVWHV----ESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSSDD 452

Query: 189 DTIRLWKDYDDDWECAAVLNGHEGTV 214
            T+R+W    +   C  V  GH G V
Sbjct: 453 KTLRMWDIRTN--SCIKVFRGHVGQV 476

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 90/231 (38%), Gaps = 47/231 (20%)

Query: 14  DKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSN 73
           D + S+D    ++ + S D+ +K+ +V +  R   +L        H + + CV   P S 
Sbjct: 393 DSVLSVDSYKKIIVSASADKTVKVWHVES--RTCYTLRG------HTEWVNCVKLHPKSF 444

Query: 74  LLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIA--WSH 131
              + S D T+ +W                  TNS     + +  GH  +V+ +      
Sbjct: 445 TCYSSSDDKTLRMW---------------DIRTNSC----IKVFRGHVGQVQKVIPLTIK 485

Query: 132 DGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTI 191
           D   L    + + V   E ++D  + +C  +   + +   H         L S S D+TI
Sbjct: 486 DTENLVVDEKIEKVPNPELEEDFAD-DCTGIFDPNLKYPTH---------LLSCSLDNTI 535

Query: 192 RLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           +LW+       C     GH   VW          ++ R+ SGS D +++VW
Sbjct: 536 KLWEV--SSGRCIRTQFGHVEGVW------DIAADNFRIVSGSHDKSIKVW 578

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 8/65 (12%)

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
           LL + SYD T+ +W     +      L GH      +D  KG   +  ++ + S D T+R
Sbjct: 324 LLFTGSYDSTVAIWDTKSGNL--IRRLTGH------TDGVKGIYFDDQKMITASLDKTIR 375

Query: 241 VWRYI 245
           VW YI
Sbjct: 376 VWNYI 380

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 89/223 (39%), Gaps = 34/223 (15%)

Query: 25  LLATGSTDRKIK--IINVTNAPRGQVSLMDVLDDT--VHKKAIRCVAWRPHSNLLAAGSF 80
            L T S D  IK  II    A    V ++ V + T   H+K I  ++  P+ ++ A  S+
Sbjct: 453 FLLTASNDLTIKKWIIPKPTASM-DVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASY 511

Query: 81  DSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCS 140
           D T  IW                   N    +L A +  H+  +  +++     LL++ S
Sbjct: 512 DKTCKIW-------------------NLENGELEATLANHKRGLWDVSFCQYDKLLATSS 552

Query: 141 RDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDD 200
            DK+V IW  D     +  +  L+ H+  V+   +  +   L S   D  I++W      
Sbjct: 553 GDKTVKIWSLDT----FSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWD--CSS 606

Query: 201 WECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWR 243
            EC   L+GH   +W        +G+ I   S   D   + W+
Sbjct: 607 GECLKTLDGHNNRLWA--LSTMNDGDMI--VSADADGVFQFWK 645

 Score = 35.8 bits (81), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 107/253 (42%), Gaps = 39/253 (15%)

Query: 108 SLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHS 167
           SL +D+  I EGHE+ +  +  + DG  +++ S+D +  +W  +++  +++  +    HS
Sbjct: 376 SLPLDV-EIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHS 434

Query: 168 QDVKHVVW-------HPELPLLASSSYDDTIRLWKDYDDDWEC-AAVLNGHEGTVWCSDF 219
             V  V         +PE  L AS+  D TI+ W            ++   E T      
Sbjct: 435 AAVTAVGLPNIVSKGYPEFLLTASN--DLTIKKWIIPKPTASMDVQIIKVSEYTRHA--H 490

Query: 220 EKGKNGESIR-----LCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSW 274
           EK  N  S+        + S D T ++W      E+G+     EA L   H R ++ VS+
Sbjct: 491 EKDINALSVSPNDSIFATASYDKTCKIWNL----ENGE----LEATLAN-HKRGLWDVSF 541

Query: 275 -STNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMML 333
              + L+A++  D T+ ++            +  +  +   G   A + +   IN    L
Sbjct: 542 CQYDKLLATSSGDKTVKIWS----------LDTFSVMKTLEGHTNA-VQRCSFINKQKQL 590

Query: 334 ATGGDDGCVNLWN 346
            + G DG + +W+
Sbjct: 591 ISCGADGLIKIWD 603

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 74/169 (43%), Gaps = 34/169 (20%)

Query: 74  LLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDG 133
           LL  GS+D+TV+IW                   +     L+  + GH + VK + +  D 
Sbjct: 346 LLFTGSYDTTVAIW-------------------DLFTGKLIRRLTGHSDGVKTLYF--DD 384

Query: 134 ALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRL 193
             L + S DK++ +W         ECIS  + H+  V  V  H ++  + S S D T+++
Sbjct: 385 QKLITGSLDKTIRVWNYITG----ECISTYRGHTDSVMSVDSHKKI--IVSGSADKTVKV 438

Query: 194 WKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           W  + +   C   L GH   V C         +S    S SDD+T+R+W
Sbjct: 439 W--HVESRTCYT-LKGHTEWVNCVKLHP----KSFSCYSCSDDTTIRMW 480

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 88/213 (41%), Gaps = 37/213 (17%)

Query: 2   GIKLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKK 61
           G+   +  K   D + +L +++ LL TGS D  + I ++         L+  L  T H  
Sbjct: 323 GLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTG-----KLIRRL--TGHSD 375

Query: 62  AIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHE 121
            ++ + +      L  GS D T+ +W                   N +  + ++   GH 
Sbjct: 376 GVKTLYFDDQK--LITGSLDKTIRVW-------------------NYITGECISTYRGHT 414

Query: 122 NEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPL 181
           + V  +  SH   ++S  S DK+V +W      E   C + L+ H++ V  V  HP+   
Sbjct: 415 DSVMSVD-SHKKIIVSG-SADKTVKVWHV----ESRTCYT-LKGHTEWVNCVKLHPKSFS 467

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTV 214
             S S D TIR+W    +   C  V  GH G V
Sbjct: 468 CYSCSDDTTIRMWDIRTN--TCLRVFRGHVGQV 498

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 68/152 (44%), Gaps = 22/152 (14%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
            +GH + V  + +++   LL + S D +V IW    D    + I  L  HS  VK + + 
Sbjct: 330 FKGHMDGVLTLQFNY--RLLFTGSYDTTVAIW----DLFTGKLIRRLTGHSDGVKTLYFD 383

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDD 236
            +   L + S D TIR+W       EC +   GH  +V   D  K        + SGS D
Sbjct: 384 DQK--LITGSLDKTIRVWNYITG--ECISTYRGHTDSVMSVDSHKKI------IVSGSAD 433

Query: 237 STVRVWRYIDDDE----DGQQEWI-CEAILPK 263
            TV+VW +++        G  EW+ C  + PK
Sbjct: 434 KTVKVW-HVESRTCYTLKGHTEWVNCVKLHPK 464

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 59/284 (20%), Positives = 96/284 (33%), Gaps = 86/284 (30%)

Query: 4   KLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAI 63
           KL + L   +D + +L +    L TGS D+ I++ N        +S      D+V     
Sbjct: 365 KLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGE--CISTYRGHTDSV----- 417

Query: 64  RCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENE 123
             ++   H  ++ +GS D TV +W                     +E      ++GH   
Sbjct: 418 --MSVDSHKKIIVSGSADKTVKVW--------------------HVESRTCYTLKGHTEW 455

Query: 124 VKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV---------- 173
           V  +          SCS D ++ +W    D     C+ V + H   V+ V          
Sbjct: 456 VNCVKLHPKSFSCYSCSDDTTIRMW----DIRTNTCLRVFRGHVGQVQKVIPLTIIDAQN 511

Query: 174 -VWHPELP----------------------------------LLASSSYDDTIRLWKDYD 198
            V H   P                                   L S + D+TI+LW+   
Sbjct: 512 LVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRS 571

Query: 199 DDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
               C     GH   VW  D       ++ R+ SGS D ++++W
Sbjct: 572 G--RCIRTQFGHVEGVW--DIA----ADNFRIISGSHDGSIKIW 607

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 96/231 (41%), Gaps = 36/231 (15%)

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH   V   ++S D   L S S DK+V +W  D     +  +   + H+  V  V + P 
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDT----HTALVSYKGHNHPVWDVSFSPL 578

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
               A++S+D T RLW    D      +  GH   V C  F    NG    + +GS D T
Sbjct: 579 GHYFATASHDQTARLWS--CDHIYPLRIFAGHLNDVDCVSFH--PNG--CYVFTGSSDKT 632

Query: 239 VRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGS-DGTLAVYKEVSN 297
            R+W    D   G    +        H   + S++   +G   STGS DG + V+ ++  
Sbjct: 633 CRMW----DVSTGDSVRLFLG-----HTAPVISIAVCPDGRWLSTGSEDGIINVW-DIGT 682

Query: 298 GDDEHDWEVIAKQELCHG---VYEANIVKWIDINGNMMLATGGDDGCVNLW 345
           G          KQ   HG   +Y  +  K     GN+++ +GG D  V +W
Sbjct: 683 GKR-------LKQMRGHGKNAIYSLSYSK----EGNVLI-SGGADHTVRVW 721

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 97/245 (39%), Gaps = 60/245 (24%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDL---LA 115
           H   +   ++ P +  L +GS D TV +W+                      MD    L 
Sbjct: 524 HSGTVYSTSFSPDNKYLLSGSEDKTVRLWS----------------------MDTHTALV 561

Query: 116 IIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW 175
             +GH + V  +++S  G   ++ S D++  +W  D        + +   H  DV  V +
Sbjct: 562 SYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDH----IYPLRIFAGHLNDVDCVSF 617

Query: 176 HPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLC---- 231
           HP    + + S D T R+W     D     +  GH   V            SI +C    
Sbjct: 618 HPNGCYVFTGSSDKTCRMWDVSTGD--SVRLFLGHTAPVI-----------SIAVCPDGR 664

Query: 232 ---SGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQ-IYSVSWSTNG-LIASTGSD 286
              +GS+D  + VW      + G  + + +    + H +  IYS+S+S  G ++ S G+D
Sbjct: 665 WLSTGSEDGIINVW------DIGTGKRLKQM---RGHGKNAIYSLSYSKEGNVLISGGAD 715

Query: 287 GTLAV 291
            T+ V
Sbjct: 716 HTVRV 720

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 82/239 (34%), Gaps = 56/239 (23%)

Query: 129 WSHDGALLSSCSRDKSVWIWETD-------------QDGEEYECISVLQEHSQDVKHVVW 175
           +S D  + ++  +D  + IW  D              D +E      L  HS  V    +
Sbjct: 474 FSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSF 533

Query: 176 HPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSD 235
            P+   L S S D T+RLW    D         GH   VW   F    +       + S 
Sbjct: 534 SPDNKYLLSGSEDKTVRLWS--MDTHTALVSYKGHNHPVWDVSFSPLGH----YFATASH 587

Query: 236 DSTVRVWRYIDDDEDGQQEWICEAILP----KVHDRQIYSVSWSTNGLIASTGSDGTLAV 291
           D T R+W              C+ I P      H   +  VS+  NG    TGS      
Sbjct: 588 DQTARLWS-------------CDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCR 634

Query: 292 YKEVSNGDD-----EHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLW 345
             +VS GD       H   VI+      G       +W        L+TG +DG +N+W
Sbjct: 635 MWDVSTGDSVRLFLGHTAPVISIAVCPDG-------RW--------LSTGSEDGIINVW 678

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 105/248 (42%), Gaps = 38/248 (15%)

Query: 108 SLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHS 167
           S+ +  +  ++GH N+V    WS D   + S S+D  + +W+    G +   I +   HS
Sbjct: 114 SVNLKPVTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDA-ATGLKSNAIPL---HS 169

Query: 168 QDVKHVVWHPELPLLASSSYDDTIRLWKDYDDD---WECAAVLNGHEGTVWCSDFEKGKN 224
           Q V      P   L+AS+  D+   +++    D       ++  GH  T + S+ E   +
Sbjct: 170 QWVLSCAICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGH--TCYISEIEFLDD 227

Query: 225 GESIRLCSGSDDSTVRVW-----RYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGL 279
                + + S D T  +W     + I++  D   + +  +  P        + +     +
Sbjct: 228 NS---ILTASGDMTCALWDITKSKRINEFADHLGDVLSLSAAP--------TETEGNGNV 276

Query: 280 IASTGSDGTLAVY-KEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGD 338
            AS GSDG L ++ K V            + Q       + + VK+   NGN  +ATG D
Sbjct: 277 FASGGSDGYLYIWDKRVPT----------SVQSFFVSDSDVSKVKFFR-NGN-TIATGSD 324

Query: 339 DGCVNLWN 346
           DGC NL++
Sbjct: 325 DGCTNLYD 332

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 76/189 (40%), Gaps = 40/189 (21%)

Query: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHEN 122
           IR V + P    LA G+ D  + IW                   +  +  ++ ++ GHE 
Sbjct: 376 IRSVCFSPDGKFLATGAEDKLIRIW-------------------DIAQRKIVMVLRGHEQ 416

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182
           ++  + +   G  L S S D+++ IW    D    +C   L          V       +
Sbjct: 417 DIYSLDYFQSGNKLVSGSGDRTIRIW----DLHTGQCSLTLSIEDGVTTVAVSPGNGNYV 472

Query: 183 ASSSYDDTIRLW--------KDYDDDWECAAVLNGHEGTVWCSDFEK-GKNGESIRLCSG 233
           A+ S D T+R+W        +  D + E      GH+ +V+   F + GKN     + SG
Sbjct: 473 AAGSLDRTVRVWDSNSGFLVERLDSEGETGV---GHKDSVYSVVFTRDGKN-----IVSG 524

Query: 234 SDDSTVRVW 242
           S D +V++W
Sbjct: 525 SLDRSVKLW 533

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 57/261 (21%), Positives = 93/261 (35%), Gaps = 50/261 (19%)

Query: 25  LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTV 84
            LATG+ D+ I+I ++      Q  ++ VL    H++ I  + +    N L +GS D T+
Sbjct: 387 FLATGAEDKLIRIWDI-----AQRKIVMVLRG--HEQDIYSLDYFQSGNKLVSGSGDRTI 439

Query: 85  SIWTRXXXXXXXXXXXXXXXTT-------------NSLEMDLLA-------IIE------ 118
            IW                 TT              SL+  +         ++E      
Sbjct: 440 RIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEG 499

Query: 119 ----GHENEVKGIAWSHDGALLSSCSRDKSVWIWE---------TDQDGEEYECISVLQE 165
               GH++ V  + ++ DG  + S S D+SV +W          + Q   E  C      
Sbjct: 500 ETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIG 559

Query: 166 HSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKN- 224
           H   V  V        + S S D  +  W           +L GH  +V       GK  
Sbjct: 560 HKDFVLSVTTTENDQYILSGSKDRGVIFWDKV--SGVPLLMLQGHRNSVISVAVANGKPL 617

Query: 225 GESIR-LCSGSDDSTVRVWRY 244
           G +     +GS D   ++W++
Sbjct: 618 GANYNVFATGSGDCKAKIWKF 638

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 110/276 (39%), Gaps = 35/276 (12%)

Query: 74  LLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDG 133
           L AAG  DS + IW+                   S + +  + + GH   V   ++S D 
Sbjct: 487 LAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQD-NTCSTLVGHSGTVYSTSFSPDN 545

Query: 134 ALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRL 193
             L S S DK+V +W  D     +  +   + H+  V  V + P     AS+S+D T RL
Sbjct: 546 MYLVSGSEDKTVKLWSMDT----HTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARL 601

Query: 194 WKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQ 253
           W    D      +  GH   V    F    NG    + +GS D T R+W    D   G  
Sbjct: 602 WA--CDHIYPLRIFAGHTNDVDTVSFH--PNG--CYVFTGSSDKTCRMW----DVSTGDS 651

Query: 254 EWICEAILPKVHDRQIYSVSWSTNGLIASTGS-DGTLAVYKEVSNGDDEHDWEVIAKQEL 312
             +        H   + S   S +G   +TGS DG + ++ ++  G          KQ  
Sbjct: 652 VRLFLG-----HTAPVLSTQVSPDGRWLATGSEDGVICLW-DIGTGKR-------IKQMR 698

Query: 313 CHGVYEANIVKWIDIN--GNMMLATGGDDGCVNLWN 346
            HG    N V  +  N  GN+++ +GG D  V +W+
Sbjct: 699 GHG---KNAVHSLSFNKEGNVLI-SGGADHSVRVWD 730

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 79/198 (39%), Gaps = 42/198 (21%)

Query: 13  NDKLWSLDYSH--GLLATGSTDRKIKIINVTNA----PRGQVSLMDVL--DDTV-----H 59
           N  + SL++S    L A G  D  IKI ++  +    P+   S  D    D+T      H
Sbjct: 473 NRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGH 532

Query: 60  KKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDL---LAI 116
              +   ++ P +  L +GS D TV +W+                      MD    L  
Sbjct: 533 SGTVYSTSFSPDNMYLVSGSEDKTVKLWS----------------------MDTHTALVN 570

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
            +GH + V  + +S  G   +S S D++  +W  D        + +   H+ DV  V +H
Sbjct: 571 YKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDH----IYPLRIFAGHTNDVDTVSFH 626

Query: 177 PELPLLASSSYDDTIRLW 194
           P    + + S D T R+W
Sbjct: 627 PNGCYVFTGSSDKTCRMW 644

>Kwal_23.6240
          Length = 913

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 62/167 (37%), Gaps = 50/167 (29%)

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           +GH +    + +S DG+ + + S D  + IW    D     C+   QEH+  V  + +  
Sbjct: 338 QGHFDATNAVTYSPDGSRVVTASEDGKIKIW----DVVSGFCLVTFQEHTAAVSALAFAK 393

Query: 178 ELPLLASSSYDDTIRLW-----------------------KDYDDDWECAA--------- 205
              +L S+S D T+R W                        D   +  CA          
Sbjct: 394 RGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHV 453

Query: 206 ----------VLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
                      L+GHEG V C  F +    E+  L S S D T+R+W
Sbjct: 454 WSVQTGQLVETLDGHEGPVSCLSFSQ----ENSVLASASWDKTIRIW 496

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 68/170 (40%), Gaps = 41/170 (24%)

Query: 43  APRGQVSLMDVLDDTVH-----------------KKAIRCVAWRPHSNLLAAGSFDS-TV 84
           A RGQV     LD TV                  +    C+A  P   ++ AGS DS  V
Sbjct: 392 AKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAV 451

Query: 85  SIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKS 144
            +W+                        L+  ++GHE  V  +++S + ++L+S S DK+
Sbjct: 452 HVWSVQTG-------------------QLVETLDGHEGPVSCLSFSQENSVLASASWDKT 492

Query: 145 VWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
           + IW      ++ E + V      DV  +   P+   +A+++ D  I  +
Sbjct: 493 IRIWSIFGRSQQVEPLEVY----ADVLSLSVRPDGNEVAAATLDGQILFF 538

 Score = 35.4 bits (80), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 82/216 (37%), Gaps = 40/216 (18%)

Query: 43  APRG-QVSLMDVLDDTV------HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXX 95
           +P G +VS+ D++ +        H+K ++CVA  P   LL +   D    +         
Sbjct: 31  SPVGNRVSVFDLIHNKSYTFEYEHRKNVQCVALNPQGTLLLSVDEDGRAIL--------- 81

Query: 96  XXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLS-SCSRDKSVWIWETDQDG 154
                      N     +L      E  V  + +S DG + + +C R   V +W+T    
Sbjct: 82  ----------VNFRAKTVLHHFNFKE-PVSDLKFSPDGKVFAIACGR--FVQVWKTPDVA 128

Query: 155 EEYECISVLQE-----HSQDVKHVVWHPELPLLASSSYDDTIRLWK-DYDDDWECAAVLN 208
           E+ +    ++      H  ++  + W  +   L S+S D T R+W  D  +    +    
Sbjct: 129 EDRQFAPFVRHRVHAGHFSNIISLTWSRDSRFLISTSKDLTARIWSLDSQEKGLASVTFA 188

Query: 209 GHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRY 244
           GH   V  + F   +     R+ + S D  V  W Y
Sbjct: 189 GHRDYVMGAFFSADQE----RIYTVSKDGAVFQWEY 220

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 60/122 (49%), Gaps = 7/122 (5%)

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQ--DGEEYECISVLQEHSQDVKHVVWHPELP 180
            ++ ++ + DG++L + +   + ++WE     D    +  +  + H   +  V+   ++ 
Sbjct: 161 PLQSLSVASDGSMLVAANNKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVK 220

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
            +A+ S D T R+W   +D++   + L+GH+  VW   F    + +S  L + S D  VR
Sbjct: 221 HMATCSADHTARIWS-VEDNFNLESTLDGHQRWVWDCAF----SADSAYLVTASSDHYVR 275

Query: 241 VW 242
           +W
Sbjct: 276 LW 277

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 8/90 (8%)

Query: 105 TTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQ 164
           T+NS   + +A  EGH   V  +++  D   + + S D ++ +W+          +    
Sbjct: 62  TSNS---NPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDI-----RSPSVPRNY 113

Query: 165 EHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
           +H+  V  VV HP    L S   D  IR+W
Sbjct: 114 KHNAPVNEVVIHPNQGELISCDRDGNIRIW 143

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 3/78 (3%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
            + H + +  +  S D   +++CS D +  IW  +   + +   S L  H + V    + 
Sbjct: 203 FKAHPSYITRVLLSSDVKHMATCSADHTARIWSVE---DNFNLESTLDGHQRWVWDCAFS 259

Query: 177 PELPLLASSSYDDTIRLW 194
            +   L ++S D  +RLW
Sbjct: 260 ADSAYLVTASSDHYVRLW 277

>Kwal_23.5769
          Length = 627

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 75/170 (44%), Gaps = 34/170 (20%)

Query: 73  NLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHD 132
            LL  GS+DSTV+IW                   +     L+  + GH + VK I +  D
Sbjct: 328 RLLFTGSYDSTVAIW-------------------DLATGKLVRRLTGHRDGVKAIYF--D 366

Query: 133 GALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIR 192
           G  L + S D+ + +W          C++    HS  V  V  + +  ++ S S D T++
Sbjct: 367 GQKLITGSLDRMIRVWNYVTGA----CVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVK 420

Query: 193 LWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           +W  + +   C   L GH  T W    +   + +S    SGSDD+T+R+W
Sbjct: 421 VW--HVESRTC-YTLRGH--TEWVGTVK--LHPKSFTCFSGSDDTTIRMW 463

 Score = 32.0 bits (71), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 63/290 (21%), Positives = 96/290 (33%), Gaps = 104/290 (35%)

Query: 4   KLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIIN-VTNAPRGQVSLMDVLDDTVHKKA 62
           KL + L    D + ++ +    L TGS DR I++ N VT A                   
Sbjct: 348 KLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGA------------------- 388

Query: 63  IRCVAWRP-----------HSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEM 111
             CVA  P           +  ++ +GS D TV +W                     +E 
Sbjct: 389 --CVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVW--------------------HVES 426

Query: 112 DLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVK 171
                + GH   V  +          S S D ++ +W    D     C+ V + H   V+
Sbjct: 427 RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW----DIRSNTCVKVFRGHVGQVQ 482

Query: 172 HVVW---------------------------HPE---------LPL---LASSSYDDTIR 192
            V+                             P+         LP    L S S D+TI+
Sbjct: 483 KVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIK 542

Query: 193 LWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           LW+      +C     GH   +W  D       ++ R+ SG+ D TV+VW
Sbjct: 543 LWEVRTG--KCVRTHFGHVEGIW--DIA----ADNFRIVSGAHDKTVKVW 584

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 45/111 (40%), Gaps = 18/111 (16%)

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
           LL + SYD T+ +W       +    L GH   V    F+  K      L +GS D  +R
Sbjct: 329 LLFTGSYDSTVAIWDLATG--KLVRRLTGHRDGVKAIYFDGQK------LITGSLDRMIR 380

Query: 241 VWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAV 291
           VW Y+           C A  P  H   + SV  S   +I S  +D T+ V
Sbjct: 381 VWNYVTG--------ACVAAYPG-HSDSVLSVD-SYKKIIVSGSADKTVKV 421

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 112 DLLAIIEGHENEVKGIAW-SHDGALLSSCSRDKSVWIWE----------TDQDG--EEYE 158
           D + +  GH  +V    +   D  +L S S D  + +WE           D+DG  E   
Sbjct: 72  DQIPLFRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVA 131

Query: 159 CISVLQEHSQDVKHVVWHPELP-LLASSSYDDTIRLW 194
            +  L  H + V HV++HP    +LASSS D T+RLW
Sbjct: 132 PVKFLTGHQRKVGHVLYHPTAQGVLASSSLDHTVRLW 168

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 82/199 (41%), Gaps = 33/199 (16%)

Query: 57  TVHKKAIRCVAWRPHSN-LLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLA 115
           T H++ +  V + P +  +LA+ S D TV +W                    ++E     
Sbjct: 137 TGHQRKVGHVLYHPTAQGVLASSSLDHTVRLW--------------------NVEQGTNP 176

Query: 116 IIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHS-QDVKHVV 174
           I+  H + V  +++S+ G  L++  RDK + +W    D  + E +S    HS    + VV
Sbjct: 177 IVLTHPDMVTSMSFSYGGTYLATVCRDKMLRVW----DIRKGEVVSEGMGHSGPKNQRVV 232

Query: 175 WHPELPLLASSSY----DDTIRLWKDYD-DDWECAAVLNGHEGTVWCSDFEKGKNGESIR 229
           W      LA++ +    D  I +W  ++ +  +     N  + +     F    N   I 
Sbjct: 233 WLGNSDRLATTGFSKLSDRQIAVWDAFNLEKGQLGGFYNVDQSSGILMPFYDDSN--KIL 290

Query: 230 LCSGSDDSTVRVWRYIDDD 248
             +G  D  +R + + DD+
Sbjct: 291 YVAGKGDGNIRYYEFQDDE 309

 Score = 32.7 bits (73), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 41/94 (43%), Gaps = 12/94 (12%)

Query: 205 AVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWR-------YIDDDEDGQQEWIC 257
            +  GH   V  +DF+     +   L SGSDD  + VW        +   DEDG  E + 
Sbjct: 75  PLFRGHTAQVLDTDFDPF---DERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVA 131

Query: 258 EAILPKVHDRQIYSVSW--STNGLIASTGSDGTL 289
                  H R++  V +  +  G++AS+  D T+
Sbjct: 132 PVKFLTGHQRKVGHVLYHPTAQGVLASSSLDHTV 165

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 63/124 (50%), Gaps = 7/124 (5%)

Query: 121 ENEVKGIAWSHDGALLSSCSRDKSVWIWETDQ--DGEEYECISVLQEHSQDVKHVVWHPE 178
           +  ++ ++ + DG++L + +   + ++W+     D    + ++  + H++ +  V+   +
Sbjct: 159 DTPLQSLSIASDGSMLVAGNNKGNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSD 218

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
           +  LA+ S D T R+W   +D+++    L+GH+  VW   F    + +S  L +   D  
Sbjct: 219 VKHLATCSADHTARVWS-IEDNFKLETTLDGHQRWVWDCAF----SADSAYLVTACSDHY 273

Query: 239 VRVW 242
           VR+W
Sbjct: 274 VRLW 277

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 32/78 (41%), Gaps = 5/78 (6%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
            EGH   V  I++  D   + S S D ++ +W+      +        +H   V  VV H
Sbjct: 71  FEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRN-----YKHHAPVNEVVIH 125

Query: 177 PELPLLASSSYDDTIRLW 194
           P    L S   D  IR+W
Sbjct: 126 PNQGELISCDQDGNIRIW 143

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 67/159 (42%), Gaps = 11/159 (6%)

