Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_615.1037937920500.0
YDR268W (MSW1)37936611051e-150
KLLA0E21923g37838610911e-148
Kwal_55.2156337235910901e-148
CAGL0M08624g33733710631e-144
ACR089C38935810371e-140
Sklu_1979.43142929271e-124
KLLA0C02717g118649720.70
Sklu_2318.441039645.3
CAGL0L01903g1287134638.3
AFL053W581120638.3
Sklu_1790.3473106629.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_615.10
         (379 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_615.10                                                           794   0.0  
YDR268W (MSW1) [1101] chr4 (1003996..1005135) Tryptophanyl-tRNA ...   430   e-150
KLLA0E21923g 1947496..1948632 similar to sp|P04803 Saccharomyces...   424   e-148
Kwal_55.21563                                                         424   e-148
CAGL0M08624g complement(859796..860809) highly similar to sp|P04...   414   e-144
ACR089C [1136] [Homologous to ScYDR268W (MSW1) - SH] (518154..51...   404   e-140
Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement        361   e-124
KLLA0C02717g complement(242948..246508) weakly similar to sp|P38...    32   0.70 
Sklu_2318.4 YJR076C, Contig c2318 7574-8806                            29   5.3  
CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces c...    29   8.3  
AFL053W [3140] [Homologous to ScYGL095C (VPS45) - SH] complement...    29   8.3  
Sklu_1790.3 YOL041C, Contig c1790 1701-3122                            28   9.2  

>Scas_615.10
          Length = 379

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/379 (100%), Positives = 379/379 (100%)

Query: 1   MLARRCIPRSTSATRLSRGLASMNSKGTVQNTDYALQDISQTLPSDATIFSLIQPTGKFH 60
           MLARRCIPRSTSATRLSRGLASMNSKGTVQNTDYALQDISQTLPSDATIFSLIQPTGKFH
Sbjct: 1   MLARRCIPRSTSATRLSRGLASMNSKGTVQNTDYALQDISQTLPSDATIFSLIQPTGKFH 60

Query: 61  LGNYLGATRIWKQISQSKQPTQTAIFGVADLHAITVPKPDPMEFLQCRREALASILSLGI 120
           LGNYLGATRIWKQISQSKQPTQTAIFGVADLHAITVPKPDPMEFLQCRREALASILSLGI
Sbjct: 61  LGNYLGATRIWKQISQSKQPTQTAIFGVADLHAITVPKPDPMEFLQCRREALASILSLGI 120

Query: 121 DPQNAIMMYQSEVPQHTQLHWVLSTFTSMGVLNRMTQWKAKAKSNHMSVKLGLFSYPVLQ 180
           DPQNAIMMYQSEVPQHTQLHWVLSTFTSMGVLNRMTQWKAKAKSNHMSVKLGLFSYPVLQ
Sbjct: 121 DPQNAIMMYQSEVPQHTQLHWVLSTFTSMGVLNRMTQWKAKAKSNHMSVKLGLFSYPVLQ 180

Query: 181 AADILLYKATHVPVGDDQCQPLELCRSIAQQFNQFYGDENFFPIPRTILAPTKKILSLGD 240
           AADILLYKATHVPVGDDQCQPLELCRSIAQQFNQFYGDENFFPIPRTILAPTKKILSLGD
Sbjct: 181 AADILLYKATHVPVGDDQCQPLELCRSIAQQFNQFYGDENFFPIPRTILAPTKKILSLGD 240

Query: 241 PLKKMSKSDPNKDSNIYVNDAADVIVKKIRKAVTDSVTGPITFDPVNRPGVSNLLNMVSG 300
           PLKKMSKSDPNKDSNIYVNDAADVIVKKIRKAVTDSVTGPITFDPVNRPGVSNLLNMVSG
Sbjct: 241 PLKKMSKSDPNKDSNIYVNDAADVIVKKIRKAVTDSVTGPITFDPVNRPGVSNLLNMVSG 300

Query: 301 ITQREMSAVEQEVSHLSHLGEFKNYVAEIVVEELRGPRERYEQLMNEPEYLKQVGDQGAE 360
           ITQREMSAVEQEVSHLSHLGEFKNYVAEIVVEELRGPRERYEQLMNEPEYLKQVGDQGAE
Sbjct: 301 ITQREMSAVEQEVSHLSHLGEFKNYVAEIVVEELRGPRERYEQLMNEPEYLKQVGDQGAE 360

Query: 361 RARAIAEVNMRQVYRMMGF 379
           RARAIAEVNMRQVYRMMGF
Sbjct: 361 RARAIAEVNMRQVYRMMGF 379

>YDR268W (MSW1) [1101] chr4 (1003996..1005135) Tryptophanyl-tRNA
           synthetase, mitochondrial, member of class I family of
           aminoacyl-tRNA synthetases [1140 bp, 379 aa]
          Length = 379

 Score =  430 bits (1105), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 206/366 (56%), Positives = 271/366 (74%), Gaps = 16/366 (4%)

Query: 27  GTVQNTDYALQDISQTLPSDATIFSLIQPTGKFHLGNYLGATRIWKQISQSKQPTQTAIF 86
            TVQ  D+ L   S+ L S+AT+FS+IQPTG FHLGNYLGATR+W  + + KQP Q  IF
Sbjct: 17  STVQRADFKLN--SEALHSNATVFSMIQPTGCFHLGNYLGATRVWTDLCELKQPGQELIF 74

Query: 87  GVADLHAITVPKPDPMEFLQCRREALASILSLGIDPQNAIMMYQSEVPQHTQLHWVLSTF 146
           GVADLHAITVPKPD   F + R EA+ASIL++G+DP+ A ++YQS +PQH++LHW+LST 
Sbjct: 75  GVADLHAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELHWLLSTL 134

Query: 147 TSMGVLNRMTQWKAKAK-------------SNHMSVKLGLFSYPVLQAADILLYKATHVP 193
            SMG+LNRMTQWK+K+              S+   V+LGLFSYPVLQAADILLYK+THVP
Sbjct: 135 ASMGLLNRMTQWKSKSNIKQSTNGDYLVNDSDVGKVRLGLFSYPVLQAADILLYKSTHVP 194

Query: 194 VGDDQCQPLELCRSIAQQFNQFYGDENFFPIPRTILAPTKKILSLGDPLKKMSKSDPNKD 253
           VGDDQ Q LEL R +A++FN+ Y  +NFFP P T+LA TKK+LSL  P KKMSKSDPN D
Sbjct: 195 VGDDQSQHLELTRHLAEKFNKMY-KKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHD 253

Query: 254 SNIYVNDAADVIVKKIRKAVTDSVTGPITFDPVNRPGVSNLLNMVSGITQREMSAVEQEV 313
           S I++ND    I KKIRKA+TDS++    +DPV RPGVSNL+N+VSGI ++ +  V ++V
Sbjct: 254 SVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSGIQRKSIEDVVEDV 313

Query: 314 SHLSHLGEFKNYVAEIVVEELRGPRERYEQLMNEPEYLKQVGDQGAERARAIAEVNMRQV 373
           S  ++  +FK+YV+E+++EEL+GPR  +E+ +NEP YL  V + G  +AR  A  N+  +
Sbjct: 314 SRFNNYRDFKDYVSEVIIEELKGPRTEFEKYINEPTYLHSVVESGMRKAREKAAKNLADI 373

Query: 374 YRMMGF 379
           +++MGF
Sbjct: 374 HKIMGF 379

>KLLA0E21923g 1947496..1948632 similar to sp|P04803 Saccharomyces
           cerevisiae YDR268w MSW1 tryptophanyl-tRNA synthetase,
           mitochondrial singleton, start by similarity
          Length = 378

 Score =  424 bits (1091), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 209/386 (54%), Positives = 276/386 (71%), Gaps = 16/386 (4%)

Query: 1   MLARRCIPRSTSATRLSRGLASMNSKGTVQNTDYALQDISQTLPSDATIFSLIQPTGKFH 60
           MLA   + R+ S     R     NS  +V+ T + L++    LP +ATIFSLIQPTGKFH
Sbjct: 1   MLASSQLVRNKSRILFKR----FNS--SVKTTGFKLRE--SDLPKNATIFSLIQPTGKFH 52

Query: 61  LGNYLGATRIWKQISQSKQPTQTAIFGVADLHAITVPKPDPMEFLQCRREALASILSLGI 120
           LGNYLGA R+WK I+  K    T +FG ADLHAITVPKP+  EF   R EA+ASILS+GI
Sbjct: 53  LGNYLGAVRVWKDITDLKDDGTTLLFGTADLHAITVPKPNAKEFRNYRIEAIASILSIGI 112