Query: 113 LLAIIEGHENEVKGIAWSHDGA-LLSSCSRDKSVWIWETDQDGEEYEC-ISVLQEHSQDV 170
           L   +EGH   V  +A S     LL S SRDK++  W+   D +++   +   + HS  V
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIV 68

Query: 171 KHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRL 230
           +            S S+D T+RLW       E      GH+G V     +K    ++  +
Sbjct: 69  QDCTLTENGAYALSGSWDKTLRLWDVATG--ETFQTFVGHKGDVMSVAIDK----KASMI 122

Query: 231 CSGSDDSTVRVWRYIDD---DEDGQQEWICEAILPKVHD 266
            SGS D +++VW    D      G  +W+ +  +    D
Sbjct: 123 ISGSRDKSIKVWSIKGDCLATLIGHNDWVSQVRIANSSD 161

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 75/174 (43%), Gaps = 23/174 (13%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
            +GH + V+    + +GA   S S DK++ +W+    GE ++       H  DV  V   
Sbjct: 61  FKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDV-ATGETFQ---TFVGHKGDVMSVAID 116

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDD 236
            +  ++ S S D +I++W    D   C A L GH    W S          +R+ + SDD
Sbjct: 117 KKASMIISGSRDKSIKVWSIKGD---CLATLIGHND--WVSQ---------VRIANSSDD 162

Query: 237 STVRVWRYIDDDEDGQQEWICEAILPKV---HDRQIYSVSWSTNG--LIASTGS 285
                     +D+  +  W   A +P        ++Y++S+S N   L A+T S
Sbjct: 163 DDKVTVISAGNDKMVKVLWNSAAKVPMYTLSAGDEVYALSFSPNRYWLCAATAS 216

 Score = 32.0 bits (71), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 49/113 (43%), Gaps = 22/113 (19%)

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQD--------------------GEEYE 158
           GH+ +V  +A     +++ S SRDKS+ +W    D                     ++ +
Sbjct: 105 GHKGDVMSVAIDKKASMIISGSRDKSIKVWSIKGDCLATLIGHNDWVSQVRIANSSDDDD 164

Query: 159 CISVLQEHSQDVKHVVWH--PELPLLASSSYDDTIRLWKDYDDDWECAAVLNG 209
            ++V+   +  +  V+W+   ++P+   S+ D+   L    +  W CAA  +G
Sbjct: 165 KVTVISAGNDKMVKVLWNSAAKVPMYTLSAGDEVYALSFSPNRYWLCAATASG 217

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 65/167 (38%), Gaps = 50/167 (29%)

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           +GH +    + +S DG+ + + + D  + +W    D     C++  +EH+  V  V +  
Sbjct: 338 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVW----DVASGFCLATFEEHTSAVTAVQFAK 393

Query: 178 ELPLLASSSYDDTIRLWK--DYDD----------DWECAAV------------------- 206
           +  +L S+S D T+R W    Y +           + C AV                   
Sbjct: 394 KGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGSTDSFDVFV 453

Query: 207 -----------LNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
                      L+GHEG V C  F      E+  L S S D T+R+W
Sbjct: 454 WSVQTGQLLDTLSGHEGPVSCLAFSM----ENAVLASASWDKTIRIW 496

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 70/182 (38%), Gaps = 44/182 (24%)

Query: 15  KLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVH--------------- 59
           K+W  D + G       +    +  V  A +GQV     LD TV                
Sbjct: 366 KVW--DVASGFCLATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTA 423

Query: 60  --KKAIRCVAWRPHSNLLAAGSFDST-VSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAI 116
             +    C+A  P   +++AGS DS  V +W+                        LL  
Sbjct: 424 TERVQFTCLAVEPSGEVVSAGSTDSFDVFVWSVQTG-------------------QLLDT 464

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQE-----HSQDVK 171
           + GHE  V  +A+S + A+L+S S DK++ IW      ++ E + V  +      + D K
Sbjct: 465 LSGHEGPVSCLAFSMENAVLASASWDKTIRIWSIFGRSQQVEPLEVFADILAITITPDGK 524

Query: 172 HV 173
           HV
Sbjct: 525 HV 526

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 52/125 (41%), Gaps = 11/125 (8%)

Query: 127 IAWSHDGALLSSCSRDKSVWIWET-----DQDGEEYECISVLQEHSQDVKHVVWHPELPL 181
           + +S DG   +  +  + + IW+T     D+    +    V   H QD+    W  +   
Sbjct: 102 VKFSPDGRYFA-LAVGRFLQIWKTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSRF 160

Query: 182 LASSSYDDTIRLWKDYDDDWE-CAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
           L ++S D T R+W    +D E  A  L GH   V  + F    N    ++ + S D  V 
Sbjct: 161 LLTTSKDLTSRVWSINSEDKELVATTLAGHRDYVLGAYF----NSTQEKIYTISKDGAVF 216

Query: 241 VWRYI 245
            W YI
Sbjct: 217 TWEYI 221

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 20/38 (52%)

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEE 156
           GH  ++    WSHD   L + S+D +  +W  + + +E
Sbjct: 144 GHFQDITSFTWSHDSRFLLTTSKDLTSRVWSINSEDKE 181

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 76/177 (42%), Gaps = 27/177 (15%)

Query: 117 IEGHENEV-KGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW 175
           + GH   V   +A  +D  L  + S DK++ +W+  +D   Y        H+  V+H+  
Sbjct: 142 LSGHNATVWHALALGYDRFL--TASADKTIKLWDGARDLATYNV------HTDVVRHLAL 193

Query: 176 HPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSD 235
            P+    AS S D ++++   +  D +     +GHE  V+C  +          L S  +
Sbjct: 194 APDGHHFASCSNDGSVKV---HTLDGKTVRTFDGHESFVYCVKYLPDGG-----LVSCGE 245

Query: 236 DSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVY 292
           D TVRVW     D  G    +      ++    ++S+    NG I   GSDG + ++
Sbjct: 246 DKTVRVW-----DMSGHVRQVI-----RLCATSLWSLDVLPNGDIVVGGSDGKILIF 292

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 59/144 (40%), Gaps = 31/144 (21%)

Query: 7   KSLKLQNDKLW-SLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRC 65
           ++L   N  +W +L   +    T S D+ IK+ +            D+    VH   +R 
Sbjct: 140 RALSGHNATVWHALALGYDRFLTASADKTIKLWD---------GARDLATYNVHTDVVRH 190

Query: 66  VAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVK 125
           +A  P  +  A+ S D +V + T                    L+   +   +GHE+ V 
Sbjct: 191 LALAPDGHHFASCSNDGSVKVHT--------------------LDGKTVRTFDGHESFVY 230

Query: 126 GIAWSHDGALLSSCSRDKSVWIWE 149
            + +  DG L+S C  DK+V +W+
Sbjct: 231 CVKYLPDGGLVS-CGEDKTVRVWD 253

 Score = 32.0 bits (71), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 9/61 (14%)

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           L SSS+D T R+W++  ++      L+GH  TVW +    G +    R  + S D T+++
Sbjct: 121 LVSSSWDQTARVWREGTEE----RALSGHNATVWHA-LALGYD----RFLTASADKTIKL 171

Query: 242 W 242
           W
Sbjct: 172 W 172

 Score = 28.9 bits (63), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 157 YECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
           YE  S L  HS DVK VV   +   +AS S D T+R+W
Sbjct: 8   YELSSSLLGHSMDVKSVVAISDTQ-IASGSRDGTVRVW 44

>Scas_719.52
          Length = 628

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 64/145 (44%), Gaps = 21/145 (14%)

Query: 112 DLLAIIEGHENEVKGIAW-SHDGALLSSCSRDKSVWIWET----------DQDGEE--YE 158
           D + +  GH  +V    +   +  +++S S D  + IW+           D DGE    +
Sbjct: 72  DQVPLFRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIK 131

Query: 159 CISVLQEHSQDVKHVVWHPELP-LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCS 217
            +  L  HS+ V HV++HP    +LASSS D T++LW   + +   A +   H   V   
Sbjct: 132 PVKFLSGHSRKVGHVLFHPVAENVLASSSLDYTVKLW---NIETGEAVITLKHPDMVTSM 188

Query: 218 DFEKGKNGESIRLCSGSDDSTVRVW 242
            F  G N     L +   D  +RVW
Sbjct: 189 SFSYGGN----HLATVCRDKKLRVW 209

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 78/198 (39%), Gaps = 35/198 (17%)

Query: 59  HKKAIRCVAWRP-HSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
           H + +  V + P   N+LA+ S D TV +W                    ++E     I 
Sbjct: 139 HSRKVGHVLFHPVAENVLASSSLDYTVKLW--------------------NIETGEAVIT 178

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHS-QDVKHVVWH 176
             H + V  +++S+ G  L++  RDK + +W    D  E + +S    H+    + VVW 
Sbjct: 179 LKHPDMVTSMSFSYGGNHLATVCRDKKLRVW----DIREGKIVSEGPAHAGAKNQRVVWL 234

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG------KNGESIRL 230
                LA++ +    RL       W+   +  G  G  +  D   G       +G  I  
Sbjct: 235 GNSDRLATTGFS---RLSDRQIGIWDAFNLEKGDLGGFYTVDQSSGILMPFYDDGNKILY 291

Query: 231 CSGSDDSTVRVWRYIDDD 248
            +G  D  +R + + +D+
Sbjct: 292 LAGKGDGNIRYYEFQNDE 309

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 78/212 (36%), Gaps = 64/212 (30%)

Query: 107 NSLEMD---LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETD-QDGEEYECISV 162
           N L+ D   + A ++GHE EV  + +     +L S S D  V +W+    + EE ECI  
Sbjct: 41  NPLDADCRGIYATLKGHEAEVTCVKFMPGTDILVSASEDHHVKLWKYKAPESEELECIQT 100

Query: 163 LQEHSQDVKHV-----------------VWHPE-------------------LPLLASSS 186
           +  +S  +  +                 +W PE                    PL  S S
Sbjct: 101 ITHYSHTIVSIETLAGLIVIGSAGGLVSIWVPETEGSDTYIISHEYSLPRNVFPLCFSLS 160

Query: 187 Y-----------DDTIRLW--------KDYDDDWECAAVLNGHEGTVWCSDFEKGKNGES 227
                         T++++            +++  AA L GHE  V    F   +    
Sbjct: 161 NVVGNKYLLAIGGTTVKIFIYSFVLSEGKVIENFNLAAELEGHEDWVKSIQFRHQETPGD 220

Query: 228 IRLCSGSDDSTVRVWR-----YIDDDEDGQQE 254
             LCSGS D  +R+WR      IDD ED + +
Sbjct: 221 YLLCSGSQDRYIRIWRIRTNDLIDDSEDDETK 252

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 63/159 (39%), Gaps = 14/159 (8%)

Query: 191 IRLWKDYDDDWE-CAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDE 249
           I LW   D D     A L GHE  V C  F  G +     L S S+D  V++W+Y   + 
Sbjct: 37  IALWNPLDADCRGIYATLKGHEAEVTCVKFMPGTD----ILVSASEDHHVKLWKYKAPES 92

Query: 250 DGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAK 309
           +       E I    H         +  GLI    + G ++++   + G D +   +I+ 
Sbjct: 93  EE-----LECIQTITHYSHTIVSIETLAGLIVIGSAGGLVSIWVPETEGSDTY---IISH 144

Query: 310 Q-ELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWNW 347
           +  L   V+         +    +LA GG    + ++++
Sbjct: 145 EYSLPRNVFPLCFSLSNVVGNKYLLAIGGTTVKIFIYSF 183

 Score = 32.3 bits (72), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 91/230 (39%), Gaps = 57/230 (24%)

Query: 111 MDLLAIIEGHENEVKGIAWSHDGA----LLSSCSRDKSVWIWET--------DQDGEEYE 158
            +L A +EGHE+ VK I + H       LL S S+D+ + IW           +D E   
Sbjct: 194 FNLAAELEGHEDWVKSIQFRHQETPGDYLLCSGSQDRYIRIWRIRTNDLIDDSEDDETKL 253

Query: 159 CISVLQEH----SQDVK-----------------HVVWHPELPLLASSSYDDTIRLWKDY 197
            +   ++H    S+D++                  + WH     L +S+ D  + +W+  
Sbjct: 254 TLLSSKQHKFHISEDLRIGINFEALIIGHDDWVSSLQWHESKLQLLASTADTAVMIWEPD 313

Query: 198 DDD--WECAAVL-----------NGHEGTVW-CSDFEKGKNGESIRLCSGSDDSTVRVWR 243
           +    W C++ L            G  G  W C  FE  +NG    L +G   S  R+W 
Sbjct: 314 ESSGVWVCSSRLGEMSSKGASTATGSSGGFWSCLWFE--ENGADYILTNGKTGSW-RIWE 370

Query: 244 YIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVY 292
             D+    Q+  I  A+ P      +  V+W+  G  + ST  D T  ++
Sbjct: 371 AKDEIMCEQRVGITGAVRP------VTDVAWAPCGKYLLSTSLDQTTRLF 414

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 78/186 (41%), Gaps = 30/186 (16%)

Query: 58  VHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
            H  A+  + +    + L +G  D T+ IW                        +++ ++
Sbjct: 119 AHDSAVTVMQYSHAGDWLISGDADGTIKIW--------------------QPNFNMVKVL 158

Query: 118 E-GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           +  H   ++ I++S+      +CS D  + IW      +E     VL  H  DVK   WH
Sbjct: 159 DRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQE----RVLSGHHWDVKSCDWH 214

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDD 236
           P++ L+ S S D+ I+LW D       + +L G + TV  + F+  +      L   S D
Sbjct: 215 PKMGLIVSGSKDNLIKLW-DPRTGRNVSTIL-GLKHTVIKTKFQPTQGN---LLAVVSKD 269

Query: 237 STVRVW 242
            +++++
Sbjct: 270 KSIKIY 275

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 49/230 (21%), Positives = 84/230 (36%), Gaps = 38/230 (16%)

Query: 18  SLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAA 77
           S  YS     T S D  +KI N +N  + +V        + H   ++   W P   L+ +
Sbjct: 170 SFSYSDQKFVTCSDDNVLKIWNFSNGQQERVL-------SGHHWDVKSCDWHPKMGLIVS 222

Query: 78  GSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLS 137
           GS D+ + +W                        ++  I+      +K       G LL+
Sbjct: 223 GSKDNLIKLWDPRTGR------------------NVSTILGLKHTVIKTKFQPTQGNLLA 264

Query: 138 SCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP-ELPLLASSSYDDTIR---- 192
             S+DKS+ I++  Q   E + I        D   + WHP    + +   Y+  I+    
Sbjct: 265 VVSKDKSIKIYDMRQHMRELQTI----RDDMDYMSLSWHPINETIFSVGCYNGAIKHFDL 320

Query: 193 LWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           L  + +    C  +   HE +V    +    +     L S + D T+R W
Sbjct: 321 LHDNSNSTPACHTIPYAHEKSVTSLAYSPVGH----ILASAAKDRTIRFW 366

 Score = 35.0 bits (79), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 59/149 (39%), Gaps = 24/149 (16%)

Query: 167 SQDVKHVV----WHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG 222
           S  VKHV+    W PE   L  ++Y     LW     ++E  +++  H+  V    +   
Sbjct: 75  SNKVKHVIPAITWTPEGRRLVVATYSGEFSLWNGSSFNFE--SIMQAHDSAVTVMQYSHA 132

Query: 223 KNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIAS 282
            +     L SG  D T+++W         Q  +    +L + H   +  +S+S +     
Sbjct: 133 GDW----LISGDADGTIKIW---------QPNFNMVKVLDRAHTECMRDISFSYSDQKFV 179

Query: 283 TGSDGTLAVYKEVSNGDDE-----HDWEV 306
           T SD  +      SNG  E     H W+V
Sbjct: 180 TCSDDNVLKIWNFSNGQQERVLSGHHWDV 208

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 20/32 (62%)

Query: 58  VHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTR 89
            H+K++  +A+ P  ++LA+ + D T+  W R
Sbjct: 337 AHEKSVTSLAYSPVGHILASAAKDRTIRFWAR 368

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 74/169 (43%), Gaps = 34/169 (20%)

Query: 74  LLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDG 133
           LL  GS+DST+ IW                   +     L+  + GH + VK + +  D 
Sbjct: 314 LLFTGSYDSTIGIW-------------------DLFTGKLIRRLSGHSDGVKTLYF--DD 352

Query: 134 ALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRL 193
             L + S DK++ +W         ECIS  + HS  V  V  + +  ++ S S D T+++
Sbjct: 353 RKLITGSLDKTIRVWNYITG----ECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKV 406

Query: 194 WKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           W  + +   C   L GH   V C       + +S    S SDD+T+R+W
Sbjct: 407 W--HVESRTCYT-LRGHTEWVNCVKL----HPKSFSCFSCSDDTTIRMW 448

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 93/244 (38%), Gaps = 60/244 (24%)

Query: 12  QNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPH 71
            +D + S+D    ++ +GS D+ +K+ +V +  R   +L        H + + CV   P 
Sbjct: 381 HSDSVLSVDSYQKVIVSGSADKTVKVWHVES--RTCYTLRG------HTEWVNCVKLHPK 432

Query: 72  SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAW-- 129
           S    + S D+T+ +W                  TNS     L +  GH  +V+ I    
Sbjct: 433 SFSCFSCSDDTTIRMW---------------DIRTNSC----LKVFRGHVGQVQKIIPLT 473

Query: 130 -----------SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
                      + DG   SS   D ++     + D    E  +VL E+     H      
Sbjct: 474 IKDVENLATDNTSDG---SSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH------ 524

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
              L S   D+TI+LW       +C     GH   VW          ++ R+ SGS D +
Sbjct: 525 ---LLSCGLDNTIKLWDV--KTGKCIRTQFGHVEGVW------DIAADNFRIISGSHDGS 573

Query: 239 VRVW 242
           ++VW
Sbjct: 574 IKVW 577

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
           LL + SYD TI +W  +    +    L+GH   V    F+  K      L +GS D T+R
Sbjct: 314 LLFTGSYDSTIGIWDLFTG--KLIRRLSGHSDGVKTLYFDDRK------LITGSLDKTIR 365

Query: 241 VWRYI 245
           VW YI
Sbjct: 366 VWNYI 370

>Kwal_27.10385
          Length = 536

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 75/177 (42%), Gaps = 11/177 (6%)

Query: 26  LATGSTDRKIKI--INVTNAPRGQVSLMDVLDD-TVHKKAIRCVAWRPHSNLLAAGSFDS 82
           L T   D KI++  +N       +V  +D L   T H++A+  + +   +++LA    D 
Sbjct: 34  LVTAGGDNKIRVWQLNFEEQNENKVDTIDFLSSLTQHEQAVNVIRFNSRNDVLATAGDDG 93

Query: 83  TVSIWTRXXXXXXXXXXXXXXXTTNSLE----MDLLAIIEGHENEVKGIAWSHDGALLSS 138
            + +W R                           L +      +E+  +AWS D   + +
Sbjct: 94  QLLLWKRNDSISKEFGVDEEEFAEFKESWYVWKRLRSSSTAGSSEIYDLAWSPDDNYIVT 153

Query: 139 CSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK 195
            S D S+ I+E     EE  C++   +H+  V+ VVW P+   + S S D ++ +++
Sbjct: 154 GSMDNSLRIFEV----EEGTCVANAADHNHYVQGVVWDPQNEFIFSQSADRSVHVYR 206

 Score = 28.9 bits (63), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 35/87 (40%), Gaps = 19/87 (21%)

Query: 66  VAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVK 125
           +AW P  N +  GS D+++ I+                      E   +A    H + V+
Sbjct: 142 LAWSPDDNYIVTGSMDNSLRIFEVE-------------------EGTCVANAADHNHYVQ 182

Query: 126 GIAWSHDGALLSSCSRDKSVWIWETDQ 152
           G+ W      + S S D+SV ++  ++
Sbjct: 183 GVVWDPQNEFIFSQSADRSVHVYRIEK 209

>CAGL0F07337g complement(714870..716735) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 621

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 79/181 (43%), Gaps = 20/181 (11%)

Query: 120 HENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP-E 178
           H  EV G+++  DG  L+S   D ++ IW+T     ++    V ++HS  VK + W P  
Sbjct: 376 HTGEVCGLSYKADGLQLASGGNDNTMMIWDTRTSMPQF----VKKDHSAAVKALAWSPTN 431

Query: 179 LPLLAS--SSYDDTIRLWKDYDDDWECAAVLNGHEGTV--WCSDFE-KGKNGESIRLCSG 233
             LLAS     D  I  W +     +   +  G + +   W   ++ KG     I    G
Sbjct: 432 AGLLASGGGQTDQQIHFW-NSTTGAKLHTINTGSQVSSLHWGQSYDTKGNMNVEIVATGG 490

Query: 234 SDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVY 292
           S D+++ ++ Y        +  + E +    HD +I     S +G ++A+ G D  L  Y
Sbjct: 491 SPDNSISIYNY------ETRYKVAEVV--HAHDARICCSKLSPDGTVLATIGGDENLKFY 542

Query: 293 K 293
           K
Sbjct: 543 K 543

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 85/187 (45%), Gaps = 25/187 (13%)

Query: 16  LWSLDYSHG-LLATGSTDRKIKIINV-----TNAPRGQVSLMDVLDDTVHKKAIRCVAWR 69
           +W+L Y+   +L +GSTDR ++I NV     T+  RG  S +  L D V    I+ V   
Sbjct: 410 VWALKYAGDEILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCL-DVVEHGGIKYV--- 465

Query: 70  PHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMD--LLAIIEGHENEVKGI 127
                   GS D+T+ +W +                 NS+E +   + ++ GH   V+ +
Sbjct: 466 ------VTGSRDNTLHVW-KLPDPNSPDYNPNAMRQFNSIEDNPFFVGVLRGHMASVRTV 518

Query: 128 AWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSY 187
             S  G ++ S S D ++ +W    D  + + + VL  H+  +   ++  +     S+S 
Sbjct: 519 --SGHGNIVVSGSYDHNLMVW----DIAKMKLLYVLTGHTDRIYSTLYDHKRKRCISASM 572

Query: 188 DDTIRLW 194
           D T+++W
Sbjct: 573 DTTVKVW 579

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/256 (22%), Positives = 100/256 (39%), Gaps = 53/256 (20%)

Query: 19  LDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAG 78
             +    + TG+ D++I   NV +A R Q  L  V     H+  +  + +     +L +G
Sbjct: 373 FQFEGNYIITGADDKRI---NVYDADREQFKLELV----GHEGGVWALKY-AGDEILVSG 424

Query: 79  SFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGAL--L 136
           S D TV IW                   N        +  GH + V+ +     G +  +
Sbjct: 425 STDRTVRIW-------------------NVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYV 465

Query: 137 SSCSRDKSVWIWE-TDQDGEEYE---------------CISVLQEHSQDVKHVVWHPELP 180
            + SRD ++ +W+  D +  +Y                 + VL+ H   V+ V  H  + 
Sbjct: 466 VTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNPFFVGVLRGHMASVRTVSGHGNI- 524

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
            + S SYD  + +W       +   VL GH   ++ + ++  +     R  S S D+TV+
Sbjct: 525 -VVSGSYDHNLMVWDI--AKMKLLYVLTGHTDRIYSTLYDHKRK----RCISASMDTTVK 577

Query: 241 VWRYIDDDEDGQQEWI 256
           VW   D + +G    I
Sbjct: 578 VWDLSDINNNGPVSQI 593

>Scas_718.6*
          Length = 546

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 49/100 (49%), Gaps = 14/100 (14%)

Query: 199 DDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSD-DSTVRVWRYIDDDEDGQQEWIC 257
           DD +    L GH+GT+ C +F    N  S  L + SD D ++R+W        GQ+E  C
Sbjct: 357 DDNKPIGKLLGHQGTISCIEF----NVNSRLLLTSSDSDYSIRIWH-------GQKENCC 405

Query: 258 EAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSN 297
                  H + I S+SW  + L+ S   DG++ ++  V N
Sbjct: 406 NCFYG--HSQSIISLSWINDDLVISASMDGSVRIWSVVEN 443

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 76/197 (38%), Gaps = 43/197 (21%)

Query: 57  TVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAI 116
           T H +    + W P    +A  S D +V I                      L   LL  
Sbjct: 52  TSHARPFSELCWSPDGQCIATASDDFSVEII--------------------HLSYGLLHT 91

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV-VW 175
             GH   V  + ++  G LL + S D+S+ IW+T  +G   + IS    HS+ V  V V 
Sbjct: 92  FIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDT-LNGSLMKTIS---AHSEAVVSVDVP 147

Query: 176 HPELPLLASSSYDDTIRLWK----------DYDDDWECAAVLNGHEGTVWCSDFEKGKNG 225
             +  +L+S SYD  IR++            YD DW+         G V  S  +  +N 
Sbjct: 148 MNDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWK------RENGVVPISQVKFSENA 201

Query: 226 ESIRLCSGSDDSTVRVW 242
               L   S D  V++W
Sbjct: 202 R--YLLVKSLDGVVKIW 216

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 55/128 (42%), Gaps = 10/128 (7%)

Query: 115 AIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVV 174
            ++  H      + WS DG  +++ S D SV I         Y  +     H+  V  + 
Sbjct: 49  TLVTSHARPFSELCWSPDGQCIATASDDFSVEIIHL-----SYGLLHTFIGHTAPVISLT 103

Query: 175 WHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGS 234
           ++ +  LL +SS D++I++W   +        ++ H   V   D     N  SI L SGS
Sbjct: 104 FNRKGNLLFTSSMDESIKIWDTLNGSL--MKTISAHSEAVVSVDVP--MNDSSI-LSSGS 158

Query: 235 DDSTVRVW 242
            D  +R++
Sbjct: 159 YDGLIRIF 166

>CAGL0L09647g 1032740..1034029 highly similar to sp|P35184
           Saccharomyces cerevisiae YIR012w SQT1, start by
           similarity
          Length = 429

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 9/80 (11%)

Query: 149 ETDQDGEEYECISV---------LQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDD 199
           E  + GE  E I V           +H+  V  V  HP LPL+AS   D+ I LW  +  
Sbjct: 37  EAMEGGEVEETIEVDLSNNSRTYFDKHTDSVFVVAHHPSLPLVASGGADNVIHLWTSHSQ 96

Query: 200 DWECAAVLNGHEGTVWCSDF 219
             + A  L+GH  +V  + F
Sbjct: 97  PPKFAGTLSGHTESVIAAHF 116

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 52/124 (41%), Gaps = 24/124 (19%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H  ++  VA  P   L+A+G  D+ + +W                 T++S        + 
Sbjct: 63  HTDSVFVVAHHPSLPLVASGGADNVIHLW-----------------TSHSQPPKFAGTLS 105

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW--- 175
           GH   V    ++ DG  L S      + +  + + G +++ +S LQE    V+ ++W   
Sbjct: 106 GHTESVIAAHFTPDGKFLVSADMTGKLLVHASVKGGAQWKLVSELQE----VEEIIWLKV 161

Query: 176 HPEL 179
           HP++
Sbjct: 162 HPKV 165

>Kwal_27.11585
          Length = 823

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 90/235 (38%), Gaps = 37/235 (15%)

Query: 25  LLATGSTDRKIKIINVTNAPRGQVSL--MDVLDDT--VHKKAIRCVAWRPHSNLLAAGSF 80
            + T S D  IK  +V       V +  + V D T   H+K I  ++  P+ ++ A  S+
Sbjct: 465 FIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASY 524

Query: 81  DSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCS 140
           D T  IW                   N    +L   +  H+  +  + +     LL++CS
Sbjct: 525 DKTCKIW-------------------NVDSGELEGTLANHKRGLWDVTFCQYDKLLATCS 565

Query: 141 RDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDD 200
            DK++ +W      E    +  L+ H+  V+   +      + S+  D  I++W      
Sbjct: 566 GDKTIKVWSL----ESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWD--LST 619

Query: 201 WECAAVLNGHEGTVWC-SDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQE 254
            EC   L+ H   +W  S    GK        +   D   + W+  D  E+ Q+E
Sbjct: 620 GECIRTLDAHSNRIWALSVLSDGK-----EFVTADADGVFQFWK--DCSEEEQKE 667

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 112/262 (42%), Gaps = 56/262 (21%)

Query: 109 LEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQ 168
           LE++L    EGH + +  +  S +G  L++CS+D +V +W+ + D E+++  +    H+ 
Sbjct: 391 LEVELY---EGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAG 447

Query: 169 DVKHV--------VWHPELPLLASSSYDDTIRLW---KDYDDDWECAAVLNGHEGTVWCS 217
            V  V         W PE  + AS+  D TI+ W   K   +D +           +  S
Sbjct: 448 PVTAVGLPNVMRNTW-PEFIITASN--DLTIKKWSVPKPTSNDVDM--------HNIKVS 496

Query: 218 DF-----EKGKNGESIR-----LCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDR 267
           D+     EK  N  SI        + S D T ++W  +D  E        E  L   H R
Sbjct: 497 DYTRRAHEKDINALSISPNDSVFATASYDKTCKIWN-VDSGE-------LEGTLAN-HKR 547

Query: 268 QIYSVSW-STNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWID 326
            ++ V++   + L+A+   D T+ V+            E ++  +   G   A + +   
Sbjct: 548 GLWDVTFCQYDKLLATCSGDKTIKVWS----------LESMSVVKTLEGHTNA-VQRCSF 596

Query: 327 INGNMMLATGGDDGCVNLWNWT 348
           IN N  + + G DG + +W+ +
Sbjct: 597 INRNKQIVSTGADGLIKVWDLS 618

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 65/167 (38%), Gaps = 50/167 (29%)

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           +GH + + G+ +S DG+ + + S +  + IW    D     C++   EH+  V  V +  
Sbjct: 338 QGHFDTLNGLCYSPDGSKIVTASHEGKIKIW----DVASGFCLATFDEHAGGVSAVEFAK 393

Query: 178 ELPLLASSSYDDTIRLWK-----------------------DYDDDWECAA--------- 205
           +  +L S+S D T++ W                        D   +  CA          
Sbjct: 394 KGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAGSEDSFDIFV 453

Query: 206 ----------VLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
                      L+GHEG + C  F   +NG    L S S D T+RVW
Sbjct: 454 WSVQTGQLVDTLSGHEGPISCLSFSN-ENGV---LASASWDKTIRVW 496

 Score = 35.8 bits (81), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 31/161 (19%), Positives = 57/161 (35%), Gaps = 29/161 (18%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMD------ 112
           H   +  V +     +L + S D TV  W                   NSL +D      
Sbjct: 382 HAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVV 441

Query: 113 -------------------LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQD 153
                              L+  + GHE  +  +++S++  +L+S S DK++ +W     
Sbjct: 442 CAGSEDSFDIFVWSVQTGQLVDTLSGHEGPISCLSFSNENGVLASASWDKTIRVWSLFGR 501

Query: 154 GEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
            ++ E   V      DV  +   P+   +A+S+    I  +
Sbjct: 502 SQQVEPFEVF----SDVLSISMKPDGQQIAASTLAGQILFF 538

 Score = 28.5 bits (62), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 37/92 (40%), Gaps = 18/92 (19%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLA-II 117
           H   I  + W   S  + + S D T  IW                 + NS E +L +   
Sbjct: 145 HFSDITSLTWSKDSRFIISTSKDLTARIW-----------------SVNSEEKNLASTTF 187

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWE 149
            GH + V G  +S D   + + S+D +++ WE
Sbjct: 188 AGHRDNVIGAYFSDDQEKIYTVSKDGALFQWE 219

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 66/145 (45%), Gaps = 9/145 (6%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           + GHE  +  +  S++G LL+SCS D+S+ IW    D    + +S    H+  + ++ + 
Sbjct: 177 LRGHEGSIFYVTTSNNGKLLASCSDDRSIIIW----DMVSGKLLSRAWGHTARIWNLKFF 232

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGH-EGTVWCSDFEKGKNGESIRLCSGSD 235
            +   L S S D T R+W   +D+     +   H    VW  D E+     ++   SG +
Sbjct: 233 NDDTQLISVSEDCTCRVWNYKNDELTIKDIFESHLTKNVWGVDVEE----TNLIAISGGN 288

Query: 236 DSTVRVWRYIDDDEDGQQEWICEAI 260
           D  ++V   +  +     E   E+I
Sbjct: 289 DGRLKVTELVPHNRSCNIELSLESI 313

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 92/206 (44%), Gaps = 34/206 (16%)

Query: 145 VWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECA 204
           + +WE D   +    I  L+ H   + +V       LLAS S D +I +W     D    
Sbjct: 163 IIVWELDSKKK----IHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIW-----DMVSG 213

Query: 205 AVLN---GHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAIL 261
            +L+   GH   +W   F      +  +L S S+D T RVW Y +D      E   + I 
Sbjct: 214 KLLSRAWGHTARIWNLKFF----NDDTQLISVSEDCTCRVWNYKND------ELTIKDIF 263

Query: 262 PKVHDRQIYSVSWSTNGLIA-STGSDGTLAVYKEVSNG---DDEHDWEVIAKQELCHG-V 316
                + ++ V      LIA S G+DG L V + V +    + E   E I++Q  C G +
Sbjct: 264 ESHLTKNVWGVDVEETNLIAISGGNDGRLKVTELVPHNRSCNIELSLESISEQ--CDGFI 321

Query: 317 YEAN-IVK---WIDINGNMMLATGGD 338
           ++AN IVK   W D  G +++ + G+
Sbjct: 322 HKANEIVKGFHWFDF-GLVLITSEGN 346

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 46/96 (47%), Gaps = 13/96 (13%)

Query: 112 DLLAIIEGHENEVKGIAW-SHDGALLSSCSRDKSVWIWETDQD--------GEEY---EC 159
           D + +  GH  +V    +   D   ++S S D  + IW+  QD         EE    E 
Sbjct: 72  DQVPLFRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEP 131

Query: 160 ISVLQEHSQDVKHVVWHPELP-LLASSSYDDTIRLW 194
              L  HS+ V H+++HP    +LASSS D T+R+W
Sbjct: 132 TKFLTGHSRKVGHILYHPTAKDVLASSSLDYTVRIW 167

 Score = 35.0 bits (79), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 82/204 (40%), Gaps = 43/204 (21%)

Query: 57  TVHKKAIRCVAWRPHS-NLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLA 115
           T H + +  + + P + ++LA+ S D TV IW                        D+  
Sbjct: 136 TGHSRKVGHILYHPTAKDVLASSSLDYTVRIWNVETGE------------------DIYK 177

Query: 116 IIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHS-QDVKHVV 174
           +   H + V  +++S+DG  L++ +RDK + +W       E + +S    H+    + VV
Sbjct: 178 L--KHPDMVTSMSFSYDGTHLATVARDKKLRVWNV----REEKVVSEGAAHAGAKNQRVV 231

Query: 175 WHPELPLLASSSY----DDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG------KN 224
           W      LA++ +    D  I +W  ++       +  G  G  +  D   G       +
Sbjct: 232 WLGNSERLATTGFSKLSDRQIGIWDAFN-------LEKGDLGGFYTVDQSSGILMPFYDD 284

Query: 225 GESIRLCSGSDDSTVRVWRYIDDD 248
           G  I   +G  D  +R + + +D+
Sbjct: 285 GNKILYLAGKGDGNIRYYEFQNDE 308

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 52/105 (49%), Gaps = 12/105 (11%)

Query: 162 VLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEK 221
           VL  H + +  V ++ E  LL + S D +  +W  Y ++ E    L+GH G++W  D   
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFTCSKDISASVW--YSNNGERLGTLDGHMGSIWSID--- 59

Query: 222 GKNGESIRLCSGSDDSTVRVWRYIDDDEDGQ--QEWICEAILPKV 264
             +  S+   +GS D T++VW  +    +GQ  Q W C   + +V
Sbjct: 60  -SDHTSLYCVTGSADYTIKVWTLM----NGQCVQTWNCPVPVKRV 99

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/250 (21%), Positives = 104/250 (41%), Gaps = 35/250 (14%)

Query: 105 TTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQ 164
           T N + +    +++GH N++    WS D   + S S+D  + IW++   G +   I +  
Sbjct: 76  TKNKINLKPNIVLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDS-ASGLKQNAIPL-- 132

Query: 165 EHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDD---WECAAVLNGHEGTVWCSDFEK 221
             SQ V      P   L+AS+  ++   +++   ++      A++  GH  T + SD E 
Sbjct: 133 -DSQWVLSCAISPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGH--TCYISDIEF 189

Query: 222 GKNGESIRLCSGSDDSTVRVW-----RYIDDDEDGQQEWICEAILPKVHDRQIYSVSWST 276
             N     + + S D T  +W     + + +  D   + +  AI  + +       S ++
Sbjct: 190 TDNAH---ILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPN-------SENS 239

Query: 277 NGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATG 336
           +   AS GSDG   ++   S           A Q       + N +++      M +  G
Sbjct: 240 SNTFASCGSDGYTYIWDSRSPS---------AVQSFYVNDSDINALRF--FKDGMSIVAG 288

Query: 337 GDDGCVNLWN 346
            D+G +N+++
Sbjct: 289 SDNGAINMYD 298

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 60/121 (49%), Gaps = 7/121 (5%)

Query: 124 VKGIAWSHDGALLSSCSRDKSVWIWETDQ--DGEEYECISVLQEHSQDVKHVVWHPELPL 181
           ++ ++ + DG++L + +   + ++W+     D    + ++  + HS+ +  V+   ++  
Sbjct: 162 LQSLSIASDGSMLVAGNNKGNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKH 221

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           LA+ S D T R+W   +D+++    L+ H   VW   F    + +S  L +   D  VR+
Sbjct: 222 LATCSADHTARVWS-VEDNFQLETTLDAHSRWVWDCAF----SADSAYLVTACSDHYVRL 276

Query: 242 W 242
           W
Sbjct: 277 W 277

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 32/78 (41%), Gaps = 5/78 (6%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
            EGH   V  IA+  D   + S S D ++ +W+      +        +H   V  VV H
Sbjct: 71  FEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRN-----YKHDAPVNEVVIH 125

Query: 177 PELPLLASSSYDDTIRLW 194
           P    L S   D  I++W
Sbjct: 126 PNQGELISCDQDGNIKIW 143

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 60/147 (40%), Gaps = 31/147 (21%)

Query: 62  AIRCVAWRPHS-NLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGH 120
               +++  HS NLLAA   DS + ++                          L ++ GH
Sbjct: 275 PFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSP------------------LHVMSGH 316

Query: 121 ENEVKGIAWS-HDGALLSSCSRDKSVWIWETDQDGEEY----------ECISVLQEHSQD 169
           ++ V  + +S H   ++ S   D+   IW+  Q G E           E + +   H   
Sbjct: 317 QDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSP 376

Query: 170 VKHVVWHPELP-LLASSSYDDTIRLWK 195
           V    ++P++P LLAS+  D+ I+ WK
Sbjct: 377 VNEFSFNPQIPWLLASTEEDNVIQAWK 403

>Scas_469.3
          Length = 624

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 80/181 (44%), Gaps = 20/181 (11%)

Query: 120 HENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPEL 179
           H+ E+ G+++  DG  L+S   D +V IW+T     ++    + + H+  VK + W P +
Sbjct: 392 HQGEICGLSYKSDGLQLASGGNDNTVMIWDTRTSMPQW----IKRNHNAAVKALSWCPYI 447

Query: 180 P-LLAS--SSYDDTIRLWKDYDDDWECAAVLNGHEGTV--WCSDF-EKGKNGESIRLCSG 233
           P LLA+     D  I  W +     +  ++ +G + +   W   +   G     I    G
Sbjct: 448 PNLLATGGGQTDKYIHFW-NSTTGAKMGSINSGSQVSSLHWGQSYNSNGVMNREIVATGG 506

Query: 234 SDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAVY 292
           + D+ + V+ Y   D   +   I  A     H+ +I     S +G ++A+ G D  L  Y
Sbjct: 507 NPDNAISVFNY---DTKYKVAEINHA-----HEARICCSQLSPDGTVLATVGGDENLKFY 558

Query: 293 K 293
           K
Sbjct: 559 K 559

>Kwal_33.15475
          Length = 783

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 89/220 (40%), Gaps = 41/220 (18%)

Query: 143 KSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDD-- 200
           K++ +W+   D   +     L+ H+ +V  V + P   L+ SSS D  +RLW   + D  
Sbjct: 33  KTIALWKP-LDPAHHGVYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQD 91

Query: 201 -WECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEW---- 255
             +C  V++ H+ T+         +  S  L  G  D +V +W   ++       +    
Sbjct: 92  ALKCVQVIDHHKHTI------TSLSVISNILSVGCADGSVSLWLTENNQAILLHSFNLQT 145

Query: 256 ----ICEAILPKVHDRQIYSVSWSTNGLI--ASTGSDGTLAVYKEVSNGDDEHDWEVIAK 309
               +C A+     D+ + ++  +   +   + T  DGTL  ++  +  +   DW     
Sbjct: 146 NVYPLCMALKLVEGDKYLLAIGGTNPRVFIYSFTLQDGTLNNFQLAAELEGHEDW----- 200

Query: 310 QELCHGVYEANIVKWIDI----NGNMMLATGGDDGCVNLW 345
                       VK +D      GNM+LATG  D  + LW
Sbjct: 201 ------------VKAMDFYEESPGNMLLATGSQDRYIRLW 228

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 128/312 (41%), Gaps = 64/312 (20%)

Query: 7   KSLKLQNDKLWSLDYSHG--LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIR 64
           ++LK  N ++  + +  G  L+ + S D ++++       +  +  + V+D   HK  I 
Sbjct: 50  RTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQDALKCVQVIDH--HKHTIT 107

Query: 65  CVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEV 124
            ++    SN+L+ G  D +VS+W                     L M  L ++EG     
Sbjct: 108 SLSVI--SNILSVGCADGSVSLWLTENNQAILLHSFNLQTNVYPLCM-ALKLVEG----- 159

Query: 125 KGIAWSHDGALLSSCSRDKSVWIWE-TDQDG--EEYECISVLQEHSQDVKHVVWHPELP- 180
                  D  LL+    +  V+I+  T QDG    ++  + L+ H   VK + ++ E P 
Sbjct: 160 -------DKYLLAIGGTNPRVFIYSFTLQDGTLNNFQLAAELEGHEDWVKAMDFYEESPG 212

Query: 181 --LLASSSYDDTIRLWK----------DYDD-----------------DWECA----AVL 207
             LLA+ S D  IRLW+          D D+                 D + A    A++
Sbjct: 213 NMLLATGSQDRYIRLWRIRTNELIDNSDEDEFKLNLLGNKQSKFFITPDLKVAINFDALI 272

Query: 208 NGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDR 267
            GH+  + C  + K    E  +L + + D+ V VW    D + G   WIC + L ++  +
Sbjct: 273 VGHDDWISCLKWHK----ERPQLLASTADTAVMVWE--PDADSGV--WICASRLGELSSK 324

Query: 268 QIYSVSWSTNGL 279
              + + S+ G 
Sbjct: 325 GASTATGSSGGF 336

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 57/121 (47%), Gaps = 17/121 (14%)

Query: 133 GALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELP----LLASSSYD 188
           G +  + SRDK +  W+  +DG++YE    L+  +  V  +   P L     L+A+   +
Sbjct: 659 GHVFVTASRDKHIKAWKLSEDGQQYEQQHALK-LAVPVTAISVFPGLHNGKLLVAAGLEN 717

Query: 189 DTIRLWKDYDDDWECAAVLNGHEGTV-------WCSDFEKGKNGESIRLCSGSDDSTVRV 241
             I+++  YD+ + C + ++             W S+ EKG+    I L   S D ++RV
Sbjct: 718 GNIQVFT-YDNQFRCYSEIDTRFTPADRVSRLRWSSNQEKGR----ILLAVTSADHSIRV 772

Query: 242 W 242
           +
Sbjct: 773 F 773

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 89/228 (39%), Gaps = 51/228 (22%)

Query: 115 AIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVV 174
           A+I GH++ +  + W  +   L + + D +V +WE D D   + C S L E S       
Sbjct: 270 ALIVGHDDWISCLKWHKERPQLLASTADTAVMVWEPDADSGVWICASRLGELSS------ 323

Query: 175 WHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGS 234
                                      + A+   G  G  W   +   KN + I L +G 
Sbjct: 324 ---------------------------KGASTATGSSGGFWSCSWFTHKNRDHI-LTNGK 355

Query: 235 DDSTVRVWR-YIDDDEDG-QQEWICEAILPKVHDRQIYSVSWSTNGL-IASTGSDGTLAV 291
             S    WR ++ D+ +G +Q+         V D     V+WS NGL + +T  D T  +
Sbjct: 356 TGS----WRMWVSDELEGWKQQLAITGPTKAVTD-----VAWSPNGLYMLATSLDQTTRL 406

Query: 292 YKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDD 339
               +   +   W   A+ ++ HG Y+   V+ +    N    +GGD+
Sbjct: 407 ISRCNYDANAGSWFEFARPQI-HG-YDMICVEPL---SNTRFISGGDE 449

 Score = 32.7 bits (73), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 82/201 (40%), Gaps = 17/201 (8%)

Query: 111 MDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYE-CISVLQEHSQD 169
           + L    + H   +  + +S D   L S SRD+   +W+ +    E+E      + H++ 
Sbjct: 588 LQLKPTKQFHNLTITRLRFSSDSESLLSVSRDRQWAVWKKNSATNEFELTFKNEKAHTRI 647

Query: 170 VKHVVWHPEL--PLLASSSYDDTIRLWKDYDD--DWECAAVLNGHEGTVWCSDFEKGKNG 225
           +    W P     +  ++S D  I+ WK  +D   +E    L         S F    NG
Sbjct: 648 IWDCDWAPTEFGHVFVTASRDKHIKAWKLSEDGQQYEQQHALKLAVPVTAISVFPGLHNG 707

Query: 226 ESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-----LI 280
           + + + +G ++  ++V+ Y     D Q     E         ++  + WS+N      L+
Sbjct: 708 K-LLVAAGLENGNIQVFTY-----DNQFRCYSEIDTRFTPADRVSRLRWSSNQEKGRILL 761

Query: 281 ASTGSDGTLAVYK-EVSNGDD 300
           A T +D ++ V+  EV    D
Sbjct: 762 AVTSADHSIRVFSMEVPPAHD 782

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 62/132 (46%), Gaps = 19/132 (14%)

Query: 120 HENEVKGIAWSHD-GALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           H++ +  +A +   G L S+ + D  + +W    D    +C+ VL  H   V    +  +
Sbjct: 279 HDDYINSLAINAQLGVLSSTANLDNEIKLW----DISTTQCLGVLSGHRATVNTTRFIDD 334

Query: 179 LPLLASSSYDDTIRLW-------KDYD-DDWECAAVLNGHEGTVWCSDFEKGKNGESIRL 230
             LLAS+  D ++++W       KD + +D  C A  +GH+ +V          G +I  
Sbjct: 335 TRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTA----LATTGNAI-- 388

Query: 231 CSGSDDSTVRVW 242
            SGS+D T+R W
Sbjct: 389 VSGSNDKTLRHW 400

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 38/87 (43%), Gaps = 8/87 (9%)

Query: 114 LAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWE----TDQDGEEYE--CISVLQEHS 167
           L ++ GH   V    +  D  LL+S  +D SV +W+     D+DG   +  C++    H 
Sbjct: 316 LGVLSGHRATVNTTRFIDDTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHK 375

Query: 168 QDVKHVVWHPELPLLASSSYDDTIRLW 194
             V  +        + S S D T+R W
Sbjct: 376 DSVTALATTGN--AIVSGSNDKTLRHW 400

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 97/205 (47%), Gaps = 22/205 (10%)

Query: 154 GEEYECISVLQEHSQDVKHVVWHPELPLLASSS-YDDTIRLWKDYDDDWECAAVLNGHEG 212
           G + +    L+ H   +  +  + +L +L+S++  D+ I+LW       +C  VL+GH  
Sbjct: 267 GTKGQLGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDI--STTQCLGVLSGHRA 324

Query: 213 TVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDD--DEDGQ-QEWICEAILPKVHDRQI 269
           TV  + F      ++  L S   D++V+VW  +D+  D+DG   + +C A     H   +
Sbjct: 325 TVNTTRFID----DTRLLASAGKDASVKVWD-VDNIVDKDGNANDNLCLATFDG-HKDSV 378

Query: 270 YSVSWSTNGLIASTGSDGTLAVYKEVSNGDDEHDWEV-IAKQELCHGVYEANIVKWID-- 326
            +++ + N +++  GS+     + ++ +G      ++ IA + +   V + +I    +  
Sbjct: 379 TALATTGNAIVS--GSNDKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDITPSFNTP 436

Query: 327 -ING----NMMLATGGDDGCVNLWN 346
            I G    +  L TG  DG V LW+
Sbjct: 437 LIGGADCIDNALVTGTKDGIVYLWD 461

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 59/260 (22%), Positives = 107/260 (41%), Gaps = 51/260 (19%)

Query: 4   KLAKSLKLQNDKLWSL--DYSHGLLA-TGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHK 60
           +L K+LK  +D + SL  +   G+L+ T + D +IK+ +++         + VL  + H+
Sbjct: 271 QLGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTT-----QCLGVL--SGHR 323

Query: 61  KAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGH 120
             +    +   + LLA+   D++V +W                   N+ +   LA  +GH
Sbjct: 324 ATVNTTRFIDDTRLLASAGKDASVKVW---------DVDNIVDKDGNANDNLCLATFDGH 374

Query: 121 ENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISV---LQEHSQDVKHVVWHP 177
           ++ V  +A +  G  + S S DK++  W+    G+  + I +   L+   Q V  +   P
Sbjct: 375 KDSVTALATT--GNAIVSGSNDKTLRHWDLGS-GKCIQSIDLTIALKMVPQSVSKLDITP 431

Query: 178 EL--PL----------LASSSYDDTIRLWKDYDDDWECAAV---LNGHEGTVWCSDFEKG 222
               PL          L + + D  + LW     D     V   L GH G +    +   
Sbjct: 432 SFNTPLIGGADCIDNALVTGTKDGIVYLW-----DLRIGRVVGSLEGHRGPITSLKYMGS 486

Query: 223 KNGESIRLCSGSDDSTVRVW 242
           +      L +GS D + R+W
Sbjct: 487 E------LITGSMDKSTRIW 500

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 73/184 (39%), Gaps = 36/184 (19%)

Query: 63  IRCVAWRPHSNL-LAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHE 121
           +RC+A     N   A GS D T+ IW                   N     L   ++ H+
Sbjct: 118 VRCIAMDKVDNEWFATGSNDKTIKIW-------------------NLASGKLKVTLKAHD 158

Query: 122 NEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPL 181
             V+ +A S+    + S S DK+V  W    D E+   I     H   V  V  HP + +
Sbjct: 159 MTVRDLAISNRHPYMFSVSEDKTVKCW----DLEKNTAIRNYHGHLSGVHTVDIHPTVDV 214

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGT---VWCSDFEKGKNGESIRLCSGSDDST 238
           + ++  D  +++W D          L GH+G    V C   +        ++ S S D++
Sbjct: 215 VVTAGRDSVVKVW-DIRTRLPVMT-LPGHKGPITKVRCLPVDP-------QVISSSVDAS 265

Query: 239 VRVW 242
           +R+W
Sbjct: 266 IRLW 269

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 71/190 (37%), Gaps = 34/190 (17%)

Query: 26  LATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTVS 85
            ATGS D+ IKI N+ +  + +V+L        H   +R +A       + + S D TV 
Sbjct: 131 FATGSNDKTIKIWNLASG-KLKVTL------KAHDMTVRDLAISNRHPYMFSVSEDKTVK 183

Query: 86  IWTRXXXXXXXXXXXXXXXTTNSLEMDL-LAIIEGHENEVKGIAWSHDGALLSSCSRDKS 144
            W                     LE +  +    GH + V  +       ++ +  RD  
Sbjct: 184 CW--------------------DLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSV 223

Query: 145 VWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECA 204
           V +W    D      +  L  H   +  V   P  P + SSS D +IRLW       +  
Sbjct: 224 VKVW----DIRTRLPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLVAG--KSM 277

Query: 205 AVLNGHEGTV 214
            VL  H+ TV
Sbjct: 278 KVLTHHQRTV 287

>Scas_680.11
          Length = 347

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query: 162 VLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEK 221
           VL  H + +  V ++ E  LL S S D+   +W  Y  + E    LNGH GT+W  D +K
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFSCSKDNFASVW--YSVNGERLGTLNGHAGTIWSIDVDK 62

Query: 222 GKNGESIRLCSGSDDSTVRVWR 243
                     +GS D ++++W+
Sbjct: 63  FTE----YCVTGSADYSIKMWK 80

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 77/188 (40%), Gaps = 20/188 (10%)

Query: 24  GLLATGSTDRKIKI--INVTNAPRG--QVSLMDVLDD-TVHKKAIRCVAWRPHSNLLAAG 78
           G L T   D K+++  +N     +G  +V  +D L   ++H++A+  + +    N+LA+ 
Sbjct: 39  GELFTAGGDNKVRLWRLNCEETGKGTCKVDTIDFLSGLSLHEQAVNVIRFDHRGNVLASA 98

Query: 79  SFDSTVSIWTRXXXXXXXXXXXXXXXTT-----------NSLEMDLLAIIEGHENEVKGI 127
             D  V +W                                   DL  +  G  +E+  +
Sbjct: 99  GDDGQVLLWKLTNEETRKKQQRMGDEPVEGDGWAVWKRLRGTANDLDNMPGGGASEIYDL 158

Query: 128 AWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSY 187
           +WS D   L + S D S+ ++  D       C++  ++H+  V+ V W P    + S S 
Sbjct: 159 SWSPDDKYLVTASMDNSLKVFNVDTGN----CVAFAKDHNHYVQGVTWDPLNQYIISQSV 214

Query: 188 DDTIRLWK 195
           D +I +++
Sbjct: 215 DRSINIYE 222

>Kwal_56.23685
          Length = 1102

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 61/139 (43%), Gaps = 8/139 (5%)

Query: 116 IIEGHENEVKGIAW-SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVV 174
           ++ GH   +  I +      +L++CS D  V  W+       Y   SV    +  VK   
Sbjct: 109 VLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMRSPRRAYYSASVWSAGASQVK--- 165

Query: 175 WHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGS 234
           W+ +   + +S++ + + +W D         VL GH  +V   DF K    E   + S S
Sbjct: 166 WNYKNSNVMASAHSNDVYIW-DLRKGCTPLHVLQGHVNSVNSIDFSKFDETE---IMSSS 221

Query: 235 DDSTVRVWRYIDDDEDGQQ 253
           +D TV+ W Y   D++ Q+
Sbjct: 222 NDGTVKFWDYSLSDKEPQR 240

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 94/242 (38%), Gaps = 21/242 (8%)

Query: 112 DLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVK 171
           +L+  + GHE  +  I  S    L++SCS D+S+ +W+ +   E    +S+   H+  + 
Sbjct: 170 ELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGKE----LSIGWSHTARIW 225

Query: 172 HVVWHPELPLLASSSYDDTIRLWKDYDDD-----WECAAVLNGH-EGTVWCSDFEKGKNG 225
           ++ +      L S S D T R+W    +D      + + +  GH    VW  D     N 
Sbjct: 226 NLKFFNNDENLVSVSEDCTCRVWNIIPNDISGYELQISNIFEGHLLKNVWGVDV----ND 281