Query: 121 DPQNAIMMYQSEVPQHTQLHWVLSTFTSMGVLNRMTQWKAKAKSNHMS-------VKLGL 173
           DP+ AI+ +QS V QHT+LHW+LS+  SMG LNRMTQWK+K+  N  S       +KLGL
Sbjct: 113 DPEKAIVFHQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKSNINDQSDDAALGAIKLGL 172

Query: 174 FSYPVLQAADILLYKATHVPVGDDQCQPLELCRSIAQQFNQFYGDENFFPIPRTILAPTK 233
           FSYPVLQAADILLYK+THVPVGDDQ Q LEL R ++  FN+FY  + +FP+P TILAPTK
Sbjct: 173 FSYPVLQAADILLYKSTHVPVGDDQSQHLELTRQLSNTFNKFYKTK-YFPMPTTILAPTK 231

Query: 234 KILSLGDPLKKMSKSDPNKDSNIYVNDAADVIVKKIRKAVTDSVTGPITFDPVNRPGVSN 293
           KILSL +P KKMSKSD N++S IY+ D  ++I KKI++AVTDS++    FDPV RPG+SN
Sbjct: 232 KILSLLNPEKKMSKSDTNQNSVIYITDEPEIIAKKIKRAVTDSISDSFYFDPVKRPGISN 291

Query: 294 LLNMVSGITQREMSAVEQEVSHLSHLGEFKNYVAEIVVEELRGPRERYEQLMNEPEYLKQ 353
           L+N +SG+ +  +  VE++++H+    +FK +V +++VEEL   RE++ + M  P+YL +
Sbjct: 292 LINTLSGVQRVSIEDVEKDIAHIKDHKDFKQHVTDVLVEELAPSREQFHRYMKNPDYLHK 351

Query: 354 VGDQGAERARAIAEVNMRQVYRMMGF 379
           V + GA +AR IA  N+ ++ R+MGF
Sbjct: 352 VSEDGASKAREIAAKNITEIKRIMGF 377

>Kwal_55.21563
          Length = 372

 Score =  424 bits (1090), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 202/359 (56%), Positives = 266/359 (74%), Gaps = 10/359 (2%)

Query: 28  TVQNTDYALQDISQTLPSDATIFSLIQPTGKFHLGNYLGATRIWKQISQSKQPTQTAIFG 87
           TV+ TDY +   +  LP +A +FS++QPTGKFHLGNYLGA R+WK +   K P+   +FG
Sbjct: 17  TVKTTDYKIN--ASDLPDNAVVFSMVQPTGKFHLGNYLGAVRVWKDLCDQKAPSTQLMFG 74

Query: 88  VADLHAITVPKPDPMEFLQCRREALASILSLGIDPQNAIMMYQSEVPQHTQLHWVLSTFT 147
           VADLHAIT+P PD M+  Q RREA+ASILS+G+DP  A++  QS V QHT+LHW+LST  
Sbjct: 75  VADLHAITIPIPDGMKLRQSRREAMASILSVGVDPSKAVLFNQSRVHQHTELHWLLSTLA 134

Query: 148 SMGVLNRMTQWKAKAKSNHMS-------VKLGLFSYPVLQAADILLYKATHVPVGDDQCQ 200
            MG+LNRMTQWK+K+   +MS       VKLGLFSYPVLQAADILLY++THVPVGDDQ Q
Sbjct: 135 PMGLLNRMTQWKSKSNLKNMSDEQALGTVKLGLFSYPVLQAADILLYRSTHVPVGDDQAQ 194

Query: 201 PLELCRSIAQQFNQFYGDENFFPIPRTILAPTKKILSLGDPLKKMSKSDPNKDSNIYVND 260
            LEL R++AQ FN+ Y      P+P TILAPTK+ILSL D   KMSKSD N+++ IY+ND
Sbjct: 195 HLELTRTLAQYFNKLY-KRPILPLPTTILAPTKRILSLADIDSKMSKSDQNQNATIYLND 253