Query: 226 ESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICE-------AILPKVHDRQIYSVSWSTNG 278
           E   + +  +D  + V     D   G +    E       A +    D  I    W   G
Sbjct: 282 EKRIIATSGNDGRINVIDLNTDTNSGDEVIGYEIADIEKAAGISFEKDEIIKGFYWFKFG 341

Query: 279 LIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGD 338
           L+  T     LA   E             A   + +G+YE+NIV + +   +++      
Sbjct: 342 LVCITSQGRVLAFQTETKQWRQCLLDSRFASYSITNGIYESNIVFFTNNKCDILAMKFSI 401

Query: 339 DG 340
           DG
Sbjct: 402 DG 403

>Scas_603.5
          Length = 589

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 83/203 (40%), Gaps = 38/203 (18%)

Query: 50  LMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSL 109
           +MD LDD  H  ++ C+   P S  L  GS D+T+ +W                 +T+++
Sbjct: 330 VMD-LDD--HIASVTCMQLHPDSKTLITGSKDATLKLW------DLGLAPQTSLDSTSNI 380

Query: 110 EMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQ---EH 166
           +   +   E H  E+  +++  D   L S SRDKS+  W    D     C+  L+    H
Sbjct: 381 D-SCINTFEAHTAEITSVSY--DNEYLLSASRDKSIRQW----DLTTGNCVQTLEATLSH 433

Query: 167 S-----QDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAV---LNGHEGTVWCSD 218
           +     +D            LA+ S D  IRLW     D     V   L  H+G +    
Sbjct: 434 NSGTNIKDSTVEALQSVGAALATGSKDGIIRLW-----DLRSGKVVRTLLKHQGPITSLQ 488

Query: 219 FEKGKNGESIRLCSGSDDSTVRV 241
           F      +S ++ +GS D+ + V
Sbjct: 489 F------DSTKIITGSTDANISV 505

>YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing
           five WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has a region of low
           similarity to a region of S. cerevisiae Sec27p, which a
           coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles [3447 bp, 1148 aa]
          Length = 1148

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 64/141 (45%), Gaps = 12/141 (8%)

Query: 105 TTNSLEMDLLAIIEGHENEVKGIAWSHDGA-LLSSCSRDKSVWIWETDQDGEEYECISVL 163
           ++N++E     ++ GH   +  I ++     +L++CS D  V  W+       +   S  
Sbjct: 102 SSNAIEF----VLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSW 157

Query: 164 QEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGK 223
           +  +  VK   W+ + P + +SS+ + I +W D          L GH  +V   DF + K
Sbjct: 158 RSAASQVK---WNYKDPNVLASSHGNDIFVW-DLRKGSTPLCSLKGHVSSVNSIDFNRFK 213

Query: 224 NGESIRLCSGSDDSTVRVWRY 244
             E   + S S+D TV+ W Y
Sbjct: 214 YSE---IMSSSNDGTVKFWDY 231

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 104/267 (38%), Gaps = 56/267 (20%)

Query: 2   GIKLAKSLKLQNDKLWSLDYS---HGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTV 58
           G KL+   K  +D +  LD+      L   G  D  +K+ + T   + Q+  M+      
Sbjct: 393 GKKLSTIPKAHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTK--KRQIGAMEG----- 445

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H   I C+    + N++A GS D+TV +W                   NS   + L  ++
Sbjct: 446 HVATISCMQVDKNYNMVATGSKDATVKLWN------ANDVIGRYEEGNNS---EALHTLD 496

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEH------------ 166
            H +EV  +    DGA L + S+DK++  W    D    +CI V   +            
Sbjct: 497 AHLDEVSSLYI--DGANLMTASQDKTIRRW----DLYSGKCIQVFDVNFPSLSAYKSSFM 550

Query: 167 -SQDVKHVVWHPELPL----------LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVW 215
            S +   ++     P+          LA+ + D  IRLW       E   VL GH   + 
Sbjct: 551 KSNEDSMILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMR--TGEVVRVLEGHMDAIT 608

Query: 216 CSDFEKGKNGESIRLCSGSDDSTVRVW 242
              F      ++  + SGS D T+R+W
Sbjct: 609 SLKF------DATTIISGSLDGTIRLW 629

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 95/226 (42%), Gaps = 47/226 (20%)

Query: 69  RPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIA 128
           R  + LL + S+D T  IW                   N L+ DL      HE  V    
Sbjct: 109 RFQNGLLLSSSWDKTAKIWDN-----------------NKLKYDL----RNHEASVWDST 147

Query: 129 WSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYD 188
              D  +L++ S DKS+ +W    +G+  + +S +  H   ++H+ +     + AS S D
Sbjct: 148 MVSDDIILTA-SADKSIGVW---MEGKLIKKLSNI--HDDVIRHLEYISN-DIFASCSND 200

Query: 189 DTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDD 248
            TI+L    + + E   V  GHE  V+C    K  N     L S  +DSTVR+W      
Sbjct: 201 GTIKLL---NLEGEIKNVFEGHESFVYCV---KHMNN---TLFSCGEDSTVRIWSI---- 247

Query: 249 EDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKE 294
            +G  + +    +P V    ++++    NG      SD T+ ++ E
Sbjct: 248 -NGSTKQVIR--IPAV---SVWNLDLLPNGDFVICCSDNTIRIFTE 287

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 100/267 (37%), Gaps = 71/267 (26%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQ-------- 164
           L A + GH  +VK I   +D   ++S SRD S+ +W     G ++E + V Q        
Sbjct: 4   LSATLRGHSQDVKDITAVNDNK-IASVSRDGSLRVWTRSSSG-DWEDVLVYQSDKFLNAV 61

Query: 165 --------------------EHSQDVKHVVWHPELP----------------LLASSSYD 188
                                H +DV      P                   LL SSS+D
Sbjct: 62  CYDKTSQTVYYGGQDTLINGSHIEDVIGSSADPMYTLVGHTGNVCGLRFQNGLLLSSSWD 121

Query: 189 DTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDD 248
            T ++W    D+ +    L  HE +VW S            + + S D ++ VW      
Sbjct: 122 KTAKIW----DNNKLKYDLRNHEASVWDSTMVSDD-----IILTASADKSIGVW------ 166

Query: 249 EDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYK---EVSNGDDEHDWE 305
                E      L  +HD  I  + + +N + AS  +DGT+ +     E+ N  + H+  
Sbjct: 167 ----MEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLNLEGEIKNVFEGHESF 222

Query: 306 VIAKQELCHGVY---EANIVKWIDING 329
           V   + + + ++   E + V+   ING
Sbjct: 223 VYCVKHMNNTLFSCGEDSTVRIWSING 249

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/295 (21%), Positives = 108/295 (36%), Gaps = 79/295 (26%)

Query: 49  SLMDVLDDTVHKKA----IRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXX 104
           S+ D +D    K++    I  V+W P   L+  G+    + +W +               
Sbjct: 194 SIKDPIDLVYPKRSEEEPIISVSWSPDGELVLTGTTSGELRLWNK--------------- 238

Query: 105 TTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWET------------DQ 152
                +  L  I++ H + +  + W+ D   L +      V +W T            + 
Sbjct: 239 -----QGKLKNILDSHRSPIVAMKWNQDCTHLLTTDVSNVVILWSTLTGTQLQHFSFKEG 293

Query: 153 DGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEG 212
           D E  + + +  E  +  K V+  P   LL  +  ++            +    L GH  
Sbjct: 294 DIENEDSLGIDLEWVETDKFVIPGPGGSLLVYTIGNN------------KPLGRLLGHTS 341

Query: 213 TVWCSDFEKGKNGESIRLCSGSDDSTVRVWR-----YIDDDEDGQQEWICEAILPKVHDR 267
           T+   +F K        L S SDD+T++VWR       +D  D              H +
Sbjct: 342 TITTLEFNKSNKS----LLSASDDNTIKVWRGGNSSAANDFTD--------------HTK 383

Query: 268 QIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQEL-CHGVYEANI 321
            I S  W  + LI ST  DGT+ V+    N        ++A+  L    ++EA++
Sbjct: 384 TISSAHWINDDLIISTAYDGTVKVWSISKNS-------IVAEASLDSEPIFEASL 431

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           + A ++GHE EV  + +  D   + S S D  V IW+   D    +CI  +Q +S   K 
Sbjct: 51  VYATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKF-TDYSHLQCIQTIQHYS---KT 106

Query: 173 VVWHPELP-LLASSSYDDTIRLWK 195
           +V    LP L++    D TI +W+
Sbjct: 107 IVALSALPSLISVGCADGTISIWR 130

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 80/212 (37%), Gaps = 43/212 (20%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H+  + CV + P S+ + + S D  V IW                  T+   +  +  I+
Sbjct: 58  HEAEVTCVRFVPDSDFMVSASEDHHVKIW----------------KFTDYSHLQCIQTIQ 101

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP- 177
            +   +  +A S   +L+S    D ++ IW  +   +E+        H   +K   ++P 
Sbjct: 102 HYSKTI--VALSALPSLISVGCADGTISIWRQNIQNDEFGL-----AHEFTIKKGFFYPL 154

Query: 178 -----------ELPLLASSSYDDTIRLWKDYDDDWE-CAAV--LNGHEGTVWCSDFEKGK 223
                       L  +  ++ +  I  +   D   E C  V  L GHE  V    F   +
Sbjct: 155 CLSLSKVEEKKYLLAIGGTNVNVFIASFILSDSGIEKCRVVAELEGHEDWVKSLAFRHQE 214

Query: 224 NGESIRLCSGSDDSTVRVWR-----YIDDDED 250
                 LCSGS D  +R+WR      IDD E+
Sbjct: 215 TPGDYLLCSGSQDRYIRLWRIRINDLIDDSEE 246

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 84/175 (48%), Gaps = 35/175 (20%)

Query: 113 LLAIIEGHENEVKGIAWSHDGA----LLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQ 168
           ++A +EGHE+ VK +A+ H       LL S S+D+ + +W    +        ++ +  +
Sbjct: 194 VVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRIN-------DLIDDSEE 246

Query: 169 DVKHVVWHPELPLLASSSY----DDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKN 224
           D K      +L LL++  Y    DD +R+  +++      A++ GH+   W S  +  ++
Sbjct: 247 DSK------KLTLLSNKQYKFQIDDELRVGINFE------ALIMGHDD--WISSLQWHES 292

Query: 225 GESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGL 279
              ++L + + D+++ VW    D+  G   W+C   L ++  +   + + S+ G 
Sbjct: 293 --RLQLLAATADTSLMVWE--PDETSGI--WVCSLRLGEMSSKGASTATGSSGGF 341

 Score = 33.1 bits (74), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 29/140 (20%), Positives = 60/140 (42%), Gaps = 7/140 (5%)

Query: 111 MDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYEC-ISVLQEHSQD 169
           +++   +  H   +  + +S DG  L S  RD+   +WE + +   +E      + H++ 
Sbjct: 596 LEIKPALPFHSLTITRLKFSKDGKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRI 655

Query: 170 VKHVVWHP-EL-PLLASSSYDDTIRLW---KDYDDDWECAAVLNGHEGTVWCSDFEKGKN 224
           +    W P E   +  ++S D T+++W   K+  DD+   A +  H   V          
Sbjct: 656 IWDADWAPLEFGNVFVTASRDKTVKVWRHQKEPADDYVLEASIK-HTKAVTAISIHDSMI 714

Query: 225 GESIRLCSGSDDSTVRVWRY 244
            E I +  G ++  + ++ Y
Sbjct: 715 REKILISVGLENGEIYLYSY 734

 Score = 32.7 bits (73), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 60/302 (19%), Positives = 109/302 (36%), Gaps = 37/302 (12%)

Query: 25  LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWR----PHSNLLAAGSF 80
           LLA G T+  + I +   +  G      V +   H+  ++ +A+R    P   LL +GS 
Sbjct: 167 LLAIGGTNVNVFIASFILSDSGIEKCRVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQ 226

Query: 81  DSTVSIW--------------TRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKG 126
           D  + +W              ++                   + ++  A+I GH++ +  
Sbjct: 227 DRYIRLWRIRINDLIDDSEEDSKKLTLLSNKQYKFQIDDELRVGINFEALIMGHDDWISS 286

Query: 127 IAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV-----------VW 175
           + W      L + + D S+ +WE D+    + C   L E S                 +W
Sbjct: 287 LQWHESRLQLLAATADTSLMVWEPDETSGIWVCSLRLGEMSSKGASTATGSSGGFWSCLW 346

Query: 176 --HPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSG 233
             H  +    ++    + R+W    D+  C   L     T   +D     +GE   L + 
Sbjct: 347 FTHERMDFFLTNGKTGSWRMWAT-KDNIICDQRLGISGATKDVTDIAWSPSGE--YLLAT 403

Query: 234 SDDSTVRVWRYIDDDEDGQQEWIC---EAILPKVHDRQIYSVSWSTNGLIASTGSDGTLA 290
           S D T R++     D  G++  I    E   P++H   +  V   T+    S G +  L 
Sbjct: 404 SLDQTTRLFAPWIYDASGRKREIATWHEFSRPQIHGYDMICVETVTDTRFVSGGDEKILR 463

Query: 291 VY 292
            +
Sbjct: 464 SF 465

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 49/112 (43%), Gaps = 12/112 (10%)

Query: 190 TIRLWKDYDDDWE-CAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDD 248
           TI LW   + + +   A L GHE  V C  F      +S  + S S+D  V++W++ D  
Sbjct: 37  TIALWDPIEPNNKGVYATLKGHEAEVTCVRFVP----DSDFMVSASEDHHVKIWKFTDYS 92

Query: 249 EDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDD 300
                    + I    H  +      +   LI+   +DGT++++++    D+
Sbjct: 93  H-------LQCIQTIQHYSKTIVALSALPSLISVGCADGTISIWRQNIQNDE 137

>Kwal_33.15591
          Length = 714

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 76/180 (42%), Gaps = 29/180 (16%)

Query: 116 IIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW 175
           ++ GHEN V  +  S    L  S      VW     Q   ++E    L+ H+  V  V  
Sbjct: 100 VLIGHENNVCVLNSSQGYVLSGSWDTTAKVWF----QGALKHE----LKGHTASVWDVKM 151

Query: 176 HPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEG--TVWCSDFEKGKNGESIRLCSG 233
            PE+    ++S D TI+LW       E   VL    G  T      +   +GE    CS 
Sbjct: 152 LPEVGFYMTASADGTIKLW-------EGEKVLKTFTGLHTDVIRHIDIDASGEKFASCS- 203

Query: 234 SDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYK 293
            +D TV++     +D +G+            H+  +YSV ++ NG + S G D T+ ++K
Sbjct: 204 -NDGTVKI-----NDMEGKTLKTLVG-----HESFVYSVKFAPNGDVISCGEDRTVRIWK 252

 Score = 32.3 bits (72), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 107 NSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETD 151
           N +E   L  + GHE+ V  + ++ +G ++S C  D++V IW+ D
Sbjct: 211 NDMEGKTLKTLVGHESFVYSVKFAPNGDVIS-CGEDRTVRIWKAD 254

>Kwal_27.12586
          Length = 509

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 23/37 (62%), Gaps = 4/37 (10%)

Query: 207 LNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWR 243
           LNGH  T+   DF    N E+  L SGSDD T+RVWR
Sbjct: 331 LNGHSATITAFDF----NSENNMLLSGSDDKTLRVWR 363

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/292 (20%), Positives = 118/292 (40%), Gaps = 39/292 (13%)

Query: 16  LWSLDYSHG-LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPH--S 72
           +W+L +  G +L +GSTDR ++I N+       V          H   +RC+    +  S
Sbjct: 303 VWALKFVDGKILVSGSTDRSVRIWNIETGKCTHVF-------KGHTSTVRCLEVVEYGDS 355

Query: 73  NLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMD-LLAIIEGHENEVKGIAWSH 131
             +  GS D+T+ +W                      E    + ++ GH + V+ +  S 
Sbjct: 356 KYIVTGSRDNTLHVWKLPPMKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTV--SG 413

Query: 132 DGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTI 191
            G ++ S S D ++ +W    D    + + +L  H+  V   ++  +     S+S D T+
Sbjct: 414 HGRIVISGSYDHNLMVW----DIISMKLLYILTGHTDRVYSTIYDYKRNRCISASMDTTV 469

Query: 192 RLW--KDYDDDWECAAVLNGHE----GTVWCSDFEKGKNG----ESIRLCSGSDDSTVRV 241
            +W  ++ +++     + +G      G++ C        G     +  L S + D ++R 
Sbjct: 470 MIWDLENIENNGTTTTINDGASIKVVGSMKCLYGHTALVGLLCLSNKFLVSAAADGSIRG 529

Query: 242 WRYIDDDEDGQQEWICEAILPKVHDRQIYSV-SWSTNGLIASTGSDGTLAVY 292
           W    D  D  +++         H   + ++ S+S N  I  +GS+    VY
Sbjct: 530 W----DPNDYSRKF-------SFHHTNLAAITSFSMNDNILVSGSERQFNVY 570

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 67/157 (42%), Gaps = 32/157 (20%)

Query: 110 EMDLLAI-IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQ 168
           E DL  + + GHE  V  + +  DG +L S S D+SV IW      E  +C  V + H+ 
Sbjct: 288 ENDLFLLELNGHEGGVWALKFV-DGKILVSGSTDRSVRIWNI----ETGKCTHVFKGHTS 342

Query: 169 DVK--HVVWHPELPLLASSSYDDTIRLWK------------------DYDDDWECAAVLN 208
            V+   VV + +   + + S D+T+ +WK                    +++     VL 
Sbjct: 343 TVRCLEVVEYGDSKYIVTGSRDNTLHVWKLPPMKELDKGSQEPIFYRTPEENPYFVGVLR 402

Query: 209 GHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYI 245
           GH  +V      +  +G    + SGS D  + VW  I
Sbjct: 403 GHMSSV------RTVSGHGRIVISGSYDHNLMVWDII 433

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 97/242 (40%), Gaps = 53/242 (21%)

Query: 19  LDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAAG 78
           L + +  + TG+ D+KI + +  N        + +L+   H+  +  + +     +L +G
Sbjct: 266 LQFENNYIITGADDKKINVYDAEND-------LFLLELNGHEGGVWALKFV-DGKILVSG 317

Query: 79  SFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVK--GIAWSHDGALL 136
           S D +V IW                   N        + +GH + V+   +    D   +
Sbjct: 318 STDRSVRIW-------------------NIETGKCTHVFKGHTSTVRCLEVVEYGDSKYI 358

Query: 137 SSCSRDKSVWIW------ETDQDGEE---YEC-------ISVLQEHSQDVKHVVWHPELP 180
            + SRD ++ +W      E D+  +E   Y         + VL+ H   V+ V  H    
Sbjct: 359 VTGSRDNTLHVWKLPPMKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVSGHGR-- 416

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
           ++ S SYD  + +W       +   +L GH   V+ + ++  +N    R  S S D+TV 
Sbjct: 417 IVISGSYDHNLMVWDII--SMKLLYILTGHTDRVYSTIYDYKRN----RCISASMDTTVM 470

Query: 241 VW 242
           +W
Sbjct: 471 IW 472

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 41/87 (47%), Gaps = 11/87 (12%)

Query: 207 LNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHD 266
           LNGHEG VW   F  GK      L SGS D +VR+W    + E G+   + +     V  
Sbjct: 296 LNGHEGGVWALKFVDGK-----ILVSGSTDRSVRIW----NIETGKCTHVFKGHTSTV-- 344

Query: 267 RQIYSVSWSTNGLIASTGSDGTLAVYK 293
           R +  V +  +  I +   D TL V+K
Sbjct: 345 RCLEVVEYGDSKYIVTGSRDNTLHVWK 371

>Kwal_56.23895
          Length = 367

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 36/71 (50%), Gaps = 4/71 (5%)

Query: 21  YSHGLLATGSTDRKIKIIN---VTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPH-SNLLA 76
           Y   ++ATG  D  IK+ +   V  A       M V +   H  AIR V+W PH SN+L 
Sbjct: 232 YRSHIVATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNMLL 291

Query: 77  AGSFDSTVSIW 87
           + S+D T  +W
Sbjct: 292 STSYDMTCRVW 302

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 166 HSQDVKHVVWHPELP-LLASSSYDDTIRLWKDYDDD 200
           H   ++ V W P    +L S+SYD T R+W+D  DD
Sbjct: 273 HDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDD 308

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 32/73 (43%), Gaps = 12/73 (16%)

Query: 230 LCSGSDDSTVRVWRYIDDD---EDGQQEWI-----CEAILPKVHDRQIYSVSWS---TNG 278
           L S S D T RVW+ + DD     G+   +     C  + P  H   ++   WS     G
Sbjct: 290 LLSTSYDMTCRVWQDLSDDGRRPTGKTNSVDPARGCRFVFPH-HTEFVFGADWSLWGKPG 348

Query: 279 LIASTGSDGTLAV 291
            IAST  DG + V
Sbjct: 349 YIASTSWDGDVCV 361

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 71/317 (22%), Positives = 118/317 (37%), Gaps = 66/317 (20%)

Query: 59  HKKAIRCVAW-RPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
           H   + C+   + + N+L  GS D+T+ +W                  T  +    +   
Sbjct: 377 HLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNF 436

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECIS----VLQEHSQDVKHV 173
           E H++E+   A S D   L S SRDK ++ W    D    +CI     +      D+K  
Sbjct: 437 ELHKDEI--TALSFDSEALVSGSRDKKIFHW----DLTTGKCIQQLDLIFTPTHSDIKMP 490

Query: 174 ---------VWHPELPL----------LASSSYDDTIRLWKDYDDDWECAA---VLNGHE 211
                    +   E P+          LA+ + D  +RLW     D        +L GH 
Sbjct: 491 ARSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLW-----DLRVGKPVRLLEGHT 545

Query: 212 GTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYS 271
             +    F+      S +L +GS D++VR+W       D +   I + I    +D  + S
Sbjct: 546 DGITSLKFD------SEKLVTGSMDNSVRIW-------DLRTSSILDVI---AYDLPVSS 589

Query: 272 VSWSTNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHG---VYEANIVKWIDIN 328
           + +    LI    ++G + V+    N + +  W          G        IVK+ D  
Sbjct: 590 LDFD-GKLITVGANEGGVNVF----NMERDEHWMTPEPPHSLDGDELSRRIAIVKYKD-- 642

Query: 329 GNMMLATGGDDGCVNLW 345
               L  G +DG +N+W
Sbjct: 643 --GFLINGHNDGDINVW 657

>Sklu_2317.3 YDR142C, Contig c2317 5804-6910
          Length = 368

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 21  YSHGLLATGSTDRKIKIINVTNAPRGQVSL---MDVLDDTVHKKAIRCVAWRPH-SNLLA 76
           Y   ++ATG  D+ +KI ++    +    L   M + +   H+ AIR V+W PH SNL+ 
Sbjct: 233 YRPHIVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVL 292

Query: 77  AGSFDSTVSIW 87
           + S+D T  +W
Sbjct: 293 STSYDMTCRVW 303

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 108/241 (44%), Gaps = 35/241 (14%)

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GHE  +  +  S++G  ++SCS D+S+ +W    D E  + +SV   H+  + ++++   
Sbjct: 177 GHEGSIFYVNLSNNGRYVASCSDDRSIRLW----DLETGKQLSVGWSHTARIWNLMFFDN 232

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECA--AVLNGHE----GTVWCSDFEKGKNGESIRLCS 232
              L S S D T R+W   +     A  ++ N +E     ++W  D    K+ E I + S
Sbjct: 233 DSKLISVSEDCTCRVWNIIESRENVAELSISNVYEVHLIKSIWGVDV---KDDEMIAVTS 289

Query: 233 GSDDS-----TVRVWRYIDDDEDGQQEWI---CEAILPKVHDRQIYSVSWSTNGLIASTG 284
           G+D        +++ R+ D++     + I   C  I  K  +  I    W + G+IA T 
Sbjct: 290 GNDGRLKLIDLLQLKRHGDEETSFSLDDIAKQCGDIFEK--NESIKGFQWFSFGVIAIT- 346

Query: 285 SDGTLAVYKEVSNGDDEHDWEVIAKQE------LCHGVYEANIVKWIDINGNMMLATGGD 338
           S G +  Y +V+       W+++   E      + +G+   NI  + +   +++L     
Sbjct: 347 SLGKILKYSDVTK-----QWKLLLTNEKFNSYPITNGIQTQNIAVFSNNKSDILLIKFSK 401

Query: 339 D 339
           D
Sbjct: 402 D 402

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 8/90 (8%)

Query: 106 TNSLEMDLLAIIEGHENEVKGIAWSHDGA--LLSSCSRDKSVWIWETDQDGEEYECISVL 163
           T++    LL  +  HE+ V    +   G+  LL++CSRD +V +W+T        CI   
Sbjct: 196 TDNAAFQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKVWDTKSGW----CIKSF 251

Query: 164 QEHSQDVKHVVWHPELPLLASSSYDDTIRL 193
           Q H+Q V+ +  H +   + + S D TIRL
Sbjct: 252 QPHNQWVRTLELHGD--YVITGSNDATIRL 279

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 66/139 (47%), Gaps = 12/139 (8%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           +EGHE  +     S DG L++SCS D+S+ +W   + GE+   + +   H+  +  + + 
Sbjct: 177 LEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSL-ETGEQ---VGIAWGHTARIWDLRFL 232

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHE-GTVWCSDFEKGKNGESIRLCSGSD 235
                L S S D T R+W    +  +  AV + H+  +VW  D ++    + + + +G+D
Sbjct: 233 RVADKLVSVSEDCTCRVWAVGAERMQEEAVYDVHQTKSVWAVDVQE---DDMVAVTAGND 289

Query: 236 DSTVRVWRYIDDDEDGQQE 254
                  R +D    G +E
Sbjct: 290 GR----LRLVDLTRPGSRE 304

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 78/196 (39%), Gaps = 34/196 (17%)

Query: 6   AKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRC 65
           AKS KL             LLA G  D  IKI ++       +S   +++   HK AI  
Sbjct: 70  AKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDL-------ISKTVLINFNGHKSAITV 122

Query: 66  VAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVK 125
           + + P    L +GS DS + IW                          L  +  H++ + 
Sbjct: 123 LRFDPTGTRLISGSKDSDIIIWDLVGEVG-------------------LYKLRSHKDSIT 163

Query: 126 GIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASS 185
           GI W  +   L S S+D  + IW    D +  +C+     H+ +   +  H +L +  ++
Sbjct: 164 GI-WCENEDWLISTSKDGLIKIW----DLKTQQCVETHMAHTSECWGLAIHNDLVI--TT 216

Query: 186 SYDDTIRLWK-DYDDD 200
           S +  I++W  D D D
Sbjct: 217 STESQIKIWNLDLDKD 232

 Score = 34.7 bits (78), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 12/79 (15%)

Query: 172 HVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVL---NGHEGTVWCSDFEKGKNGESI 228
           ++ +HPE  LLA    D  I++W     D     VL   NGH+  +    F+        
Sbjct: 80  YLQYHPETNLLAVGYADGVIKIW-----DLISKTVLINFNGHKSAITVLRFDP----TGT 130

Query: 229 RLCSGSDDSTVRVWRYIDD 247
           RL SGS DS + +W  + +
Sbjct: 131 RLISGSKDSDIIIWDLVGE 149

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 59/139 (42%), Gaps = 27/139 (19%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H   + C++W  H  +L++GS D T  I  R                   +       IE
Sbjct: 417 HLDRVACLSWNNH--ILSSGSRDRT--ILHRDVR----------------MADPFFEKIE 456

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP- 177
            HE E+ G+ W+ +   L+S   D  V+++    DG        + EH   VK + W P 
Sbjct: 457 THEQEICGLKWNTNDNKLASGGNDNMVFVY----DGTSRTPFLSINEHKAAVKAMAWSPH 512