Query: 261 AADVIVKKIRKAVTDSVTGPITFDPVNRPGVSNLLNMVSGITQREMSAVEQEVSHLSHLG 320
             D IVKKIRKAVTDS +    +DP +RPGVSNL+N+VSG+ ++ +  VE+++S  +   
Sbjct: 254 EPDSIVKKIRKAVTDSNSKAFYYDPSSRPGVSNLINIVSGLQRQSIQQVEKDISRFNSHS 313

Query: 321 EFKNYVAEIVVEELRGPRERYEQLMNEPEYLKQVGDQGAERARAIAEVNMRQVYRMMGF 379
           EFK+YV+E++VE L+GPRER+   M +P+YL +V + GAE A   AE +++++  +MGF
Sbjct: 314 EFKSYVSEVLVETLQGPRERFNLYMKDPDYLDKVFESGAENASKHAEKSIKEIKNIMGF 372

>CAGL0M08624g complement(859796..860809) highly similar to sp|P04803
           Saccharomyces cerevisiae YDR268w MSW1 tryptophanyl-tRNA
           synthetase, mitochondrial, start by similarity
          Length = 337

 Score =  414 bits (1063), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 196/337 (58%), Positives = 252/337 (74%), Gaps = 10/337 (2%)

Query: 52  LIQPTGKFHLGNYLGATRIWKQISQSKQPTQTAIFGVADLHAITVPKPDPMEFLQCRREA 111
           ++QPTGKFHLGNYLGATR+WK +   KQP Q  IFGVADLHAIT+PKPD  +F Q RREA
Sbjct: 1   MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA 60

Query: 112 LASILSLGIDPQNAIMMYQSEVPQHTQLHWVLSTFTSMGVLNRMTQWKAK--------AK 163
           +ASIL++G+DP  A +MYQS +P H+QL+W+LST   MG LNRMTQWK+K        A 
Sbjct: 61  IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDAT 120

Query: 164 SNHMS-VKLGLFSYPVLQAADILLYKATHVPVGDDQCQPLELCRSIAQQFNQFYGDENFF 222
           +  +  VKLGLF YPVLQAADILLYKATHVPVGDDQ Q LEL R++A+ FN+ Y  +  F
Sbjct: 121 AKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLY-KKQVF 179

Query: 223 PIPRTILAPTKKILSLGDPLKKMSKSDPNKDSNIYVNDAADVIVKKIRKAVTDSVTGPIT 282
           P+PRT+LAPTKKILSL    KKMSKSDPN+D  IYVND  + I++KI+KA TDS+T    
Sbjct: 180 PLPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITDKFY 239

Query: 283 FDPVNRPGVSNLLNMVSGITQREMSAVEQEVSHLSHLGEFKNYVAEIVVEELRGPRERYE 342
           +DPV+RPG+SNL+N+VSGIT++ + AVEQE+    +  + K +V+E+++EELR PRE++ 
Sbjct: 240 YDPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEELRVPREKFH 299

Query: 343 QLMNEPEYLKQVGDQGAERARAIAEVNMRQVYRMMGF 379
           Q M +P++L     QG +RA  IA   M++  + MGF
Sbjct: 300 QYMEDPQFLDDTVQQGTQRASEIAASTMKETMQTMGF 336

>ACR089C [1136] [Homologous to ScYDR268W (MSW1) - SH]
           (518154..519323) [1170 bp, 389 aa]
          Length = 389

 Score =  404 bits (1037), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 197/358 (55%), Positives = 252/358 (70%), Gaps = 9/358 (2%)

Query: 28  TVQNTDYALQDISQTLPSDATIFSLIQPTGKFHLGNYLGATRIWKQISQSKQPTQTAIFG 87
           T+QN DYA  + S  LP  A +FSLIQPTGKFHLGNYLGA R+W ++S+        IFG
Sbjct: 35  TIQNIDYA--NRSLKLPDGAVVFSLIQPTGKFHLGNYLGAVRVWTELSEDAPAGGKCIFG 92

Query: 88  VADLHAITVPKPDPMEFLQCRREALASILSLGIDPQNAIMMYQSEVPQHTQLHWVLSTFT 147
            ADLHAIT+PKPD   F Q R EA+AS+L++GIDP  +I+ +QS+VP+H +L W LST T
Sbjct: 93  TADLHAITIPKPDGNAFRQMRHEAIASLLAVGIDPTKSILFHQSQVPEHAELCWYLSTLT 152