Query: 178 ELPLLAS--SSYDDTIRLW 194
           +  +LA+   + D T+++W
Sbjct: 513 KQGILATGGGTADRTLKMW 531

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 74/186 (39%), Gaps = 36/186 (19%)

Query: 26  LATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAA---GSFDS 82
           LA+G  D  + + + T       S    L    HK A++ +AW PH   + A   G+ D 
Sbjct: 474 LASGGNDNMVFVYDGT-------SRTPFLSINEHKAAVKAMAWSPHKQGILATGGGTADR 526

Query: 83  TVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWS--HDGALLSSCS 140
           T+ +W                    +  + L  +  G  ++V  + WS   D  + S   
Sbjct: 527 TLKMWNV------------------NTSVKLNDVDTG--SQVCNMVWSTNTDEIVTSHGY 566

Query: 141 RDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDD 200
              ++ IWE        E +++L+ HS  V H+    +   + S + D+T+R WK ++  
Sbjct: 567 SKYNLTIWE----ASNLEPLAILKGHSFRVLHLTLSADGTTIVSGAGDETLRYWKLFEKQ 622

Query: 201 WECAAV 206
              A  
Sbjct: 623 KRKATA 628

>KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces
           cerevisiae YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis, start by similarity
          Length = 582

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 107/248 (43%), Gaps = 41/248 (16%)

Query: 4   KLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAI 63
           K  ++L    D++  L +++ +L++GS DRKI   +V    R      + +D   H + +
Sbjct: 351 KCIRTLSGHVDRVACLSWNNHVLSSGSRDRKILHRDV----RAPEPFFEQID--THSQEV 404

Query: 64  RCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENE 123
             + W  + N LA+G  D+ V ++                    +L   +L+ +E H   
Sbjct: 405 CGLKWNVNENKLASGGNDNMVYVY------------------DGTLRQPMLS-MEEHTAA 445

Query: 124 VKGIAWS-HDGALLSS--CSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPEL- 179
           VK +AWS H   +L++   + DK + IW   +  +  E  +  Q     + +++W     
Sbjct: 446 VKAMAWSPHTRGVLATGGGTADKKLKIWNISKAVKLNEVDTGSQ-----LCNMLWSKNTD 500

Query: 180 PLLASSSYDD-TIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
            ++ S  Y    + LW +Y    E  AVL GH   V         + +   + SG+ D T
Sbjct: 501 EIITSHGYSKYNLTLW-NY-PTLEPMAVLKGHSFRVLHLTL----SADGTTVVSGAGDET 554

Query: 239 VRVWRYID 246
           +R W+  D
Sbjct: 555 LRYWKLFD 562

>KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces
           cerevisiae YDR142c PAS7 peroxisomal import protein -
           peroxin singleton, start by similarity
          Length = 372

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 6/73 (8%)

Query: 21  YSHGLLATGSTDRKIKIINVTNAPRGQVS----LMDVLDDTVHKKAIRCVAWRPH-SNLL 75
           Y   ++ATG  D+ IK+ ++    R  +S     +++ +   H+ A+R V W PH SN+L
Sbjct: 238 YRPHIIATGGVDKMIKVWDLRMC-RKMLSQGHQPININEIQGHELAVRKVTWSPHHSNML 296

Query: 76  AAGSFDSTVSIWT 88
            + S+D T  +WT
Sbjct: 297 LSTSYDMTCRVWT 309

 Score = 35.8 bits (81), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 135 LLSSCSRDKSVWIWETDQ------DGEEYECISVLQEHSQDVKHVVWHPELP-LLASSSY 187
           ++++   DK + +W+          G +   I+ +Q H   V+ V W P    +L S+SY
Sbjct: 242 IIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHSNMLLSTSY 301

Query: 188 DDTIRLWKDYDDD 200
           D T R+W D  DD
Sbjct: 302 DMTCRVWTDLSDD 314

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 33/77 (42%), Gaps = 12/77 (15%)

Query: 230 LCSGSDDSTVRVWRYIDDDEDG--------QQEWICEAILPKVHDRQIYSVSWS---TNG 278
           L S S D T RVW  + DD  G             C  I  + H   ++   WS   T G
Sbjct: 296 LLSTSYDMTCRVWTDLSDDGHGLTGKTNSIDPAHGCRFIFME-HSEFVFGADWSLWGTPG 354

Query: 279 LIASTGSDGTLAVYKEV 295
            +ASTG DG + ++  +
Sbjct: 355 FVASTGWDGQVCIWNGI 371

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           +E H  EV G+ W+ D   L+S   D  V+++    DG   +    L EH+  VK + W 
Sbjct: 370 VETHTQEVCGLKWNTDENRLASGGNDNVVYVY----DGTSRKPTLKLAEHTAAVKAIAWS 425

Query: 177 P 177
           P
Sbjct: 426 P 426

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 59/256 (23%), Positives = 102/256 (39%), Gaps = 41/256 (16%)

Query: 4   KLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAI 63
           K  ++L    D++  L +++ +L +GS DRKI   +V   P      ++      H + +
Sbjct: 324 KCIRTLSGHMDRVACLSWNNHILTSGSRDRKILHRDV-RMPEPYFEQVE-----THTQEV 377

Query: 64  RCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENE 123
             + W    N LA+G  D+ V ++                    +     L + E H   
Sbjct: 378 CGLKWNTDENRLASGGNDNVVYVY------------------DGTSRKPTLKLAE-HTAA 418

Query: 124 VKGIAWS-HDGALLSS--CSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPEL- 179
           VK IAWS H   +L++   + DK + IW  +   +  +      +    V +++W     
Sbjct: 419 VKAIAWSPHKRGILATGGGTADKKMKIWNVNTSTKLRDI-----DTGSQVCNMIWSKNTN 473

Query: 180 PLLASSSYDD-TIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
            L+ S  Y    + LW DY    E  A+L GH   V         + +   + SG+ D T
Sbjct: 474 ELVTSHGYSRYNLTLW-DY-PSMEPVAILKGHSFRVLHLTL----SADGTTVVSGAGDET 527

Query: 239 VRVWRYIDDDEDGQQE 254
           +R W+  D  +   Q 
Sbjct: 528 LRYWKLFDRPKPKAQP 543

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 78/201 (38%), Gaps = 43/201 (21%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H   +  + W P    +A+ S D TV +  R                    ++ LL  + 
Sbjct: 54  HAAGVSQICWSPDGKCIASCSDDFTVVVTHR--------------------QLGLLHRLV 93

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV-VWHP 177
           GH   V  + +++ G LL + S D+S+ +W    D      +  +  HS+ V  + +   
Sbjct: 94  GHTAPVISLCYNNKGNLLFTSSMDESIKVW----DVLTGTVMKTMSAHSEPVVSIDLSDN 149

Query: 178 ELPLLASSSYDDTIRLWK----------DYDDDWECAAVLNGHEGTVWCSDFEKGKNGES 227
           +  +L+S S+D  IR++            YD DW+         G V  +  +   N + 
Sbjct: 150 DGSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQ------SETGVVPIAKVKFSANTK- 202

Query: 228 IRLCSGSDDSTVRVWRYIDDD 248
             L   S D  V++W  +  D
Sbjct: 203 -YLLVKSYDGVVKIWDSVSGD 222

>AER280C [2782] [Homologous to ScYML102W (CAC2) - SH]
           (1148956..1150488) [1533 bp, 510 aa]
          Length = 510

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/208 (21%), Positives = 86/208 (41%), Gaps = 22/208 (10%)

Query: 6   AKSLKL---QNDKLWSLDYSHGL--------LATGSTDRKIKI--INVTNAPRGQVSLMD 52
           A SL++   ++  ++S+ +   L        L T   D K ++  +N  +   G+V  +D
Sbjct: 3   ASSLQIYWHESQPIYSISFQPSLPGSSGAPRLVTAGGDNKARVWQLNFDSERPGKVDSID 62

Query: 53  VLDD-TVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNS--- 108
            L   T H++A+    + P  ++LA    D  + +W +                      
Sbjct: 63  FLSSLTQHEQAVNVARFNPSGDVLATAGDDGLLLLWKKNDTIVKEFGIDDDEFADFKESW 122

Query: 109 -LEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHS 167
            +   L  +     +E+  +AWS     + +   D  V I+    D  E  C++ + EH+
Sbjct: 123 CVVEKLRTVSTIGTSEIYDLAWSPCAKYIVTGCMDNGVRIF----DIAEKTCVAHVVEHN 178

Query: 168 QDVKHVVWHPELPLLASSSYDDTIRLWK 195
             V+ VVW P+   + S S D ++ ++K
Sbjct: 179 HYVQGVVWDPQNEYIISQSADRSVHIYK 206

>Scas_442.2*
          Length = 795

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 70/203 (34%), Gaps = 63/203 (31%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETD----QDGEEYECISVLQEHSQ 168
           + A ++GHE EV  + +  D   + SCS D  V IW+ +    ++ + + C+  L  +S 
Sbjct: 51  VFATLKGHEAEVTCVKFITDTPYMVSCSEDHHVKIWKQNPGVAREVDGWTCVQTLDHYSH 110

Query: 169 DVKHVVWHPELPLLASSSYDDTIRLW-----------------------------KDYDD 199
            V  +   P   L+A    D  + LW                             K  DD
Sbjct: 111 TVVALAVLPG--LIAVGCADGKVSLWVQKMKEDVFILGEEFEVQKGVLPLALAFSKVIDD 168

Query: 200 DWECA----------------------------AVLNGHEGTVWCSDFEKGKNGESIRLC 231
            +  A                            A L GHE  +    F   +      LC
Sbjct: 169 KYLLAVGGTNVNVFVFSFVLNATAETIETLQLAAKLEGHEDWIKSLAFRHQETPGDYLLC 228

Query: 232 SGSDDSTVRVWRYIDDDEDGQQE 254
           SGS D  +R+WR   +D   +Q+
Sbjct: 229 SGSQDRYIRLWRIRINDLMKKQD 251

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 81/189 (42%), Gaps = 8/189 (4%)

Query: 111 MDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYEC-ISVLQEHSQD 169
           +++   +  H   V  + +S D   L S  RD+   +WE D + +++       + H++ 
Sbjct: 606 LEVKPPLAFHTLTVTKLRFSPDSKYLLSVCRDRQWVVWERDPETDKFTLKYKTAKPHTRI 665

Query: 170 VKHVVWHP-ELP-LLASSSYDDTIRLWK--DYDDDWECAAVLNGHEGTVWCSDFEKGKNG 225
           +    W P E   +  + S D TI+LWK  +   +++    LN        S  +   +G
Sbjct: 666 IWDGDWAPLEFGNVFVTGSRDRTIKLWKFDENKSNFDLENSLNMTSLVTALSVXDSVLDG 725

Query: 226 ESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVH-DRQIYSVSWSTNGL-IAST 283
             + +  G +D ++ +++Y         E + + I P     R  +S S   N L +A+ 
Sbjct: 726 R-LLIAXGLEDGSIYIYKYDSTSGFDVVEVLNDLITPAEKLTRLRWSRSQRNNKLWLAAA 784

Query: 284 GSDGTLAVY 292
            SD +  +Y
Sbjct: 785 SSDTSTRIY 793

 Score = 28.5 bits (62), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 62/310 (20%), Positives = 109/310 (35%), Gaps = 42/310 (13%)

Query: 25  LLATGSTDRKIKIIN-VTNAPRGQVSLMDVLDDTV-HKKAIRCVAWR----PHSNLLAAG 78
           LLA G T+  + + + V NA    +  + +      H+  I+ +A+R    P   LL +G
Sbjct: 171 LLAVGGTNVNVFVFSFVLNATAETIETLQLAAKLEGHEDWIKSLAFRHQETPGDYLLCSG 230

Query: 79  SFDSTVSIWTR----------------XXXXXXXXXXXXXXXTTNSLE--MDLLAIIEGH 120
           S D  + +W                                  T++L   ++  A+I GH
Sbjct: 231 SQDRYIRLWRIRINDLMKKQDEDDEDIATKLALLNNKQYKFHVTDALRVCINFEALIMGH 290

Query: 121 ENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV------- 173
           ++ +  + W      L + + D ++ +WE D+    + C   L E S             
Sbjct: 291 DDWISSLQWHETRLQLLASTADTALMVWEPDEASGIWVCGLRLGELSSKGASTATGSAGG 350

Query: 174 ----VW--HPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGES 227
               +W  H     + ++    + R+W   + +  C   L     T   +D      GE 
Sbjct: 351 FWSCLWFSHQNKDYILTNGKTGSWRVWTTEEGNTLCDQELGITGATKQVTDIAWSPKGE- 409

Query: 228 IRLCSGSDDSTVRV---WRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTG 284
             L S S D T R+   W Y +D          E   P++H   +  V   +     S G
Sbjct: 410 -YLLSTSLDQTTRLFAPWIYNNDGTKRNTATWHEFSRPQIHGYDMICVEPMSGARFVSGG 468

Query: 285 SDGTLAVYKE 294
            +  L  + E
Sbjct: 469 DEKILRSFDE 478

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
           complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 109/257 (42%), Gaps = 58/257 (22%)

Query: 108 SLEMDLLAIIEGHENEVKGIAWSHDGA---LLSSCSRDKSVWIWET-------DQDGEEY 157
           +++++L A +EGHE+ +K +A+  +G    +L+S ++D+ + +W         ++D  + 
Sbjct: 202 TVDVELSATVEGHEDWIKDLAFRSNGPGDWMLASGAQDRYIRLWRIKANNNIEEEDPTKL 261

Query: 158 ECIS--------------------VLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK-- 195
           + +S                    ++  H   +  + WH     L +++ D ++ LW+  
Sbjct: 262 KLLSNKIYKFQVTADLHLSINFEALIMGHDDWISSLQWHESKCQLLAATADTSVMLWEPD 321

Query: 196 DYDDDWECAAVL-----------NGHEGTVW-CSDFEKGKNGESIRLCSGSDDSTVRVWR 243
           +    W CA+ L            G  G  W C  F  G + E I L +G   S    WR
Sbjct: 322 EISGIWVCASRLGEFSSKGASTATGSAGGFWSCLWFATG-DAEYI-LANGKTGS----WR 375

Query: 244 YIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG--LIASTGSDGTLAVYKEVSNGD-- 299
             ++  DG       AI      R +  V+WS +G  L+AS+    T    + +  GD  
Sbjct: 376 MWENRGDGGSWEQLPAITGPT--RSVTDVAWSPSGSYLLASSLDQTTRLYTRWMYEGDGS 433

Query: 300 -DEHDWEVIAKQELCHG 315
             +H W   A+ ++ HG
Sbjct: 434 RRKHTWHEFARPQI-HG 449

 Score = 35.8 bits (81), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 80/204 (39%), Gaps = 23/204 (11%)

Query: 109 LEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQ 168
           L ++  A+I GH++ +  + W      L + + D SV +WE D+    + C S L E S 
Sbjct: 279 LSINFEALIMGHDDWISSLQWHESKCQLLAATADTSVMLWEPDEISGIWVCASRLGEFSS 338

Query: 169 DVKHV-----------VWHP--ELPLLASSSYDDTIRLWKDYDD--DWECAAVLNGHEGT 213
                           +W    +   + ++    + R+W++  D   WE    + G   +
Sbjct: 339 KGASTATGSAGGFWSCLWFATGDAEYILANGKTGSWRMWENRGDGGSWEQLPAITGPTRS 398

Query: 214 VWCSDFEKGKNGESIRLCSGSDDSTVRV---WRYIDDDEDGQQEWICEAILPKVHDRQIY 270
           V  +D     +G    L + S D T R+   W Y  D    +  W  E   P++H   + 
Sbjct: 399 V--TDVAWSPSGS--YLLASSLDQTTRLYTRWMYEGDGSRRKHTW-HEFARPQIHGYDMI 453

Query: 271 SVSWSTNGLIASTGSDGTLAVYKE 294
            +   ++    S G +  L  + E
Sbjct: 454 CLEPISDTQFISAGDEKVLRSFNE 477

 Score = 28.9 bits (63), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 58/151 (38%), Gaps = 26/151 (17%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDK----------SVWIWETDQDGEEYECISVLQ-E 165
           + GH  E+  +  S DG LL+S  +            S   W       E+  +++ +  
Sbjct: 567 LYGHGYEISCVDVSPDGKLLASACKSNNTSHAVVRIFSTHTWLQLPPCPEFHNLTITRLR 626

Query: 166 HSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAV--LNGHEGTVWCSDFEKGK 223
            S+D +H         L S S D    +W   DDD           H   +W  D+    
Sbjct: 627 FSKDNRH---------LLSVSRDRMWAVWYRNDDDTFTLKYSDQKPHSRIIWDGDWLPAS 677

Query: 224 NGESIRLCSGSDDSTVRVWRYIDDDEDGQQE 254
            G +    + S D TV++WR   D ++G+ E
Sbjct: 678 CGTA--FVTASRDKTVKIWRL--DGQEGRFE 704

 Score = 28.9 bits (63), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 51/107 (47%), Gaps = 27/107 (25%)

Query: 202 ECAAV---LNGHEGTVWCSDFEKGKNGE--SIR-------LCSGSDDSTVRVWRYIDDDE 249
           +C A+   L+ H   V+C+   K  N E  S++       L S S D+T+ VWR      
Sbjct: 56  KCIALWNPLDEHNAGVYCT--LKAHNAEVTSVKFIGAEKLLVSASADATINVWR------ 107

Query: 250 DGQQEWICEAIL--PKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKE 294
            G + W     L  PK     + S++ +  GLI +  +DGTL+V+ E
Sbjct: 108 -GDERWELAQTLEGPK---SSVTSLAVAA-GLIVAGFADGTLSVWSE 149

>Kwal_26.8628
          Length = 422

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 53/251 (21%), Positives = 103/251 (41%), Gaps = 38/251 (15%)

Query: 105 TTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQ 164
           T  S+ +     + GH N++   AWS D   + S S+D  + +W+     ++    + + 
Sbjct: 70  TKGSVNLSSHLTLNGHNNKISDFAWSSDSRSILSASQDGFMIVWDASLGFKK----NAIP 125

Query: 165 EHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDD---WECAAVLNGHEGTVWCSDFEK 221
             SQ V     +    L+AS+   ++  +++   ++    +  ++  GH  T + S  E 
Sbjct: 126 LDSQWVLTCAINSSGNLVASAGLTNSCTIYRISQENRVQQQIVSMFKGH--TCYVSQVEF 183

Query: 222 GKNGESIRLCSGSDDSTVRVW-----RYIDDDEDGQQEWICEAILPKVHDRQIYSVSWST 276
            +N   I   + S D T  +W     + I +  D   + +  A LP  H +       ++
Sbjct: 184 FENNSII---TASGDMTCALWDIPKAKRIAEFSDHLGDVLALA-LPPPHAQ-------TS 232

Query: 277 NGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQEL-CHGVYEANIVKWIDINGNMMLAT 335
           + + AS GSDG + +            W+  A+       V E++I      N    + T
Sbjct: 233 SPIFASGGSDGYVYI------------WDTRARAAAQSFFVSESDISTLKFFNNGYAIVT 280

Query: 336 GGDDGCVNLWN 346
           G DDG   +++
Sbjct: 281 GADDGVARMFD 291

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 129 WSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYD 188
           +S  G L+ +C  D    IW+T       E +  L+ HS  +  V   P+   + + S+D
Sbjct: 356 FSGSGRLMHACYTDYGCVIWDT----LRAEIVGKLEGHSSRISGVKTSPDGMAVCTGSWD 411

Query: 189 DTIRLW 194
            T++LW
Sbjct: 412 ATLKLW 417

>Kwal_33.15136
          Length = 473

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 15/91 (16%)

Query: 158 ECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCS 217
             + V ++H   V  V + P    + + SYD TIR+++          V +GH   ++ +
Sbjct: 291 RALHVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIYQ----------VKHGHSREIYHT 340

Query: 218 D-----FEKGKNGESIRLCSGSDDSTVRVWR 243
                 F+     +S  + SGSDD  VR+WR
Sbjct: 341 KRMQHVFQVKYTMDSRYIVSGSDDGNVRMWR 371

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 60/137 (43%), Gaps = 12/137 (8%)

Query: 109 LEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQ 168
           L +  +  ++GH N++  + WS D A + S S+D  + IW+    G +   I +L   SQ
Sbjct: 74  LNLQPVRTLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDPFT-GLKKSAIPLL---SQ 129

Query: 169 DVKHVVWHPELPLLASSSYDD---TIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNG 225
            V      P   L+AS+  D+     R+ +D        ++  GH   +  ++F   +  
Sbjct: 130 WVLSSAISPSGNLVASAGLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISATEFLDERT- 188

Query: 226 ESIRLCSGSDDSTVRVW 242
               + + S D T  +W
Sbjct: 189 ----ILTASGDMTCAMW 201

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 15/91 (16%)

Query: 158 ECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCS 217
           + + V ++H   V  V + P    + + SYD TIR+++          V +GH   ++ +
Sbjct: 289 KALHVFKDHVSAVMDVDFSPTGDEVVTGSYDKTIRIYQ----------VKHGHSREIYHT 338

Query: 218 D-----FEKGKNGESIRLCSGSDDSTVRVWR 243
                 F+     +S  + SGSDD  VR+WR
Sbjct: 339 KRMQHIFQVKYTMDSKYIVSGSDDGNVRLWR 369

>Kwal_26.8975
          Length = 445

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 82/201 (40%), Gaps = 39/201 (19%)

Query: 114 LAIIEGHENEVKGIAWSH-DGALLSSCSRDKSVWIWE------TDQDGEEYECISVLQEH 166
           LA++E H   V+ + +   D  +  S S+D ++  W+       D     Y  +S+ Q  
Sbjct: 266 LALLESHTAPVEEVLFDFADKTVGYSVSQDHTIKTWDLVTARCVDTKSTSYSLLSLAQ-- 323

Query: 167 SQDVKHVVWHPELPLLA--SSSYDDTIRLWKDYDDDWECAAVLNGHEGTV----WCSDFE 220
                     P+L LLA  SS+   T+   +           LNGH+  V     C + E
Sbjct: 324 ---------LPQLNLLACGSSARHITLHDPRVGSSTKITQQQLNGHKNFVVALDTCPEME 374

Query: 221 KGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWIC-EAILPKVHDRQIYSVSWSTNGL 279
                    LCSGS D TV+VW   D         I  EA + K  + +++ V W+    
Sbjct: 375 -------YMLCSGSHDGTVKVW---DVRSSAPMYTITREAEVVKGINDKVFDVKWAKGLG 424

Query: 280 IASTGSDGTLAVYKEVSNGDD 300
           I S G D  +    +++ GDD
Sbjct: 425 IISGGQDKKI----QINKGDD 441

 Score = 35.0 bits (79), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 17/110 (15%)

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           + S SYD  +R W   +   +      GH G V    +       S RL SG++D T+R+
Sbjct: 115 IVSGSYDGIVRTW---NLSGKVEKQYAGHSGAVRAVKYI-----SSTRLVSGANDRTLRL 166

Query: 242 WRYIDD--------DEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIAST 283
           W+  +D        +ED  +E    AIL + H   + +V  S + +I+ +
Sbjct: 167 WKTKNDELKNNLAAEEDDVEEGKTLAIL-EAHKAPVVTVDVSGDRIISGS 215

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 162 VLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEK 221
           +L  H + +  V ++ E  L+ +S  D+   +W  Y  + E    L GH G++W  D ++
Sbjct: 5   MLMGHERSLTQVKYNREGDLIFTSGKDNVASVW--YAMNGERLGTLEGHNGSIWSIDVDQ 62

Query: 222 GKNGESIRLCSGSDDSTVRVWRYID 246
                +    +GS D +V+VWR  D
Sbjct: 63  ----HTEYAVTGSADFSVKVWRVRD 83

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 79/194 (40%), Gaps = 44/194 (22%)

Query: 59  HKKAIRCVAWRPHS-NLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
           HK     + + P + +LL +G  D+ + +W                      E +LL   
Sbjct: 134 HKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYH------------------ERELLRTY 175

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQD--------GEEYECISVLQEHSQD 169
           EGH   +K + ++ +G   +S S DK V IW T++              CI+    H +D
Sbjct: 176 EGHSMTIKDLNFTDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITF---HPKD 232

Query: 170 VKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWC-SDFEKGKNGESI 228
              +V    + L  S      +RL +++ +        + H+G++     F  GK     
Sbjct: 233 KNQLV----VGLSNSEIRHYDLRLSENHGE----VQKYDHHQGSILALKYFPDGK----- 279

Query: 229 RLCSGSDDSTVRVW 242
           +L S S+D TVR+W
Sbjct: 280 KLISSSEDKTVRIW 293

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 50/124 (40%), Gaps = 6/124 (4%)

Query: 120 HENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPEL 179
           H+  +  + +  DG  L S S DK+V IWE ++     + IS   +HS  +  +  +P+ 
Sbjct: 265 HQGSILALKYFPDGKKLISSSEDKTVRIWE-NRINIPIKQISGTAQHS--MPWIDINPQG 321

Query: 180 PLLASSSYDDTIRLWKDYDD-DWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
               + S D+TI  +               GH  T +   F    +G+ I   SG     
Sbjct: 322 QSFCTQSMDNTIYTYSMLPKYKRHPNKTFKGHNTTGYGIHFAFSPDGQYI--ASGDSKGQ 379

Query: 239 VRVW 242
             +W
Sbjct: 380 TFIW 383

>Kwal_55.21450
          Length = 503

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 63/162 (38%), Gaps = 29/162 (17%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIW------TRXXXXXXXXXXXXXXXTTNSLEM- 111
           H KA+R +++    +   + SFD  + IW       R                +NS E  
Sbjct: 253 HSKAVRGISFNSEGSEFLSVSFDQQIKIWDTETGKVRHQYSYSCIPNCAEFRPSNSNEFI 312

Query: 112 -------------------DLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQ 152
                               L+ + + H + +  + +  DG+   S S DKS+ IWE +Q
Sbjct: 313 VGLSNSEIRHYDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWE-NQ 371

Query: 153 DGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
                + IS   ++S  + ++  HPE    A+ S D+ I  +
Sbjct: 372 INIPIKQISDTSQYS--MPYIGIHPEQNYFAAQSMDNAIYAF 411

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 54/130 (41%), Gaps = 11/130 (8%)

Query: 109 LEMDLLAIIEGHENEVKGIAW-SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHS 167
           L   L+    GH+N    I      G L  S   D  V IW+  +D    E +   + HS
Sbjct: 198 LPKKLIHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRD---RELLRDYRGHS 254

Query: 168 QDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVW--CSDFEKGKNG 225
           + V+ + ++ E     S S+D  I++W     D E   V + +  +    C++F    + 
Sbjct: 255 KAVRGISFNSEGSEFLSVSFDQQIKIW-----DTETGKVRHQYSYSCIPNCAEFRPSNSN 309

Query: 226 ESIRLCSGSD 235
           E I   S S+
Sbjct: 310 EFIVGLSNSE 319

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 101/238 (42%), Gaps = 36/238 (15%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           ++GH N++    WS D   + S S+D  + IW+    G +   I +    SQ V      
Sbjct: 84  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWD-PMSGLKKNAIPL---DSQWVLACAIS 139

Query: 177 PELPLLASSSYDDTIRLWKDYDDD---WECAAVLNGHEGTVWCSDFEKGKNGESIRLCSG 233
           P   L+AS    +   +++   ++    +  ++  GH  T + SD E   N ESI   SG
Sbjct: 140 PSRNLVASGGLSNNCTIYRISQENRTQQKIVSIFKGH--TCYVSDLE-FINNESILTASG 196

Query: 234 SDDSTVRVW-----RYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGT 288
             D T  +W     + + +  D   + +  ++ P        + + S + + AS GSDG 
Sbjct: 197 --DMTCALWDIPKSKRVSEYSDHLGDVLTLSVPP--------AGTTSYDSMFASGGSDGY 246