Query: 148 SMGVLNRMTQWKAKAKSNHMS------VKLGLFSYPVLQAADILLYKATHVPVGDDQCQP 201
           SMG LNRMTQWK KA     S      VKLGLF+YPVLQAAD+LLYK+TH+PVG+DQ Q 
Sbjct: 153 SMGALNRMTQWKTKANIKDTSSEKVGAVKLGLFTYPVLQAADVLLYKSTHIPVGEDQVQQ 212

Query: 202 LELCRSIAQQFNQFYGDENFFPIPRTILAPTKKILSLGDPLKKMSKSDPNKDSNIYVNDA 261
           LEL R +AQ FN  Y    +F  P T+L PT+K+LSL +PLKKMSKSD N++S I V D 
Sbjct: 213 LELTRQLAQAFNSTY-KTRYFREPTTLLTPTRKVLSLQNPLKKMSKSDANQNSCICVTDE 271

Query: 262 ADVIVKKIRKAVTDSVTGPITFDPVNRPGVSNLLNMVSGITQREMSAVEQEVSHLSHLGE 321
            D I +KIR AVTDS+     +DP  RPGVSNL+N+V+GI ++ ++AVE +++       
Sbjct: 272 PDAIRRKIRSAVTDSIGHEFKYDPEGRPGVSNLINIVAGIQKKTIAAVEADIAGFKDHAT 331

Query: 322 FKNYVAEIVVEELRGPRERYEQLMNEPEYLKQVGDQGAERARAIAEVNMRQVYRMMGF 379
           FKNYV +I+V ELRGPRE + + MN+  Y+ +V   GAERA AIA   + +V  +MG+
Sbjct: 332 FKNYVTDILVAELRGPREEFARYMNDKSYIYEVERNGAERAGAIAAKTLAEVRAIMGY 389

>Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement
          Length = 314

 Score =  361 bits (927), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 177/292 (60%), Positives = 220/292 (75%), Gaps = 11/292 (3%)

Query: 28  TVQNTDYALQDISQTLPSDATIFSLIQPTGKFHLGNYLGATRIWKQISQSKQPTQTAIFG 87
           TV+ TDY L   S  +P  +TIFSLIQPTGKFHLGNYLGA R+WK +  +       +FG
Sbjct: 16  TVKTTDYTLH--SHDIPDKSTIFSLIQPTGKFHLGNYLGAVRVWKDLCDTDLDESKLLFG 73

Query: 88  VADLHAITVPKPDPMEFLQCRREALASILSLGIDPQNAIMMYQSEVPQHTQLHWVLSTFT 147
           VADLHAIT+PKP+  EF Q R EA+ASILS+GIDP+ AI+ +QS+V QH +LHW+LST  
Sbjct: 74  VADLHAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVHQHAELHWILSTIA 133

Query: 148 SMGVLNRMTQWKAKAKSNHMS--------VKLGLFSYPVLQAADILLYKATHVPVGDDQC 199
            +G LNRMTQWK+K+     +        VKLGLF+YPVLQAADILLY +THVPVGDDQ 
Sbjct: 134 PVGYLNRMTQWKSKSNLRQDASDAEALGNVKLGLFAYPVLQAADILLYHSTHVPVGDDQS 193

Query: 200 QPLELCRSIAQQFNQFYGDENFFPIPRTILAPTKKILSLGDPLKKMSKSDPNKDSNIYVN 259
           Q LEL R +AQQFN+ Y  +++FP+P TILAPTKKILSL  P KKMSKSD N++S IY+N
Sbjct: 194 QHLELTRFLAQQFNKLY-KKSYFPLPTTILAPTKKILSLASPGKKMSKSDANQNSVIYLN 252

Query: 260 DAADVIVKKIRKAVTDSVTGPITFDPVNRPGVSNLLNMVSGITQREMSAVEQ 311
           D  + I KKI+KAVTDS++    +DP NRPGVSNL+N+VSGI +R ++ VE+
Sbjct: 253 DDPETISKKIKKAVTDSISHEFKYDPENRPGVSNLINIVSGIQRRSIAEVEK 304

>KLLA0C02717g complement(242948..246508) weakly similar to sp|P38717
           Saccharomyces cerevisiae YNL257c SIP3 SNF1P protein
           kinase interacting protein, start by similarity
          Length = 1186