Query: 289 LAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWN 346
           + ++   S           + Q       + + V++   +GN ++ TG DDG   L++
Sbjct: 247 VYLWDTRSPS---------SVQNFFVSDSDISTVRFFS-DGNSII-TGSDDGIARLFD 293

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 129 WSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYD 188
           +S  G LL +C  +    +W+T +     E +  L+ HS  +  V   P+   + + S+D
Sbjct: 360 FSISGRLLYACYTEYGCIVWDTLRG----EIVGRLEGHSSRISGVRTSPDGMCVCTGSWD 415

Query: 189 DTIRLW 194
            T++LW
Sbjct: 416 STMKLW 421

>Scas_558.3
          Length = 725

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 80/199 (40%), Gaps = 32/199 (16%)

Query: 65  CVAWRPHSNLLAAGSFDSTVSIW------------------TRXXXXXXXXXXXXXXXTT 106
           C     H + + +GS+D+T  +W                   +                T
Sbjct: 106 CALSYKHMSAIISGSWDTTAKVWINGALQWSLEGHQASVWDAKIISVEENTFITASADRT 165

Query: 107 NSL--EMDLLAIIEG-HENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVL 163
             L  E  LL    G H + ++ I     G  +++CS D ++ I  +D DG   +   VL
Sbjct: 166 VKLWKENKLLKTFSGIHSDVIRNIEVLSSGKEIATCSNDGTIKI--SDLDGNIKQ---VL 220

Query: 164 QEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGK 223
             H   V +V    +   L S   D ++R+W D ++++    V+     ++WC D     
Sbjct: 221 SGHESFVYNVKLSKQGDKLVSCGEDRSLRIW-DINNNFNIKQVIKLPAVSIWCVD--TLP 277

Query: 224 NGESIRLCSGSDDSTVRVW 242
           NG+ +  CS   D+TVR++
Sbjct: 278 NGDIVVGCS---DNTVRIF 293

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 157 YECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDD 199
           Y+  + L  H+QDVK +V   +   +AS S D T+RLWK  D+
Sbjct: 2   YQLSATLLGHTQDVKDIVVIDD-SQVASVSRDGTLRLWKHNDN 43

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 78/185 (42%), Gaps = 20/185 (10%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           L A + GH  +VK I    D  + +S SRD ++ +W+ + +G   + +    E  + +  
Sbjct: 4   LSATLLGHTQDVKDIVVIDDSQV-ASVSRDGTLRLWKHNDNGTWQDIVMATSE--KFLNA 60

Query: 173 VVWHPELPLLASSSYDDTIR---LWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIR 229
           V +  +  LL  S  +  I    L      D +    L GH   V    ++         
Sbjct: 61  VCYDKDHELLFYSGQESLINGVSLLDIESIDKDPLYTLIGHHSNVCALSYKHMS-----A 115

Query: 230 LCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTL 289
           + SGS D+T +VW       +G  +W  E     V D +I SV  +T     +  +D T+
Sbjct: 116 IISGSWDTTAKVWI------NGALQWSLEGHQASVWDAKIISVEENT---FITASADRTV 166

Query: 290 AVYKE 294
            ++KE
Sbjct: 167 KLWKE 171

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 4/84 (4%)

Query: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182
           E+  I+W+  G  ++  S D +V ++  DQ     + +  + EH+  V+ +VW P+   +
Sbjct: 137 EIYDISWNPQGTCIAIASLDNTVRVFNVDQG----KVVGHITEHNHYVQGIVWDPQGEFI 192

Query: 183 ASSSYDDTIRLWKDYDDDWECAAV 206
            S S D ++ + K   +D E   +
Sbjct: 193 VSQSADRSLAICKMIYEDNEVKGL 216

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 34/82 (41%), Gaps = 19/82 (23%)

Query: 66  VAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVK 125
           ++W P    +A  S D+TV ++                   N  +  ++  I  H + V+
Sbjct: 141 ISWNPQGTCIAIASLDNTVRVF-------------------NVDQGKVVGHITEHNHYVQ 181

Query: 126 GIAWSHDGALLSSCSRDKSVWI 147
           GI W   G  + S S D+S+ I
Sbjct: 182 GIVWDPQGEFIVSQSADRSLAI 203

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 224 NGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIAS 282
           N  + RL +   D+ +RVW+  + + DG+ E I        H++ +    ++  G  +A+
Sbjct: 29  NQNTRRLFTSGGDNKIRVWQLNESENDGKIETIDFLSSLTQHEQAVNVCRFNKQGDTLAT 88

Query: 283 TGSDGTLAVYKE 294
            G DG L ++K+
Sbjct: 89  AGDDGLLLLWKK 100

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 41/87 (47%), Gaps = 4/87 (4%)

Query: 109 LEMDLLAIIEGHENEVKGIAW-SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHS 167
           L   ++    GH      + +    G L+ S   D ++ IW+   D   YEC+   Q H+
Sbjct: 150 LPKKVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHD---YECLRDFQGHN 206

Query: 168 QDVKHVVWHPELPLLASSSYDDTIRLW 194
           + +K + +  +     SSS+D ++++W
Sbjct: 207 KPIKALRFTEDCQSFLSSSFDRSVKIW 233

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 70/213 (32%), Gaps = 36/213 (16%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIW------TRXXXXXXXXXXXXXXXTTNSLEM- 111
           H K I+ + +        + SFD +V IW       +                TN  E  
Sbjct: 205 HNKPIKALRFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFI 264

Query: 112 -------------------DLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQ 152
                               L+   + H + +  + +  DG+   S S DK+V IWE +Q
Sbjct: 265 VGLSNSKILHYDDRVSENQGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWE-NQ 323

Query: 153 DGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTI---RLWKDYDDDWECAAVLNG 209
                + IS   +HS    +V  HP      + S D+ I    L   Y        +  G
Sbjct: 324 INVPIKQISDTAQHSMPFLNV--HPSQNYFCAQSMDNRIYSFSLKPKY--KRHPKKIFKG 379

Query: 210 HEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
           H    +        +G  I  CSG   S +  W
Sbjct: 380 HSSAGYGISLAFSGDGRYI--CSGDSKSRLFTW 410

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 16/84 (19%)

Query: 170 VKHVVWHPE-------LP----LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSD 218
           +++   HPE       LP    L+ S   D TI++W D+  D+EC     GH   +    
Sbjct: 155 IRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIW-DFYHDYECLRDFQGHNKPIKALR 213

Query: 219 FEKGKNGESIRLCSGSDDSTVRVW 242
           F +    +     S S D +V++W
Sbjct: 214 FTE----DCQSFLSSSFDRSVKIW 233

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 86/236 (36%), Gaps = 46/236 (19%)

Query: 59  HKKAIRCVAWRPHS-NLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
           H +    + + P + +L+ +G  D T+ IW                      + + L   
Sbjct: 161 HPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYH------------------DYECLRDF 202

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           +GH   +K + ++ D     S S D+SV IW+T+    + +    L     DV+    +P
Sbjct: 203 QGHNKPIKALRFTEDCQSFLSSSFDRSVKIWDTETG--KVKTRLHLNSTPADVESRPTNP 260

Query: 178 ELPLLASSS-----YDDTIR----LWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESI 228
              ++  S+     YDD +     L + YD        L           F  G      
Sbjct: 261 HEFIVGLSNSKILHYDDRVSENQGLVQTYDHHLSSILALKY---------FPDGS----- 306

Query: 229 RLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILP--KVHDRQIYSVSWSTNGLIAS 282
           +  S S+D TVR+W    +    Q     +  +P   VH  Q Y  + S +  I S
Sbjct: 307 KFISSSEDKTVRIWENQINVPIKQISDTAQHSMPFLNVHPSQNYFCAQSMDNRIYS 362

>Scas_693.36
          Length = 375

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 58/136 (42%), Gaps = 13/136 (9%)

Query: 21  YSHGLLATGSTDRKIKI--INVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPH-SNLLAA 77
           Y   +LAT   D  I+I    +  A    + + ++++   H  A+R V W PH S++L +
Sbjct: 240 YRPNVLATAGVDNSIRIWDFRMLVARDAAICINEIVN--AHDLAVRKVVWSPHHSDILLS 297

Query: 78  GSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMD---LLAIIEGHENEVKGIAWSHDG- 133
            S+D +  IW                  TNSL+        I+  H   V G  WS  G 
Sbjct: 298 TSYDMSCKIWN---DLSYDPIQQRKTGKTNSLDFTGNGCRFIMNQHTEFVFGADWSMWGQ 354

Query: 134 -ALLSSCSRDKSVWIW 148
              ++S   D +V+IW
Sbjct: 355 PGYVASTGWDGNVFIW 370

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 64/164 (39%), Gaps = 45/164 (27%)

Query: 135 LLSSCSRDKSVWIWETDQ--DGEEYECIS-VLQEHSQDVKHVVWHPELP-LLASSSYDDT 190
           +L++   D S+ IW+       +   CI+ ++  H   V+ VVW P    +L S+SYD +
Sbjct: 244 VLATAGVDNSIRIWDFRMLVARDAAICINEIVNAHDLAVRKVVWSPHHSDILLSTSYDMS 303

Query: 191 IRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDED 250
            ++W D   D                   ++ K G++      S D T    R+I +   
Sbjct: 304 CKIWNDLSYD-----------------PIQQRKTGKT-----NSLDFTGNGCRFIMNQ-- 339

Query: 251 GQQEWICEAILPKVHDRQIYSVSWST---NGLIASTGSDGTLAV 291
                         H   ++   WS     G +ASTG DG + +
Sbjct: 340 --------------HTEFVFGADWSMWGQPGYVASTGWDGNVFI 369

>AFL022W [3171] [Homologous to ScYBR234C (ARC40) - SH]
           complement(397359..398474) [1116 bp, 371 aa]
          Length = 371

 Score = 36.2 bits (82), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 73/192 (38%), Gaps = 56/192 (29%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           L+AI+  H+  V  +  S  G +++ CS+D++  +WE   DG  Y+   VL   ++    
Sbjct: 47  LVAILADHDKTVTAVDISIHGRIVT-CSQDRNAIVWEPLSDG-SYKPTLVLLRINRAATC 104

Query: 173 VVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCS 232
           V W P                              NG++       F  G +   I +C 
Sbjct: 105 VSWAP------------------------------NGYK-------FAVGSSARIISVC- 126

Query: 233 GSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG-LIASTGSDGTLAV 291
                      Y + D D    W     + K     I ++SW  NG L+A+ G+DG L V
Sbjct: 127 -----------YYEHDND----WWVSKHIKKPIKSTINALSWHENGVLLAAGGTDGYLRV 171

Query: 292 YKEVSNGDDEHD 303
           +     G D+ +
Sbjct: 172 FSGYIKGLDQKE 183

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 97/250 (38%), Gaps = 80/250 (32%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETD---------QDGEEY---EC- 159
           L A ++GHE +VK +   +D  + +SCSRD +V +W  +          + E++    C 
Sbjct: 4   LSADLKGHEQDVKSVVAINDSQV-ASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLCY 62

Query: 160 ------------------ISVLQEHSQD-VKHVVWHP--------ELPLLASSSYDDTIR 192
                             IS L    +D V  ++ H         +   + SSS+D T +
Sbjct: 63  DKSSQLLFYGGQDTLVGGISPLATTDEDPVYMLIGHKGNVCSLSSKNNFVISSSWDKTAK 122

Query: 193 LWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW---------- 242
           +W +    ++    L GH  +VW + F   K+       + S D T+++W          
Sbjct: 123 VWHNGSAIYD----LVGHSASVWDAKFLPEKD----FFLTASADCTIKLWHGNKLIKTFS 174

Query: 243 -------RYIDDDEDGQQEWICEA------------ILPKV--HDRQIYSVSWSTNGLIA 281
                  R++D   DG+    C              IL     H+  +YSV +  NG + 
Sbjct: 175 GIHKDVIRHLDISPDGETFASCSNDGTVKINDMDGNILKTFTGHESFVYSVKFLPNGDLV 234

Query: 282 STGSDGTLAV 291
           S G D ++ V
Sbjct: 235 SCGEDRSVRV 244

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 21/91 (23%)

Query: 58  VHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
           +HK  IR +   P     A+ S D TV I                    N ++ ++L   
Sbjct: 176 IHKDVIRHLDISPDGETFASCSNDGTVKI--------------------NDMDGNILKTF 215

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIW 148
            GHE+ V  + +  +G L+ SC  D+SV +W
Sbjct: 216 TGHESFVYSVKFLPNGDLV-SCGEDRSVRVW 245

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 157 YECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDW 201
           Y+  + L+ H QDVK VV   +   +AS S D T+R+W + D  W
Sbjct: 2   YKLSADLKGHEQDVKSVVAIND-SQVASCSRDGTVRVWSNNDGVW 45

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 36.2 bits (82), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 92/265 (34%), Gaps = 48/265 (18%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMD------ 112
           H K I+ + +   S+   +GS+D  V IW                 T NS E        
Sbjct: 191 HSKPIKTLDFTSDSSQFLSGSYDQQVKIW--DTETGKVTKRLNTYSTPNSAEFRPTSGNE 248

Query: 113 ----------------------LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWET 150
                                 L+ + + H + +  I +  DG+   S S DK++ IW  
Sbjct: 249 FVVGLSSSKIKHYDTRVSEKDGLVQVYDHHLSSILAIKYFPDGSKFISSSEDKTLRIW-N 307

Query: 151 DQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDD-DWECAAVLNG 209
           +Q     + IS   +HS  + ++  HPE    ++ S D  I  +               G
Sbjct: 308 NQVNIPIKQISDTTQHS--MPYIGIHPEHNYFSTQSMDSVIYSYSMKPKYKMHPNKKFKG 365

Query: 210 HEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQI 269
           H    +        +G    LCSG     + +W +           +C+  LP      I
Sbjct: 366 HNSAGYGIGLTFSPDGRF--LCSGDARGQLFLWDW------NTNRKLCDLKLPT--KSPI 415

Query: 270 YSVSW---STNGLIASTGSDGTLAV 291
             VSW    T+ +I S G DG + V
Sbjct: 416 TQVSWHPKETSKVICS-GPDGRIFV 439

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 5/62 (8%)

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240
           L+ S   D+T++LW D+  D +C     GH   +   DF      +S +  SGS D  V+
Sbjct: 163 LILSGGNDNTVKLW-DFYHDRKCLRDFVGHSKPIKTLDF----TSDSSQFLSGSYDQQVK 217

Query: 241 VW 242
           +W
Sbjct: 218 IW 219

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 38/87 (43%), Gaps = 4/87 (4%)

Query: 109 LEMDLLAIIEGHENEVKGIAW-SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHS 167
           L   ++   +GH N    +      G L+ S   D +V +W+   D    +C+     HS
Sbjct: 136 LPKKVIYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHD---RKCLRDFVGHS 192

Query: 168 QDVKHVVWHPELPLLASSSYDDTIRLW 194
           + +K + +  +     S SYD  +++W
Sbjct: 193 KPIKTLDFTSDSSQFLSGSYDQQVKIW 219

>KLLA0C07513g complement(656060..657379) similar to sp|P39946
           Saccharomyces cerevisiae YOR269w PAC1 singleton, start
           by similarity
          Length = 439

 Score = 36.2 bits (82), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 40/82 (48%), Gaps = 8/82 (9%)

Query: 114 LAIIEGHENEVKGIAWSHDGA--LLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVK 171
           +  + GHE+ V    +   GA  LL++CSRD  + IW    D     CI   Q H+Q ++
Sbjct: 194 IKTLAGHEHTVSDCQFFERGADLLLATCSRDLYLKIW----DISNGWCIKSFQPHTQWIR 249

Query: 172 HVVWHPELPLLASSSYDDTIRL 193
            +  H E  L  S+  D  IRL
Sbjct: 250 SLHVHGEFVLTGSN--DSAIRL 269

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 91/241 (37%), Gaps = 46/241 (19%)

Query: 134 ALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELP--LLASSSYDDTI 191
           A L++ S+D +  IWE + D      I  L  H   V    +       LLA+ S D  +
Sbjct: 169 AYLATTSKDLNTKIWELELDS-TLSHIKTLAGHEHTVSDCQFFERGADLLLATCSRDLYL 227

Query: 192 RLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDG 251
           ++W D  + W C      H  T W        +GE +   +GS+DS +R+  +   +   
Sbjct: 228 KIW-DISNGW-CIKSFQPH--TQWIRSLH--VHGEFV--LTGSNDSAIRLTHWPSGNGLS 279

Query: 252 Q---QEWICEAILPKVHDRQIYSVSWSTNGL--IASTGSDGTLAVYKEVSNGDDEHDWEV 306
                ++  E +L  + D Q     +   G   +AS   DGT+ +            W+V
Sbjct: 280 MGIGHDFPVEKVLILIPDPQHLQPQYQPLGFQHVASASRDGTIRL------------WKV 327

Query: 307 IAKQELCHGVYEAN--------IVKWIDING--------NMMLATGGDDGCVNLW--NWT 348
              + + H     N        I    D N         N ML +  DDG V  W  +WT
Sbjct: 328 SLPKFIPHRPPRPNPLDTTFKVIAVLTDHNSWVRDLRQFNDMLFSCSDDGSVKCWSLDWT 387

Query: 349 D 349
           +
Sbjct: 388 N 388

>CAGL0D05588g 533235..534668 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1, start by
           similarity
          Length = 477

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 15/91 (16%)

Query: 158 ECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCS 217
             ++V ++H   V  V   P    + ++SYD TIR++           +  GH   ++ +
Sbjct: 293 RALNVFKDHVSAVMDVDISPTGEEVVTASYDKTIRIF----------PINKGHSREIYHT 342

Query: 218 D-----FEKGKNGESIRLCSGSDDSTVRVWR 243
                 F+   + +S  + SGSDD  VR+WR
Sbjct: 343 KRMQHVFQAKFSMDSKYVMSGSDDGNVRLWR 373

>YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anaphase
           promoting complex (APC), required for microtubule
           function at mitosis and for exit from anaphase, contains
           WD (WD-40) repeats [1833 bp, 610 aa]
          Length = 610

 Score = 36.2 bits (82), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 7/78 (8%)

Query: 120 HENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPEL 179
           H  EV G+++  DG  L+S   D +V IW+T     ++      + H+  VK + W P  
Sbjct: 384 HTGEVCGLSYKSDGLQLASGGNDNTVMIWDTRTSLPQFS----KKTHTAAVKALSWCPYS 439

Query: 180 P-LLAS--SSYDDTIRLW 194
           P +LAS     D  I  W
Sbjct: 440 PNILASGGGQTDKHIHFW 457

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 58/135 (42%), Gaps = 19/135 (14%)

Query: 18  SLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAA 77
           SLD     + +GS D  ++  N++     Q S         H   IR V +   + L++A
Sbjct: 108 SLDVGSNYIYSGSYDGIVRTYNLSGKVEKQYS--------GHSGPIRAVHYISSTRLVSA 159

Query: 78  GSFDSTVSIW-TRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALL 136
           G+ D T+ +W T+                T       LAI+EGH+  V  I  S D  L 
Sbjct: 160 GN-DRTLRLWKTKNDDLKSIDEEEIEDGKT-------LAILEGHKAPVVSIDVSKDRILS 211

Query: 137 SSCSRDKSVWIWETD 151
           +SC  D +V +W T+
Sbjct: 212 ASC--DNTVSLWSTN 224

>Scas_571.4
          Length = 601

 Score = 36.2 bits (82), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 60/135 (44%), Gaps = 26/135 (19%)

Query: 59  HKKAIRCVAWRPH-SNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
           H + +  V + P   N+LA+ S D TV IW                   N  +  ++  +
Sbjct: 147 HTRKVGHVLFHPRIRNVLASSSLDFTVKIW-------------------NIKKGKVIGTL 187

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHS-QDVKHVVWH 176
           + H + V  +A+  DGA L++ +R+K + IW    D    + +S  + H     + VVW 
Sbjct: 188 Q-HSDMVTAMAFDPDGAYLATITRNKKLTIW----DIASKQIVSQTKSHQGPKNQRVVWL 242

Query: 177 PELPLLASSSYDDTI 191
               ++A++ +  ++
Sbjct: 243 GYSRIIATTGFSKSM 257

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 15/91 (16%)

Query: 158 ECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCS 217
             ++V ++H   V  V + P    + + SYD +IR++K            +GH   ++ +
Sbjct: 296 RSLNVFKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYK----------TNHGHSREIYHT 345

Query: 218 D-----FEKGKNGESIRLCSGSDDSTVRVWR 243
                 F+   + +S  + SGSDD  VR+WR
Sbjct: 346 KRMQHVFQVKYSMDSKYIISGSDDGNVRLWR 376

>YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associated
           protein essential for the G1/S transition, member of WD
           (WD-40) repeat family [1383 bp, 460 aa]
          Length = 460

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 55/145 (37%), Gaps = 36/145 (24%)

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           + S SYD  +R W   D         +GH G +    +       + RL S  +D T+R+
Sbjct: 118 IISGSYDGIVRTW---DLSGNVQKQYSGHSGPIRAVKYI-----SNTRLVSAGNDRTLRL 169

Query: 242 WRYIDDD-------------------EDGQQEWICEAILPKVHDRQIYSVSWSTNGLIAS 282
           W+  +DD                   EDG+   I E      H   + S+  S N  I S
Sbjct: 170 WKTKNDDLKLTSQQQAQEDDDDEVNIEDGKTLAILEG-----HKAPVVSIDVSDNSRILS 224

Query: 283 TGSDGTL----AVYKEVSNGDDEHD 303
              D ++     +YKE++  D   D
Sbjct: 225 ASYDNSIGFWSTIYKEMTVVDPLED 249

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 83/201 (41%), Gaps = 48/201 (23%)

Query: 114 LAIIEGHENEVKGIAW-SHDGALLSSCSRDKSVWIWE------TDQDGEEYECISVLQEH 166
           L+++E H   V+ + + S D  +  S S+D ++  W+       D     Y  +S+ Q  
Sbjct: 280 LSLLESHTAPVEQVIFDSTDNTVGYSVSQDHTIKTWDLVTARCIDTRTTSYSLLSIAQLS 339

Query: 167 SQDV-------KHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDF 219
           + ++       +H+  H   P + +SS     +L               GH+   + S  
Sbjct: 340 TLNLLACGSSARHITLHD--PRVGASSKVTQQQLI--------------GHKN--FVSSL 381

Query: 220 EKGKNGESIRLCSGSDDSTVRVW-------RYIDDDEDGQQEWICEAILPKVHDRQIYSV 272
           +     E I LCSGS D TV+VW        Y    ED       +++   V+D+ +++V
Sbjct: 382 DTCPENEYI-LCSGSHDGTVKVWDVRSTSPMYTITRED-------KSVQKGVNDK-VFAV 432

Query: 273 SWSTNGLIASTGSDGTLAVYK 293
            W+    I S G D  + + K
Sbjct: 433 KWAEKVGIISAGQDKKIQINK 453

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 6/96 (6%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIW-TRXXXXXXXXXXXXXXXTTNSLEMD---LL 114
           H   IR V +  ++ L++AG+ D T+ +W T+                 + + ++    L
Sbjct: 143 HSGPIRAVKYISNTRLVSAGN-DRTLRLWKTKNDDLKLTSQQQAQEDDDDEVNIEDGKTL 201

Query: 115 AIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWET 150
           AI+EGH+  V  I  S +  +L S S D S+  W T
Sbjct: 202 AILEGHKAPVVSIDVSDNSRIL-SASYDNSIGFWST 236

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 54/126 (42%), Gaps = 11/126 (8%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
           + GH   +  IA++    LL S S D ++ +W     G       V   HSQ +    W 
Sbjct: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR----GGNLNPSHVFYGHSQSITSAHWV 374

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDD 236
            +  ++ S+S D +IR+W    +    +A ++G        +F    + +  +  +G+ D
Sbjct: 375 DDDTII-STSMDGSIRVWSLASNSTVASATVDG------VPNFTGALSPDQGKFATGTLD 427

Query: 237 STVRVW 242
             V V+
Sbjct: 428 GEVMVY 433

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 62/283 (21%), Positives = 103/283 (36%), Gaps = 50/283 (17%)

Query: 24  GLLATGSTDRKIKIINVTNAPRG-QVSLMDVLDD--TVHKKAIRCVAWRPHSNLLAAGSF 80
           G+ A G  D +  ++  + A     +S   VL D  T  +  + C+ W P    L  G  
Sbjct: 155 GVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVE 214

Query: 81  DSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCS 140
              + +W                    S+E  L  I+  H   +  I W+ D   + +C 
Sbjct: 215 SGELRLW--------------------SVEGKLQNILSYHRAPIVCIKWNSDETHVLTCD 254

Query: 141 RDKSVWIWETDQDGEEYECISVLQEHSQDVKHV--VWHPE----LPLLASSSYDDTIRLW 194
            D    +W     G   +  S  +  +++   V   W  +    +P +  S     I + 
Sbjct: 255 ADNMTIVWNV-LSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGIS 313

Query: 195 KDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQE 254
           K           L GH  T+    +    N  +  L S SDD+T+RVWR  +        
Sbjct: 314 KPIGK-------LRGHSKTLTTIAY----NEHNKLLLSASDDNTLRVWRGGN-------- 354

Query: 255 WICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSN 297
            +  + +   H + I S  W  +  I ST  DG++ V+   SN
Sbjct: 355 -LNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASN 396

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 15/91 (16%)

Query: 158 ECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCS 217
             + V ++H   V  V + P    + + SYD TIR++           + +GH   V+ +
Sbjct: 293 RALHVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFN----------LKHGHSREVYHT 342

Query: 218 D-----FEKGKNGESIRLCSGSDDSTVRVWR 243
                 F+     +S  + SGSDD  VR+WR
Sbjct: 343 KRMQHVFQVKFTMDSKYIVSGSDDGNVRLWR 373

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           + S SYD  +R W   +   +     +GH G V    F       S RL SG +D T+R+
Sbjct: 116 IVSGSYDGVVRTW---NLSGKIEKQYSGHTGAVRAVKFI-----SSTRLVSGGNDRTLRL 167

Query: 242 WRYIDDD 248
           W+  +DD
Sbjct: 168 WKTKNDD 174

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 84/193 (43%), Gaps = 32/193 (16%)

Query: 114 LAIIEGHENEVKGIAW-SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           L+++E H+  V+ + + S+D  +  S S+D ++  W    D     C+   +  S  +  
Sbjct: 265 LSLLESHKAPVEQVIFASNDSTVAYSVSQDHTIKTW----DLVTSRCVDT-KSTSYSLLS 319

Query: 173 VVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLN-----GHEGTVWCSDFEKGKNGES 227
           +V  P+L LLA  S    I L   +D   + +A +      GH+  V   D       E 
Sbjct: 320 MVELPKLRLLACGSSARHITL---HDPRADSSAKITQQQLLGHKNFVVALD--TCPENEY 374

Query: 228 IRLCSGSDDSTVRVWR-------YIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLI 280
           + LCS S D TV+VW        Y    ED       +++   ++D+ +++V W+    I
Sbjct: 375 M-LCSASHDGTVKVWDIRSSSSIYTITRED-------QSVEKGINDK-VFAVKWAKGVGI 425

Query: 281 ASTGSDGTLAVYK 293
            S G D  +   K
Sbjct: 426 ISGGQDKKIQFNK 438

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 62/168 (36%), Gaps = 40/168 (23%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H  A+R V +   + L++ G+ D T+ +W                    + E   LAI+E
Sbjct: 141 HTGAVRAVKFISSTRLVSGGN-DRTLRLW-----KTKNDDVKHVDELEGTEEAHTLAILE 194

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETD--------------------------- 151
           GH+  V  +    D  L  S S D S+  W T+                           
Sbjct: 195 GHQAPVVSVDVQGDRIL--SASYDNSIGFWSTNHKDMTAVDPMDSLGDKASSAAKKRRKL 252