 Score = 32.3 bits (72), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 15  RLSRGLASMNSKGTVQNTDYALQDISQTL--PSDATIFSLIQPTGKFHL 61
           RL+R L S N      NTD++  DI QTL   S+   + + Q TG F L
Sbjct: 804 RLARALISDNKVHRSTNTDFSYMDILQTLTKTSENFYYEIDQKTGFFSL 852

>Sklu_2318.4 YJR076C, Contig c2318 7574-8806
          Length = 410

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 5/39 (12%)

Query: 316 LSHLGEFKNYVAEIVVEELRGPRERYEQLMNEPEYLKQV 354
           +SHL +FK+Y  EI+ E     R R E L  E   LKQV
Sbjct: 272 ISHLHDFKDYTHEILYE-----RYRTEALSGEGPALKQV 305

>CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces
           cerevisiae YKL038w RGT1, hypothetical start
          Length = 1287

 Score = 28.9 bits (63), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 57/134 (42%), Gaps = 17/134 (12%)

Query: 188 KATHVPVGDDQCQPLELCRSIAQQFN-----QFYGDENFF---PIPRTILAPTKKILSLG 239
           K T+V    DQC+  ++     Q+ N     Q  G+   F   P+ R    P+K      
Sbjct: 8   KRTNVSRACDQCRRKKIKCDRNQERNICTSCQRNGERCKFERVPLKR---GPSKGAHKAS 64

Query: 240 DPLKKMSKSDPNKDSNIYVNDAADVIVKKIRKAVTDSVTGPITFDPVNRPGVSNLLNMVS 299
           DP  K+S + P+K S     D+  +I  + +    DS   P++    N P + N  N  S
Sbjct: 65  DPELKLSSNKPSKSS--LFEDSNSII--RPKSVGEDSNMDPLSRHGSNTPILDN--NSNS 118

Query: 300 GITQREMSAVEQEV 313
           GI  R M  ++  +
Sbjct: 119 GINDRNMGGIDDRL 132

>AFL053W [3140] [Homologous to ScYGL095C (VPS45) - SH]
           complement(338636..340381) [1746 bp, 581 aa]
          Length = 581

 Score = 28.9 bits (63), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 53/120 (44%), Gaps = 18/120 (15%)

Query: 199 CQPLELCRSIAQQFNQFYGDENFFPIPRTILAPTKKILSLGDPLKKMSKSDPNKDSNIYV 258
           C P E+  +I  +F + +G      + +   +P   ++S     KK +K + N   N+Y+
Sbjct: 425 CSPREM--AIFHKFREQFGAH----VSQVRKSPENDLIS--GLSKKFNKLNHNSADNVYM 476

Query: 259 NDA-------ADVIVKKIRKAVTDSVTGPITFDPVNRPGVSNLLNMVSGITQREMSAVEQ 311
                     AD+   ++ + +  S +G +   P N+P    +L +V G+T  E   V Q
Sbjct: 477 QHKPKLGAILADLAKGRLSQDIFSSTSGAL---PTNKPVQDVVLFIVGGVTLDEARLVHQ 533

>Sklu_1790.3 YOL041C, Contig c1790 1701-3122
          Length = 473

 Score = 28.5 bits (62), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 49/106 (46%), Gaps = 17/106 (16%)

Query: 219 ENFFPIPRTILAPTKKILSLGDPL-----KKMSKSDPNKDSNIYVNDAADVIVKKIRKAV 273
           ++F  + + +L   KKI   G  L     K M KS P ++S+ Y+NDA    + + +K +
Sbjct: 356 KDFQSVNKALLLNEKKINGNGRKLRVSRCKNMRKSQPAQNSSRYLNDAQRTKLGRAKKIL 415

Query: 274 --TDSVT--GPITFDPV------NRPGVSNLLNMVSG--ITQREMS 307
              D  T  G +T + V        PG+    N   G  +T+R ++
Sbjct: 416 GKADRATAGGKLTIEGVRATKGDTTPGLKGKKNRSKGGRVTKRSIA 461

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,599,285
Number of extensions: 486615
Number of successful extensions: 1461
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1474
Number of HSP's successfully gapped: 17
Length of query: 379
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 276
Effective length of database: 13,030,455
Effective search space: 3596405580
Effective search space used: 3596405580
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)