Query: 152 --QDG--EEYECISVLQEHSQDVKHVVWHPELPLLA-SSSYDDTIRLW 194
             +DG       +S+L+ H   V+ V++      +A S S D TI+ W
Sbjct: 253 TMKDGSVRRRAPLSLLESHKAPVEQVIFASNDSTVAYSVSQDHTIKTW 300

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 18/73 (24%)

Query: 182 LASSSYDDTIRLWKDYDDDWE------------CAAVLNGHEGTVWCSDFEKGKNGESIR 229
           L S   D T+RLWK  +DD +              A+L GH+  V   D +    G+  R
Sbjct: 156 LVSGGNDRTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQ----GD--R 209

Query: 230 LCSGSDDSTVRVW 242
           + S S D+++  W
Sbjct: 210 ILSASYDNSIGFW 222

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 56/135 (41%), Gaps = 33/135 (24%)

Query: 182 LASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRV 241
           + S SYD  +R W   +   +     +GH G V    +       + R+ S  +D ++R+
Sbjct: 118 IYSGSYDGVVRTW---NMSGKVEKQYSGHTGAVKAVKYI-----SNTRIVSAGNDRSLRL 169

Query: 242 WRYIDDD----------------EDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGS 285
           W+  +DD                EDG+   I E      H   + S+  ++N  I S   
Sbjct: 170 WKTKNDDGSVSNNTGDENDEENIEDGKTLAILEG-----HKAPVVSLDVASNSRILSASY 224

Query: 286 DGTLA----VYKEVS 296
           D T+A    +YKE++
Sbjct: 225 DNTVALWSTIYKEMT 239

 Score = 35.8 bits (81), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 79/193 (40%), Gaps = 32/193 (16%)

Query: 114 LAIIEGHENEVKGIAWSH-DGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           L+++E H   V+ + + H D  +  S S+D ++  W    D     CI   +  S  +  
Sbjct: 277 LSLLESHTGPVEQVIFDHGDNTVGYSVSQDHTIKTW----DLVTARCIDT-KTTSYPLLS 331

Query: 173 VVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLN-----GHEGTV----WCSDFEKGK 223
           +   P L LLA  S   ++R    +D     +A +      GH+  V     CS+ E   
Sbjct: 332 IAQMPTLNLLACGS---SVRHITLHDPRVSSSAKITQKQLVGHKNFVVGLDTCSENE--- 385

Query: 224 NGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVH---DRQIYSVSWSTNGLI 280
                 LCS S D TV+VW    D       +      P V    + ++++V W+ +  I
Sbjct: 386 ----YLLCSASHDGTVKVW----DVRSTSPMYTITRQDPTVEKGVNDKVFAVKWAKSIGI 437

Query: 281 ASTGSDGTLAVYK 293
            S G D  + + K
Sbjct: 438 ISGGQDKKIQINK 450

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 79/187 (42%), Gaps = 20/187 (10%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIW-TRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
           H  A++ V +  ++ +++AG+ D ++ +W T+                 N  +   LAI+
Sbjct: 143 HTGAVKAVKYISNTRIVSAGN-DRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAIL 201

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           EGH+  V  +  + +  +LS+ S D +V +W T    +E   I  L+E        + +P
Sbjct: 202 EGHKAPVVSLDVASNSRILSA-SYDNTVALWSTIY--KEMTAIDHLEE--------IQNP 250

Query: 178 ELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKN--GESIRLCSGSD 235
              +  ++     + L           ++L  H G V    F+ G N  G S+     S 
Sbjct: 251 NNKISTAAKKRRKLTLKDGTIRRRAPLSLLESHTGPVEQVIFDHGDNTVGYSV-----SQ 305

Query: 236 DSTVRVW 242
           D T++ W
Sbjct: 306 DHTIKTW 312

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 36.2 bits (82), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 80/204 (39%), Gaps = 43/204 (21%)

Query: 57  TVHKKAIRCVAWRP-HSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLA 115
           T H + +  V + P   N+LA+ S D TV +W                    ++E     
Sbjct: 137 TGHARKVGHVLYHPVAENVLASSSGDYTVKLW--------------------NVETGKDM 176

Query: 116 IIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHS-QDVKHVV 174
           I   H + V  +++S+DG  L++ +RDK + +W       E + +S    H+    + VV
Sbjct: 177 ITLKHPDMVTSMSFSYDGNYLATVARDKKLRVWNI----REEKIVSEGPAHTGAKNQRVV 232

Query: 175 WHPELPLLASSSY----DDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG------KN 224
           W      LA++ +    D  I +W  ++       +  G  G  +  D   G        
Sbjct: 233 WLGNSDRLATTGFSKLSDRQIGIWDAFN-------IEKGDLGGFYTVDQSSGILMPFYDE 285

Query: 225 GESIRLCSGSDDSTVRVWRYIDDD 248
           G  I    G  D  +R + + +D+
Sbjct: 286 GNKILYLVGKGDGNIRYYEFQNDE 309

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 43/96 (44%), Gaps = 12/96 (12%)

Query: 205 AVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDD-------DEDGQQEWIC 257
            +  GH   V  +DF+   +    R+ SGSDDS + +W   ++       DEDG+   I 
Sbjct: 75  PLFRGHTAQVLDTDFDPFNDH---RIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIK 131

Query: 258 EAILPKVHDRQIYSVSWST--NGLIASTGSDGTLAV 291
                  H R++  V +      ++AS+  D T+ +
Sbjct: 132 PVKFLTGHARKVGHVLYHPVAENVLASSSGDYTVKL 167

>KLLA0E08415g 759718..760986 similar to sp|P53962 Saccharomyces
           cerevisiae YNL035c singleton, start by similarity
          Length = 422

 Score = 35.8 bits (81), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 43/85 (50%), Gaps = 13/85 (15%)

Query: 11  LQNDK---LWSLDYSHGLLATGST----DRKIKIINVTNAPRGQVSLMDVLDDTVHKKAI 63
           LQNDK    +SLD  H +LA G+     D ++ I ++ N  +   S +D      H   I
Sbjct: 96  LQNDKASPFFSLDSRHNMLACGTELKDYDAELHIYDIRNWTKPVRSFVDS-----HHDDI 150

Query: 64  RCVAWRP-HSNLLAAGSFDSTVSIW 87
             + + P  SNLL +GS D  V+I+
Sbjct: 151 TDIKFHPCDSNLLMSGSTDGYVNIY 175

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 35.8 bits (81), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 80/198 (40%), Gaps = 35/198 (17%)

Query: 59  HKKAIRCVAWRPHS-NLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
           H + +  + + P + N+LA+ S D TV IW                     +  + +   
Sbjct: 151 HSRKVGHLLFHPLAENILASSSLDYTVKIW--------------------DISQEEVKFT 190

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHS-QDVKHVVWH 176
             H + V  +++S+DG  L + SRDK + +W+   +    + +S    HS    + VVW 
Sbjct: 191 LKHPDMVTSMSFSYDGKHLVTVSRDKKLRVWDVRAE----KIVSEGPAHSGAKNQRVVWL 246

Query: 177 PELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG------KNGESIRL 230
            +   +A++ +    RL       W+   +  G+ G  +  D   G       +   I  
Sbjct: 247 GDTDKVATTGFS---RLSDRQIGVWDAFNLEKGNLGGFYNVDQSSGILMPFYDDSNRILY 303

Query: 231 CSGSDDSTVRVWRYIDDD 248
            +G  D  +R + + +D+
Sbjct: 304 VAGKGDGNIRYFEFQNDE 321

>Kwal_0.212
          Length = 303

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 32/78 (41%), Gaps = 5/78 (6%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWH 176
            EGH   V  IA+  +   + S S D ++ +W+      +        +H   V  VV H
Sbjct: 71  FEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRN-----YKHQAAVNEVVIH 125

Query: 177 PELPLLASSSYDDTIRLW 194
           P    L S   D  +R+W
Sbjct: 126 PNQGELISCDQDGNVRIW 143

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 35.4 bits (80), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 75/216 (34%), Gaps = 42/216 (19%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIW--------TRXXXXXXXXXXXXXXXTTNSL- 109
           H+KAI   ++   +   A+ S+D TV IW         R                   L 
Sbjct: 217 HRKAISATSFSHDNVQFASSSYDKTVKIWDTETGDIINRLSFKATPNCMTFHPQNKEQLL 276

Query: 110 ---------EMDL--------LAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQ 152
                      DL        + I + H   +  + +  DG+   S S DKS+ IWE   
Sbjct: 277 VGFSDSKIRHFDLRVDKKDGVIQIYDHHLAAINALRYFPDGSKFISSSDDKSIRIWENQI 336

Query: 153 DGEEYECISVLQEHSQDVKHVVW---HPELPLLASSSYDDTIRLW---KDYDDDWECAAV 206
           +      I + Q    D     W   HPE    A+ S D++I ++     Y      A  
Sbjct: 337 N------IPIKQISDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYKRHPRKA-- 388

Query: 207 LNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242
             GH+   + S F+   +G  +   +G     + +W
Sbjct: 389 FRGHKSAGYNSMFDIAPDGRYV--AAGDTSGRLFIW 422

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETD 151
           GH   +   ++SHD    +S S DK+V IW+T+
Sbjct: 216 GHRKAISATSFSHDNVQFASSSYDKTVKIWDTE 248

 Score = 32.0 bits (71), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 63/149 (42%), Gaps = 20/149 (13%)

Query: 109 LEMDLLAIIEGHENEVKGIAW-SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQE-- 165
           L   +L + +GH+     + +    G L  S   D  + IW+       Y    +L++  
Sbjct: 162 LPKRILHVYDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDM------YHERLLLRDYC 215

Query: 166 -HSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLN--GHEGTVWCSDFEKG 222
            H + +    +  +    ASSSYD T+++W     D E   ++N    + T  C  F   
Sbjct: 216 GHRKAISATSFSHDNVQFASSSYDKTVKIW-----DTETGDIINRLSFKATPNCMTFHP- 269

Query: 223 KNGESIRLCSGSDDSTVRVWRYIDDDEDG 251
           +N E  +L  G  DS +R +    D +DG
Sbjct: 270 QNKE--QLLVGFSDSKIRHFDLRVDKKDG 296

>YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal
           biogenesis protein (peroxin) that serves as import
           receptor for proteins containing peroxisomal targeting
           signal 2 (PTS2), member of WD (WD-40) repeat family
           [1128 bp, 375 aa]
          Length = 375

 Score = 35.4 bits (80), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 14/81 (17%)

Query: 21  YSHGLLATGSTDRKIKI-----------INVTNAPRGQVSLMDVLDD--TVHKKAIRCVA 67
           Y   ++ATG  D  I+I             +     GQ+     +++    H  AIR V 
Sbjct: 231 YRPYVVATGGVDNAIRIWDIRMLNKNESATIKRTVPGQLHNSSCINEIPNAHGLAIRKVT 290

Query: 68  WRPH-SNLLAAGSFDSTVSIW 87
           W PH SN+L + S+D T  IW
Sbjct: 291 WSPHHSNILMSASYDMTCRIW 311

 Score = 32.7 bits (73), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 159 CIS-VLQEHSQDVKHVVWHPELP-LLASSSYDDTIRLWKDYDDD 200
           CI+ +   H   ++ V W P    +L S+SYD T R+W+D  +D
Sbjct: 274 CINEIPNAHGLAIRKVTWSPHHSNILMSASYDMTCRIWRDLSND 317

>Scas_700.27*
          Length = 433

 Score = 35.4 bits (80), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH+N +  +        + SCS D ++ +W    D    + + V+  H + V+++ +HP 
Sbjct: 246 GHKNPINKVHCLPVDPQIVSCSTDATIRLW----DIVAGKSMKVITHHKKSVRNIAFHPT 301

Query: 179 LPLLASSSYDDTIRLWK 195
              ++S S +D IR WK
Sbjct: 302 EFSMSSCSAND-IRSWK 317

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 45/109 (41%), Gaps = 11/109 (10%)

Query: 135 LLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
           L+++  RD  V +W    D      +  L  H   +  V   P  P + S S D TIRLW
Sbjct: 220 LIATAGRDSVVRLW----DIRARVAVMTLIGHKNPINKVHCLPVDPQIVSCSTDATIRLW 275

Query: 195 KDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWR 243
                  +   V+  H+ +V    F   +   S+  CS +D   +R W+
Sbjct: 276 DIVAG--KSMKVITHHKKSVRNIAFHPTE--FSMSSCSAND---IRSWK 317

>Scas_692.29
          Length = 456

 Score = 35.4 bits (80), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 2/92 (2%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H   IR V +   + L++AG+ D T+ +W                   N  +   LAI+E
Sbjct: 143 HSGPIRAVKFISDTRLVSAGN-DRTLRLWKTKNNDSVVQHFDEEDEEANIEDGKTLAILE 201

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWET 150
           GH+  V  +  S+   +LSS S D S+ +W T
Sbjct: 202 GHKAPVVSLDVSNTSRILSS-SYDNSIGLWST 232

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 59/149 (39%), Gaps = 41/149 (27%)

Query: 167 SQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGE 226
           SQD K ++         ++SYD  IR W   +   +     +GH G +    F       
Sbjct: 112 SQDKKAII---------TASYDGVIRTW---NLSGKVQKQYSGHSGPIRAVKF-----IS 154

Query: 227 SIRLCSGSDDSTVRVWRYIDDD---------------EDGQQEWICEAILPKVHDRQIYS 271
             RL S  +D T+R+W+  ++D               EDG+   I E      H   + S
Sbjct: 155 DTRLVSAGNDRTLRLWKTKNNDSVVQHFDEEDEEANIEDGKTLAILEG-----HKAPVVS 209

Query: 272 VSWSTNGLIASTGSDGTL----AVYKEVS 296
           +  S    I S+  D ++     +YKE++
Sbjct: 210 LDVSNTSRILSSSYDNSIGLWSTIYKEMT 238

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 78/191 (40%), Gaps = 28/191 (14%)

Query: 114 LAIIEGHENEVKGIAWS-HDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           L+++E H   V+  ++  +D  +  S S+D ++  W    D     CI   +  S  +  
Sbjct: 276 LSLLESHTAPVEQASFDINDDTVGYSVSQDHTIKTW----DLVTARCIDT-KTTSYSLLS 330

Query: 173 VVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHE---GTVWCSDFEKGKNGESIR 229
           +   P L LLA  S    I L   +D     ++ +  H+      +    +     E I 
Sbjct: 331 LTQLPTLNLLACGSSARHITL---HDPRMGASSKVTQHQLIGHKNFVVSLDTCPENEYI- 386

Query: 230 LCSGSDDSTVRVW-------RYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIAS 282
           LCSGS D TV+VW        Y    ED   E         V+D+ +++V W+    I S
Sbjct: 387 LCSGSHDGTVKVWDVRSTAPMYTITREDKNVE-------KGVNDK-VFAVRWAEKIGIIS 438

Query: 283 TGSDGTLAVYK 293
            G D  + + K
Sbjct: 439 GGQDKKIQINK 449

>YBR234C (ARC40) [413] chr2 complement(685395..686549) Component of
           the ARP2/3 actin-organizing complex, involved in actin
           assembly and function [1155 bp, 384 aa]
          Length = 384

 Score = 35.4 bits (80), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 86/199 (43%), Gaps = 19/199 (9%)

Query: 106 TNSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQE 165
           +N+    L A ++ H+  +  +  S  G +++ CS+D++ ++WE   DG  Y+   VL  
Sbjct: 48  SNNTPPVLFATLKDHDKTITAVDISIHGRIVT-CSQDRNAYVWEPLSDG-TYKPTLVLLR 105

Query: 166 HSQDVKHVVWHPELPLLASSSYDDTIRL-WKDYDDDWECAA-VLNGHEGTVWCSDFEKGK 223
            ++    V W P     A  S    I + + +++++W  +  +    + T+ C  +    
Sbjct: 106 INRAATSVTWAPNGYKFAVGSSARIIAVCYYEHENNWWVSKHIKKPIKSTINCLSWH--A 163

Query: 224 NGESIRLCSGSDDSTVRVW----RYIDDDED------GQQEWICEAILPKVHDRQIYSVS 273
           NG  + L +G  D  +RV+    + +D  E       GQ+      I        I+ V 
Sbjct: 164 NG--VLLAAGGTDGFMRVFSGFIKGLDSKESVAGSPWGQKFPFGCLIREWYQGSYIHDVE 221

Query: 274 W-STNGLIASTGSDGTLAV 291
           W S    IA    DGTL V
Sbjct: 222 WRSQMERIAYVAHDGTLNV 240

>Scas_659.9
          Length = 475

 Score = 35.4 bits (80), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 42/91 (46%), Gaps = 15/91 (16%)

Query: 158 ECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCS 217
             ++V ++H   V  V + P    + + SYD TIR++             +GH   ++ +
Sbjct: 290 RALNVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFN----------TTHGHSREIYHT 339

Query: 218 D-----FEKGKNGESIRLCSGSDDSTVRVWR 243
                 F+   + ++  + SGSDD  VR+WR
Sbjct: 340 KRMQHVFQVKFSMDAKYIVSGSDDGNVRLWR 370

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 35.4 bits (80), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 66/172 (38%), Gaps = 51/172 (29%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGE-----EYECISVLQEHS 167
           L A + GH  +V+ +  S     ++S SRD +V IW  D DG       +     +   +
Sbjct: 4   LSAQLRGHTQDVRSVV-SLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNSLT 62

Query: 168 QDVKHVVWH------------PELPL------------------------LASSSYDDTI 191
            D K  V              P L L                        L SSS+D T 
Sbjct: 63  YDAKQCVLFCGGQEKIIYGVSPLLALGQEPVYTLVGHEGNICSLSGDFESLVSSSWDKTA 122

Query: 192 RLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWR 243
           ++W +    WE    L GH  +VW  D +   +G    + + S D+TV++W+
Sbjct: 123 KVWTNGIVKWE----LKGHSASVW--DAKLLNDGS---VLTASADTTVKLWK 165

 Score = 32.3 bits (72), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 157 YECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWK-DYDDDWE 202
           Y+  + L+ H+QDV+ VV       +AS+S D T+R+W  D D +WE
Sbjct: 2   YQLSAQLRGHTQDVRSVV-SLSTTQVASASRDGTVRIWNLDADGNWE 47

>Kwal_34.15818
          Length = 349

 Score = 35.0 bits (79), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 85/198 (42%), Gaps = 36/198 (18%)

Query: 162 VLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEK 221
           +L+ H + +  V ++ E  L+ + + D+   +W  Y  + E      GH+GT+W  D ++
Sbjct: 5   LLKGHERSLTQVKFNREGDLIFTCAKDNVASVW--YSINGERLGTFEGHQGTIWSIDVDQ 62

Query: 222 GKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNG--- 278
                     +GS D ++++W+     +DG   +  +   P      +  V +S +G   
Sbjct: 63  FTQ----YAVTGSADFSIKLWKV----QDGTNVFTWKTKTP------VRRVQFSPSGDKI 108

Query: 279 ---LIASTGSDGTLAVY--------KEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDI 327
              L    G  G++ VY        K++ +  +E  + ++ ++    G   A +  W   
Sbjct: 109 LAVLDGVMGYPGSVTVYTVRRDPETKDIVDISEEPTFNILTRE----GFEIAAVAAW-SF 163

Query: 328 NGNMMLATGGDDGCVNLW 345
           N   ++A G  DG V+ +
Sbjct: 164 NDTYIVA-GHKDGRVSKY 180

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/80 (21%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 116 IIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW 175
           +++GHE  +  + ++ +G L+ +C++D    +W +  +GE    +   + H   +  +  
Sbjct: 5   LLKGHERSLTQVKFNREGDLIFTCAKDNVASVWYS-INGER---LGTFEGHQGTIWSIDV 60

Query: 176 HPELPLLASSSYDDTIRLWK 195
                   + S D +I+LWK
Sbjct: 61  DQFTQYAVTGSADFSIKLWK 80

>KLLA0F13750g complement(1274110..1275972) similar to sp|P46680
           Saccharomyces cerevisiae YMR092c AIP1 actin cytoskeleton
           component singleton, start by similarity
          Length = 620

 Score = 35.0 bits (79), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 100/267 (37%), Gaps = 53/267 (19%)

Query: 114 LAIIEGHENEVKGIAWSHDGALLS-SCSRDKSVWIWETDQDGEEYECISVLQEH---SQD 169
           L  + GH   V  + +     + + S S D SV  ++    G  ++  S  + H    + 
Sbjct: 148 LGEVSGHSQRVNAVHFKQSRPMRAFSVSDDGSVVFYQ----GPPFKFASSDRTHHGQGKF 203

Query: 170 VKHVVWHPELPLLASSS--------YDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEK 221
           V+ V + P     A S         +D     +  Y +  E A +  G     W  D E 
Sbjct: 204 VRDVKFSPGAGKYAVSVGSDRKICCFDGKTGEFIKYIES-EKAPIGGGLFAVAWLDDGE- 261

Query: 222 GKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIA 281
               ES R+ +   D T R+W  +  D+  QQ W   A +      QI  V  + +  I 
Sbjct: 262 ----ESSRVVTVGADCTARLWD-VSLDDPFQQSWKLGADV----SNQIVGVVVTKDNSIV 312

Query: 282 STGSDGTLAVYKEVSNGDDEHDWEVI----------AKQELCHGVYEANIVKWI------ 325
           +   DGTL++        ++H  + I          A   L  G Y+  +V W       
Sbjct: 313 TLTLDGTLSILSL-----NDHTIKFIHGHNKGITSLAVNPLVSGSYDGRVVTWNSEGDEV 367

Query: 326 -----DINGNMMLATGGDDGCVNLWNW 347
                DI+GN++LA    D  V+  +W
Sbjct: 368 NAISHDIHGNLVLAIDNSDNEVSSVSW 394

 Score = 32.0 bits (71), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 314 HGVYEANIVKWIDINGNMMLATGGDDGCVNLWNW 347
           HG     +VK+  I G+  +A+G D G V +W+W
Sbjct: 57  HGTSNVTVVKFSPIQGSQYVASGDDSGRVIVWSW 90

>CAGL0L04950g complement(562491..564908) highly similar to sp|Q04660
           Saccharomyces cerevisiae YMR049c, start by similarity
          Length = 805

 Score = 35.0 bits (79), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 13/89 (14%)

Query: 203 CAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILP 262
           C+ + +GHEG +     +       I L +GSDD +VR+W  +   E  + + + +   P
Sbjct: 428 CSTIYSGHEGKIRTLSIDPT----GIWLATGSDDGSVRIWEILTGREVYRVQLVNKEDNP 483

Query: 263 KVHDRQIYSVSWSTNGLIASTGSDGTLAV 291
              +  I+SV W+ +G +      G LAV
Sbjct: 484 ---EDNIHSVEWNPDGSV------GILAV 503

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 115 AIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQD--VKH 172
            I  GHE +++ ++    G  L++ S D SV IWE     E Y    V +E + +  +  
Sbjct: 430 TIYSGHEGKIRTLSIDPTGIWLATGSDDGSVRIWEILTGREVYRVQLVNKEDNPEDNIHS 489

Query: 173 VVWHPE 178
           V W+P+
Sbjct: 490 VEWNPD 495

>Scas_711.11
          Length = 695

 Score = 35.0 bits (79), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 14/64 (21%)

Query: 182 LASSSYDDTIRLWKDYDDDWECAAV---LNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
           LA+ + D  +RLW     D     V   L GH G++ C  F+  KN     + +GS D T
Sbjct: 552 LATGTRDGIVRLW-----DLRAGKVVRALEGHSGSITCLKFDN-KN-----IVTGSIDKT 600

Query: 239 VRVW 242
           VR+W
Sbjct: 601 VRIW 604

>Scas_652.7
          Length = 380

 Score = 34.7 bits (78), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 62/135 (45%), Gaps = 8/135 (5%)

Query: 110 EMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQD 169
           +  L+A +  H+  +  +  S  G +++ CS+D++ ++WE   DG  Y+   VL   ++ 
Sbjct: 52  QPKLVATLANHDKTITAVDISIHGRIVT-CSQDRNAYVWEPLSDG-SYKPTLVLLRINRA 109

Query: 170 VKHVVWHPELPLLASSSYDDTIRL--WKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGES 227
              V W P     A  S    I +  ++  ++ W    +    + T+ C  +   +NG  
Sbjct: 110 ATSVSWAPNGYKFAVGSSARIIAVCYYEQENNWWVSKHIKKPIKSTINCLSWH--ENG-- 165

Query: 228 IRLCSGSDDSTVRVW 242
           + L +G  D  +RV+
Sbjct: 166 VLLAAGGTDGFIRVF 180

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 56/120 (46%), Gaps = 16/120 (13%)

Query: 229 RLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGT 288
           R+ + S D    VW  + D       +    +L ++ +R   SVSW+ NG   + GS   
Sbjct: 76  RIVTCSQDRNAYVWEPLSDGS-----YKPTLVLLRI-NRAATSVSWAPNGYKFAVGSSAR 129

Query: 289 LAVYKEVSNGDDEHDWEVIA--KQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWN 346
           +     V   + E++W V    K+ +   +   N + W + NG ++LA GG DG + +++
Sbjct: 130 IIA---VCYYEQENNWWVSKHIKKPIKSTI---NCLSWHE-NG-VLLAAGGTDGFIRVFS 181

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 35.0 bits (79), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 82/210 (39%), Gaps = 41/210 (19%)

Query: 57  TVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAI 116
           T H KAI  +       ++ A +F+  +   T                ++N+ E+ L+  
Sbjct: 163 TAHSKAITSI------EVIEAHNFEEFIDSTTLVSTTSKDAQINVYDHSSNTGELKLIRS 216

Query: 117 IEGHENEVKG-IAWSHDG-ALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVV 174
              H++ V     W  D   LL+S SRD +V +W  +    +  C+     HS+ VK + 
Sbjct: 217 FNAHDSTVSSQKTWQKDNDVLLASSSRDATVKVWRVN----DSRCLQSFSPHSEWVKSID 272

Query: 175 WHPELPLLASSSYDDTIRLWKDYDDDWECA---AVLNGHEGTV------------WCSDF 219
              E  L  S S D T+RL       W      +V  GHE  +             C+  
Sbjct: 273 VLDEYIL--SGSLDSTLRLTH-----WPSGNGLSVGTGHEFPIERVLIIPFSDSKICTSP 325

Query: 220 EKGKNGES------IRLC-SGSDDSTVRVW 242
            + +N  S       + C S + D+T+++W
Sbjct: 326 YRDQNEHSAFAPLRFKYCASAARDNTIKIW 355

 Score = 28.5 bits (62), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 15/117 (12%)

Query: 181 LLASSSYDDTIRLWKDYDDDWECAAV--LNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
           L++++S D  I ++    +  E   +   N H+ TV  S  +  +    + L S S D+T
Sbjct: 189 LVSTTSKDAQINVYDHSSNTGELKLIRSFNAHDSTV--SSQKTWQKDNDVLLASSSRDAT 246

Query: 239 VRVWRYID----DDEDGQQEWIC------EAILPKVHDRQIYSVSW-STNGLIASTG 284
           V+VWR  D           EW+       E IL    D  +    W S NGL   TG
Sbjct: 247 VKVWRVNDSRCLQSFSPHSEWVKSIDVLDEYILSGSLDSTLRLTHWPSGNGLSVGTG 303

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 66/178 (37%), Gaps = 52/178 (29%)

Query: 120 HENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP-E 178
           H  EV G+ W+ D   L+S   D  V+++    DG   + +    EH+  VK + W P  
Sbjct: 369 HSQEVCGLKWNVDENRLASGGNDNVVYVY----DGPSKKPVLKFTEHNAAVKAMAWSPHR 424

Query: 179 LPLLASS--SYDDTIRLW-----------------------KDYDDD------------- 200
              LA+   + D  +++W                       K+ D+              
Sbjct: 425 RATLATGGGTADRRLKIWNVNSGVRLNDVDTGSQVCNMVWSKNTDEIVTSHGYSKFNLTL 484

Query: 201 WECA-----AVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQ 253
           W+C      AVL GH   V         +G +I   SG+ D T+R W+     + G Q
Sbjct: 485 WDCPTLEPLAVLKGHSFRVL--HLTLSTDGTTI--VSGAGDETLRYWKLFGKSKFGNQ 538

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 78/186 (41%), Gaps = 38/186 (20%)

Query: 17  WSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLA 76
           W++D +   LA+G  D    ++ V + P    S   VL  T H  A++ +AW PH     
Sbjct: 378 WNVDENR--LASGGND---NVVYVYDGP----SKKPVLKFTEHNAAVKAMAWSPHRRATL 428

Query: 77  A---GSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSH-- 131
           A   G+ D  + IW                   NS  + L  +  G  ++V  + WS   
Sbjct: 429 ATGGGTADRRLKIW-----------------NVNS-GVRLNDVDTG--SQVCNMVWSKNT 468

Query: 132 DGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTI 191
           D  + S      ++ +W    D    E ++VL+ HS  V H+    +   + S + D+T+
Sbjct: 469 DEIVTSHGYSKFNLTLW----DCPTLEPLAVLKGHSFRVLHLTLSTDGTTIVSGAGDETL 524

Query: 192 RLWKDY 197
           R WK +
Sbjct: 525 RYWKLF 530

>AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH]
           complement(341382..342494) [1113 bp, 370 aa]
          Length = 370

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 11/75 (14%)

Query: 21  YSHGLLATGSTDRKIKI-------INVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPH-S 72
           Y   ++ATG  D+ +K+         +T +    VS+ ++     H  A+R V W PH S
Sbjct: 233 YRPHVIATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQG---HSLAVRKVVWSPHHS 289

Query: 73  NLLAAGSFDSTVSIW 87
           N+L + S+D T   W
Sbjct: 290 NILLSTSYDMTCRAW 304

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 160 ISVLQEHSQDVKHVVWHPELP-LLASSSYDDTIRLWKDYDD 199
           I+ +Q HS  V+ VVW P    +L S+SYD T R W D  D
Sbjct: 269 INEMQGHSLAVRKVVWSPHHSNILLSTSYDMTCRAWHDLAD 309

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 66/152 (43%), Gaps = 13/152 (8%)

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH   +  + ++ D  LL S S DK++  W     G      +    H+Q + +  W  +
Sbjct: 334 GHTKTLTVLCYNSDNKLLLSASDDKTLRTWR----GGNANSSNCFYGHTQSITYADWLDD 389

Query: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238
             L+ S+S D ++R+W    +     +V++G    ++C      K     +  +G+ D  
Sbjct: 390 DRLI-STSMDGSVRVWSVKQNALVGLSVVDGVP--IFCGTLSSDKQ----KFATGTLDGE 442

Query: 239 VRVW--RYIDDDEDGQQEWICEAILPKVHDRQ 268
           V V+  + + +  D  ++ I    +P + D Q
Sbjct: 443 VSVYNVKKLLEVLDADEKPIGPVRIPTIGDYQ 474

 Score = 28.5 bits (62), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 7/87 (8%)

Query: 156 EYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVW 215
           E + I  L  H++ +  + ++ +  LL S+S D T+R W+  + +   +    GH  ++ 
Sbjct: 325 ESKPIGKLVGHTKTLTVLCYNSDNKLLLSASDDKTLRTWRGGNAN--SSNCFYGHTQSIT 382

Query: 216 CSDFEKGKNGESIRLCSGSDDSTVRVW 242
            +D+         RL S S D +VRVW
Sbjct: 383 YADWLDDD-----RLISTSMDGSVRVW 404

>YIR012W (SQT1) [2677] chr9 (378483..379778) Protein that may be
           required for ribosomal assembly, contains WD (WD-40)
           repeats [1296 bp, 431 aa]
          Length = 431

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 1/64 (1%)

Query: 160 ISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGH-EGTVWCSD 218
           ++   +H+  V  +  HP LPL+ +   D+   LW  +    + A  L G+ E  + CS 
Sbjct: 58  LTYFDKHTDSVFAIGHHPNLPLVCTGGGDNLAHLWTSHSQPPKFAGTLTGYGESVISCSF 117

Query: 219 FEKG 222
             +G
Sbjct: 118 TSEG 121

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 163 LQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKG 222
           L  H + +  V ++ E  LL S S D +  +W  Y  + E    L+GH GT+W  D +  
Sbjct: 6   LTGHERPLTQVKYNKEGDLLFSCSKDSSASVW--YSLNGERLGTLDGHTGTIWSIDVDC- 62

Query: 223 KNGESIRLC-SGSDDSTVRVW 242
                 + C +GS D ++++W
Sbjct: 63  ----FTKYCVTGSADYSIKLW 79

 Score = 32.3 bits (72), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 117 IEGHENEVKGIAWSHDGALLSSCSRDKSVWIW 148
           + GHE  +  + ++ +G LL SCS+D S  +W
Sbjct: 6   LTGHERPLTQVKYNKEGDLLFSCSKDSSASVW 37

>Kwal_47.17567
          Length = 590

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 101/245 (41%), Gaps = 41/245 (16%)

Query: 14  DKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSN 73
           D++  L +++ +L +GS DR+I   +V      Q S  ++     H + +  + W    N
Sbjct: 369 DRVACLSWNNHILTSGSRDRRILHRDVRTP---QSSFEEI---RTHNQEVCGLKWNVEDN 422

Query: 74  LLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWS-HD 132
            LA+G  D+ V ++                    +  +  L  +E H   VK +AWS H 
Sbjct: 423 KLASGGNDNAVFVY------------------DGTSRLPFLK-LEEHTAAVKAMAWSPHR 463

Query: 133 GALLSS--CSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPEL-PLLASSSYDD 189
             +L++   + DK + IW      + ++  +  Q     V +++W      ++ S  Y  
Sbjct: 464 RGILATGGGTADKRLKIWNVKTSVKLHDVDTASQ-----VCNMIWSKNTNEIITSHGYSK 518

Query: 190 -TIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDD 248
             + LW    +  E  A+L GH   V         +G ++   SG+ D T+R W+  +  
Sbjct: 519 YNLTLWD--GNTLEPMAILKGHSFRVL--HMTLSTDGTTV--VSGAGDETLRYWKLFEKS 572

Query: 249 EDGQQ 253
           +   Q
Sbjct: 573 KSQAQ 577

>CAGL0K07095g 698028..699143 highly similar to sp|P38328
           Saccharomyces cerevisiae YBR234c AR41, hypothetical
           start
          Length = 371

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           L+A +  H+  V  +  S  G +++ CS+D++ ++WE   DG  Y+   VL   ++    
Sbjct: 49  LVATLANHDKLVTAVDISPHGRIVT-CSQDRNAYVWEPLSDG-SYKPTLVLLRINRAATS 106

Query: 173 VVWHPELPLLASSSYDDTIRL-WKDYDDDW 201
           V W P     A  S    I + + +++++W
Sbjct: 107 VSWAPSGYKFAVGSSARIIAVCYYEHENNW 136

>ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH]
           complement(868744..872445) [3702 bp, 1233 aa]
          Length = 1233

 Score = 34.7 bits (78), Expect = 0.14,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 70/179 (39%), Gaps = 28/179 (15%)

Query: 111 MDLLAIIEGHENEVKGIAW-SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQD 169
           M L  + +GH   +  + W  HD  L+ S  RD +  +W    + EE + ++        
Sbjct: 240 MPLQVMSQGHSKGILSLDWCKHDEKLMLSSGRDNTCILW----NPEEAQKLTQYPTRGNW 295

Query: 170 VKHVVWHPELP-LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESI 228
                + PE P L AS+S+D+ I++    +     A  L+  E     + F++       
Sbjct: 296 CFKTKFAPEAPDLFASASFDNKIQVQTLQN----LANKLDLDE-----TAFKQ------- 339

Query: 229 RLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDG 287
                  +S    W  +   E  ++  + +   P  H ++  +  W+  G I    SDG
Sbjct: 340 ------QESEADFWNNVSQSESKEKPVVTKIQAPAWHSKKSPAAHWAFGGKIVRITSDG 392

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 6/85 (7%)

Query: 162 VLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEK 221
           +L+ H + +  V ++ E  L+ S + D    +W  Y  + E      GH GT+W  D ++
Sbjct: 5   MLKGHERSLTQVKYNREGDLIFSCAKDSVASVW--YAINGERLGTFEGHMGTIWSIDVDQ 62

Query: 222 GKNGESIRLCSGSDDSTVRVWRYID 246
                     +GS D +V++W+  D
Sbjct: 63  FTE----YAVTGSADFSVKLWKVCD 83

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 9/33 (27%), Positives = 21/33 (63%)

Query: 116 IIEGHENEVKGIAWSHDGALLSSCSRDKSVWIW 148
           +++GHE  +  + ++ +G L+ SC++D    +W
Sbjct: 5   MLKGHERSLTQVKYNREGDLIFSCAKDSVASVW 37

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 4/66 (6%)

Query: 128 AWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSY 187
           +W  +G  + +  +D  V    +  DGE  E +  L+ H Q V  + + P+     +SS 
Sbjct: 160 SWGFEGKYIVAGHKDGKV----SKYDGENGEYLDSLELHEQSVSDIQFSPDRTYFITSSR 215

Query: 188 DDTIRL 193
           D   +L
Sbjct: 216 DSASKL 221

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 13/85 (15%)

Query: 207 LNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHD 266
           L GH GT+   +F    N E+  L S +DD+T+RVW       +G             H 
Sbjct: 355 LVGHRGTISQLEF----NSETKLLASAADDNTIRVWH----GGNGNSIHCFYG-----HT 401

Query: 267 RQIYSVSWSTNGLIASTGSDGTLAV 291
           + I S+ W  N ++ S   DG++ +
Sbjct: 402 QTIVSLKWVNNDMLISASMDGSVKL 426

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178
           GH   +  + ++ +  LL+S + D ++ +W     G     I     H+Q +  + W   
Sbjct: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWH----GGNGNSIHCFYGHTQTIVSLKWVNN 412

Query: 179 LPLLASSSYDDTIRLW 194
             +L S+S D +++LW
Sbjct: 413 -DMLISASMDGSVKLW 427

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 56/131 (42%), Gaps = 6/131 (4%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
           L+     H + +  + +  DG+   S S DK+V IWE +Q     + IS   ++S  + +
Sbjct: 301 LIQTYNHHLSSIISLKYFPDGSKFISSSEDKTVRIWE-NQVNIPIKQISDTSQYS--MPY 357

Query: 173 VVWHPELPLLASSSYDDTIRLWK-DYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLC 231
           +  HPE    ++ S D+ I  +            V  GH    +  +F    +G+ I   
Sbjct: 358 LEIHPEQHYFSAQSMDNAIYSFSMKPKYKKNLKKVFRGHLCAGFGINFGFSPDGQYI--V 415

Query: 232 SGSDDSTVRVW 242
           SG    +V VW
Sbjct: 416 SGDSRGSVVVW 426

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 110 EMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETD 151
           E  LL    GH   V+ I ++ DG    S S D+++ +W+T+
Sbjct: 211 ERTLLRDYRGHRKAVRDINFNSDGTEFLSVSFDQTLKVWDTE 252

>Kwal_55.20441
          Length = 360

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 55/134 (41%), Gaps = 9/134 (6%)

Query: 160 ISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDF 219
           I+   +H+  V  V  HP LPL+ S   D+   LW  +    + A  +   E  +     
Sbjct: 78  IAYFDKHTDSVFTVFAHPTLPLVCSGGADNMAYLWTSHSQPPKFAGSITHSESVIG---- 133

Query: 220 EKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGL 279
             G   + + L +   +  V V +      +G  +W   A L +V +     V  + +G+
Sbjct: 134 -GGFTPDGMFLVTADMNGQVLVHKA----SNGGAKWKQCAELHEVQEVVWIKVHPTISGV 188

Query: 280 IASTGSDGTLAVYK 293
            A   +DG++  Y+
Sbjct: 189 FAFGSTDGSVWCYQ 202

>Scas_658.1
          Length = 442

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 75/190 (39%), Gaps = 36/190 (18%)

Query: 59  HKKAIRCVAWRPHS-NLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAII 117
           H      + + P+S NLL +G  D+ V +W                      + +LL   
Sbjct: 148 HTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYH------------------KRNLLRDY 189

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHP 177
           +GH   +  + ++ DG    S S D ++ IW+T+Q   + +     +    DVK   ++ 
Sbjct: 190 KGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQGKVKTKL--HFKSTPNDVKFRPFNS 247

Query: 178 ELPLLASSS-----YDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCS 232
              ++  ++     YD  I      ++D     V + H  ++    F      +  +  S
Sbjct: 248 SEFIVGFANSKIYHYDTRIS-----ENDGRV-QVYDHHMSSILALKFFP----DGSKFIS 297

Query: 233 GSDDSTVRVW 242
            S+D TVR+W
Sbjct: 298 SSEDKTVRIW 307

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 37/186 (19%), Positives = 75/186 (40%), Gaps = 26/186 (13%)

Query: 114 LAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHV 173
           + + + H + +  + +  DG+   S S DK+V IW+ +Q     + IS   ++S  +  +
Sbjct: 273 VQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIWD-NQVNVPIKQISDTTQYS--MPSI 329

Query: 174 VWHPELPLLASSSYDDTIRLW---KDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRL 230
             HP+     + S D+TI  +     Y  +     +  G     +        +G  +  
Sbjct: 330 DIHPDKKNFCAQSMDNTIYTYSMKPKYRRN--PNKMFKGQTSAGYGIGLTFSADGRYV-- 385

Query: 231 CSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVH---DRQIYSVSWSTN--GLIASTGS 285
           CSG   S V +W           +W    +L  +    ++ I  V+W+      +A +G+
Sbjct: 386 CSGDSKSKVHIW-----------DWTTTRLLNTISIPGNKPITQVAWNPQETSKVACSGN 434

Query: 286 DGTLAV 291
            G + +
Sbjct: 435 TGKIYI 440

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 10/90 (11%)

Query: 109 LEMDLLAIIEGHENEVKGIAW-SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQE-- 165
           L   +   ++GH N    + +  + G LL S   D  V +W+       Y   ++L++  
Sbjct: 137 LPKKIKYAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDF------YHKRNLLRDYK 190

Query: 166 -HSQDVKHVVWHPELPLLASSSYDDTIRLW 194
            HS+ +  + ++ +     SSS+D TI++W
Sbjct: 191 GHSKAINSLDFNDDGTNFISSSFDHTIKIW 220

>Scas_601.2
          Length = 389

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 10/80 (12%)

Query: 13  NDKLWSLDYSHGLLATGS----TDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAW 68
           N    SLD  HGLLA G+     D  I I ++    +   SL+D      H   + C+ W
Sbjct: 105 NVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVD-----SHHDDVTCLKW 159

Query: 69  RPH-SNLLAAGSFDSTVSIW 87
            P+  N+L +GS D   +++
Sbjct: 160 HPNDPNILLSGSTDGYTNVY 179

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 58/160 (36%), Gaps = 40/160 (25%)

Query: 50  LMDVLDDTVHKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSL 109
            M +     H  +I+C+A       L +GS D  + I+                      
Sbjct: 96  FMPIFHFQAHSLSIKCLAVS--RRYLVSGSNDEHIRIYDLQKRKE--------------- 138

Query: 110 EMDLLAIIEGHENEVKGIAWSH------DGAL---------LSSCSRDKSVWIWETDQDG 154
               L  +  H+  +  + +SH      D A+         L S S D  + +W      
Sbjct: 139 ----LGTLLSHQGSITALQFSHPASSSEDAAVSKGSKNSKWLLSASEDHKIMVWRV---- 190

Query: 155 EEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLW 194
           +++E +  L+ H+  V  V  HP   +  S S D +IRLW
Sbjct: 191 KDWETVGTLKGHTARVNDVDIHPTNRIAISVSDDHSIRLW 230

>KLLA0E24354g complement(2163651..2164829) similar to sgd|S0006021
           Saccharomyces cerevisiae YPL100w, start by similarity
          Length = 392

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 6/88 (6%)

Query: 260 ILPKVHDRQIYSVSWSTNGLIASTGSD-GTLA-VYKEVSNGDDEHDWEVIAKQELCHGVY 317
           +LP VH   I  ++ S +G++ +T S+ GT+  V+K +   D E+D E I   E   G  
Sbjct: 196 VLPAVHQSNIVCIACSPDGMLMATASEKGTIIRVFKTI---DTEND-EPILVNEFRRGSR 251

Query: 318 EANIVKWIDINGNMMLATGGDDGCVNLW 345
            + I +    + N +LA  G+   ++++
Sbjct: 252 PSRISEMKFNHDNTLLACVGESDTIHIF 279

>AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH]
           (1203152..1204411) [1260 bp, 419 aa]
          Length = 419

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 76/193 (39%), Gaps = 23/193 (11%)

Query: 160 ISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDF 219
           ++   +H+  V  V  HP+LPL+ S   D+   LW  + +    A  +   E  +  +  
Sbjct: 53  VTYFDKHTDSVFTVAAHPKLPLVVSGGGDNKAHLWTTHREPPREAGSVEHSESVIGAAFT 112

Query: 220 EKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGL 279
             G+      L +   +  VRV           QEW   A L +V +     V     G+
Sbjct: 113 ADGR-----YLVTADMNGQVRVQVAARQG----QEWRPAAELQEVDEVTWLKVHPHRAGI 163

Query: 280 IASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCH------GVYEANIVKWIDINGNMML 333
            A    DG++  Y+     D +++  V+    + H      GV+    ++    + N++L
Sbjct: 164 FAIGAVDGSVWCYEM----DTQNNTPVLLMTGVAHAQDCTMGVF----LETAADDENVIL 215

Query: 334 ATGGDDGCVNLWN 346
            T   DG +  WN
Sbjct: 216 VTCSLDGTIIGWN 228

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 94/241 (39%), Gaps = 40/241 (16%)

Query: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIE 118
           H  ++  VA  P   L+ +G  D+   +WT                   S+E        
Sbjct: 59  HTDSVFTVAAHPKLPLVVSGGGDNKAHLWTTHREPPRE---------AGSVE-------- 101

Query: 119 GHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVW--- 175
            H   V G A++ DG  L +   +  V +    + G+E+   + LQE    V  V W   
Sbjct: 102 -HSESVIGAAFTADGRYLVTADMNGQVRVQVAARQGQEWRPAAELQE----VDEVTWLKV 156

Query: 176 HPELP-LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCS---DFEKGKNGESIRLC 231
           HP    + A  + D ++  ++    +     ++ G      C+     E   + E++ L 
Sbjct: 157 HPHRAGIFAIGAVDGSVWCYEMDTQNNTPVLLMTGVAHAQDCTMGVFLETAADDENVILV 216

Query: 232 SGSDDSTV---------RVWRYIDDDEDGQQ-EWICEAILPKVHDRQIYSVSWSTN-GLI 280
           + S D T+         +V++    +  GQ+ +WI  + LP   +R    V+  +N GL+
Sbjct: 217 TCSLDGTIIGWNCYSGQQVFKVTPSELKGQEAQWITLSTLPLGINRGSPIVACGSNSGLL 276

Query: 281 A 281
           A
Sbjct: 277 A 277

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 76/178 (42%), Gaps = 36/178 (20%)

Query: 26  LATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSNLLAA---GSFDS 82
           LA+G  D  + +   T       S   +L    HK A++ +AW PH   + A   G+ D 
Sbjct: 400 LASGGNDNVVHVYEGT-------SKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADR 452

Query: 83  TVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLAIIEGHENEVKGIAWSHD-GALLSSCSR 141
            + IW                    S++M    I  G  +++  + WS +   L++S   
Sbjct: 453 RLKIWN----------------VNTSIKMS--DIDSG--SQICNMVWSKNTNELVTSHGY 492

Query: 142 DK-SVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYD 198
            K ++ +W    D    + I++L+ HS  V H+    +   + S + D+T+R WK +D
Sbjct: 493 SKYNLTLW----DCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWKLFD 546

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 26/65 (40%), Gaps = 4/65 (6%)

Query: 113 LLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKH 172
               IE H  EV G+ W+     L+S   D  V ++E    G     I    EH   VK 
Sbjct: 377 FFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYE----GTSKSPILTFDEHKAAVKA 432

Query: 173 VVWHP 177
           + W P
Sbjct: 433 MAWSP 437

>Kwal_55.21144
          Length = 570

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 59/134 (44%), Gaps = 16/134 (11%)

Query: 118 EGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVL--QEHSQDVKHVVW 175
           EGH +E+  +A S DG  + +  RD+ + IW T    E    + V+  ++   +V  +V+
Sbjct: 230 EGHYDEILTLAASPDGKYVITGGRDRKLIIWST----ESLAPVKVIPTKDRRGEVLSLVF 285

Query: 176 HPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLC--SG 233
                 L ++  D  IR +    + +    +L GH+      D   G +   +  C   G
Sbjct: 286 RKNSDQLYAACADYKIRTYS--INQFSQLEILYGHQ------DLVVGISALGMERCVTVG 337

Query: 234 SDDSTVRVWRYIDD 247
           S D T  +W+  D+
Sbjct: 338 SRDRTAMLWKIADE 351

>Kwal_27.11126
          Length = 996

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 96/228 (42%), Gaps = 14/228 (6%)

Query: 120 HENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPEL 179
           HE  +  +  S +G   +SCS D+S+ +W    D +  + +S    H+  + ++++    
Sbjct: 180 HEGAIFFVTASKNGKYAASCSDDRSIKLW----DLKSGQLLSTAWGHTARIWNLLFFDND 235

Query: 180 PLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTV 239
             + S S D T R+W   +D+    A +  HEG +  S +    + E +   +  +D  +
Sbjct: 236 SKVISVSEDCTCRVWDISEDNTLSQASV--HEGHLLKSVWGLDVDNERMIAATSGNDGRI 293

Query: 240 RVW------RYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYK 293
           ++       R  D+      E I  A +       I    W   GLIA T S+G +  ++
Sbjct: 294 KLTDLKAKSRVGDETMSSSLEDIEAAGVAMKPKEIIKGFHWFKFGLIAMT-SEGQVLKFE 352

Query: 294 EVSNG-DDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDG 340
           + S       +    +   +  G+ E N++ +     ++++    DDG
Sbjct: 353 QSSKKWSSILNDSTFSNYSITAGLQELNLIVFCSSQCDLLVIKFNDDG 400

>KLLA0E19613g complement(1733708..1735426) similar to sp|P21304
           Saccharomyces cerevisiae YLR196w PWP1 singleton, start
           by similarity
          Length = 572

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 68/315 (21%), Positives = 125/315 (39%), Gaps = 52/315 (16%)

Query: 63  IRCVAWRPHSN-------LLAAGSFDSTVSIWTRXXXXXXXXXXXXXXXTTNSLEMDLLA 115
           + C+ ++P SN         A G+FD  + IW                 T NS+ +   +
Sbjct: 213 VECLNYKPGSNSDETVANFAAVGTFDPAIEIWNLDCVDKAFPDMILGEPTDNSIALPTKS 272

Query: 116 ----------IIEGHENEVKGIAWSHD-GALLSSCSRDKSVWIWETDQDGEEYECISVLQ 164
                     +   H + +  +A +    A+L+S S D +V +W+ +        I++  
Sbjct: 273 KKKKKSKSKHVTTHHTDAILSLAHNKQFRAVLASTSADHTVKLWDLNTATAARSLINI-- 330

Query: 165 EHSQ-DVKHVVWHPEL-PLLASSSYDDT-----IRLWKDYDDD--WECAAVLNGHEGTVW 215
            HS  +V    WHP    +L ++ YD       +R+  D D    W  ++   G E  + 
Sbjct: 331 -HSNTNVSASQWHPSNGSVLLTAGYDSRAALSDVRIENDNDMSKYWNVSS---GEE--IE 384

Query: 216 CSDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWS 275
           C  F      E+I +C G+D+  V  +  I +  + +  W       K HD  + SV  +
Sbjct: 385 CVRFAD----ENIFIC-GTDNGNVYSFD-IRNGAESKPVWTL-----KAHDAGVSSVEIN 433

Query: 276 ---TNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHG-VYEANIVKWIDINGNM 331
               N L+ S   +  + ++K   +        ++  ++   G V   +    I+I GNM
Sbjct: 434 RHIPNMLLTSAMGEKPVKLWKCPLDAKPGKGPSMVLSRDFGVGNVLTTSFAPDIEIAGNM 493

Query: 332 MLATGGDDGCVNLWN 346
           ++  GG    + LW+
Sbjct: 494 VV--GGVSPGLKLWD 506

>Scas_465.4
          Length = 1002

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 101/252 (40%), Gaps = 35/252 (13%)

Query: 109 LEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQ 168
           LE  L  ++ GHE  +     S +G  ++SCS D+S+ +W   Q GEE   +     H+ 
Sbjct: 168 LETKLYNLV-GHEGSIFYATISDNGRYITSCSDDRSIKLWNL-QTGEE---LCTGWGHTA 222

Query: 169 DVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHE-------GTVWCSDFEK 221
            + ++ +      L S S D+T R+W    D+      L   +         VW  D ++
Sbjct: 223 RIWNLKFFNNDTQLISVSEDNTCRVWDILQDEGNGNTSLTLSQIYEVHLIKNVWGVDIQE 282

Query: 222 GKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQE-------WICEAILPKVHDRQIYSVSW 274
               + + + SG +D  +++ +  D      QE           +++       I     
Sbjct: 283 ---KDMVAVTSG-NDGRLKLTKIQDTKTMNAQEVSFSLEDISTHSVIKFSKGEIIKGFQK 338

Query: 275 STNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQE------LCHGVYEANIVKWIDIN 328
              GLIA T S G +  Y E  N      W+++   E      + HG+ E NIV + +  
Sbjct: 339 FEFGLIAIT-SLGKIIQYFECDNL-----WKLLLVSENLVSYSVTHGIMEHNIVTFSNNK 392

Query: 329 GNMMLATGGDDG 340
            + +L     DG
Sbjct: 393 SDALLLKLSQDG 404

>Kwal_26.7655
          Length = 743

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 7/88 (7%)

Query: 160 ISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDF 219
             + QEH+QD+  + W  +   + ++S D T RLW  + D  +   V   H   V C+ F
Sbjct: 265 FRIYQEHTQDILDLDWS-KNGFILTTSMDKTARLW--HCDRPKALKVFT-HPDFVTCAKF 320

Query: 220 EKGKNGESIRLCSGSDDSTVRVWRYIDD 247
               +   I   SG  D T+R+W  +D+
Sbjct: 321 HPNDDRFFI---SGCLDHTLRLWSILDN 345

>CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces
           cerevisiae YCL039w, hypothetical start
          Length = 812

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 12/88 (13%)

Query: 7   KSLKLQNDKLWSLDYSH------GLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHK 60
           K+L   +D++W L +S        + A  +TDRKI I +V N       +  +L    + 
Sbjct: 348 KTLTQHSDEVWYLQFSPDGRYLASVSADATTDRKIYIYDVQN----DFQVYKILSG--NS 401

Query: 61  KAIRCVAWRPHSNLLAAGSFDSTVSIWT 88
           + I  +++ P S LL +  F++ V+I++
Sbjct: 402 QCILYLSFSPDSKLLVSCPFNAIVNIYS 429

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,794,494
Number of extensions: 564307
Number of successful extensions: 4407
Number of sequences better than 10.0: 370
Number of HSP's gapped: 3226
Number of HSP's successfully gapped: 956
Length of query: 349
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 246
Effective length of database: 13,030,455
Effective search space: 3205491930
Effective search space used: 3205491930
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)