Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_613.23*1371377089e-98
YDL110C1501213861e-48
Sklu_1742.31541593304e-40
Kwal_23.34581531142906e-34
CAGL0H10362g1491132705e-31
KLLA0E09229g1601212551e-28
AGR378C1171091893e-19
Scas_578.5117992800.010
AEL270W637115770.019
YPR115W1083107690.27
KLLA0F23089g33360660.59
KLLA0F26499g70927641.0
YLR392C51835641.1
Scas_706.21130494621.8
YPR084W45656622.0
KLLA0C10593g24165612.3
Sklu_2115.6107948612.5
ADL298C147679612.9
Sklu_1809.347050603.2
KLLA0B06303g120337603.9
Scas_697.363436604.1
Sklu_2415.358528585.8
CAGL0D00638g69355586.2
Sklu_2249.2108333579.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_613.23*
         (137 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_613.23*                                                          277   9e-98
YDL110C (YDL110C) [759] chr4 complement(264512..264964) Protein ...   153   1e-48
Sklu_1742.3 YDL110C, Contig c1742 2887-3351 reverse complement        131   4e-40
Kwal_23.3458                                                          116   6e-34
CAGL0H10362g 1009858..1010307 similar to tr|Q12513 Saccharomyces...   108   5e-31
KLLA0E09229g complement(827035..827517) similar to sgd|S0002268 ...   102   1e-28
AGR378C [4689] [Homologous to ScYDL110C - SH] (1426104..1426457)...    77   3e-19
Scas_578.5                                                             35   0.010
AEL270W [2235] [Homologous to ScYPR179C (PLO1) - SH] complement(...    34   0.019
YPR115W (YPR115W) [5536] chr16 (754873..758124) Protein containi...    31   0.27 
KLLA0F23089g 2145083..2146084 weakly similar to sp|P43597 Saccha...    30   0.59 
KLLA0F26499g 2456560..2458689 similar to sp|P36085 Saccharomyces...    29   1.0  
YLR392C (YLR392C) [3771] chr12 complement(904749..906305) Protei...    29   1.1  
Scas_706.21                                                            28   1.8  
YPR084W (YPR084W) [5510] chr16 (706968..708338) Protein of unkno...    28   2.0  
KLLA0C10593g 911134..911859 some similarities with sp|P38771 Sac...    28   2.3  
Sklu_2115.6 YGL156W, Contig c2115 5286-8525 reverse complement         28   2.5  
ADL298C [1443] [Homologous to ScYBL034C (STU1) - SH] (174376..17...    28   2.9  
Sklu_1809.3 YDR195W, Contig c1809 3856-5268                            28   3.2  
KLLA0B06303g complement(555780..559391) highly similar to sp|P22...    28   3.9  
Scas_697.3                                                             28   4.1  
Sklu_2415.3 YJL216C, Contig c2415 5464-7221                            27   5.8  
CAGL0D00638g complement(80947..83028) similar to tr|Q07457 Sacch...    27   6.2  
Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement          27   9.7  

>Scas_613.23*
          Length = 137

 Score =  277 bits (708), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 137/137 (100%), Positives = 137/137 (100%)

Query: 1   MSSPGAMKRPIQIEEFKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEGLE 60
           MSSPGAMKRPIQIEEFKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEGLE
Sbjct: 1   MSSPGAMKRPIQIEEFKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEGLE 60

Query: 61  QEYADDSEEVENIEAGDLQLFRDSVRENQIVLKNYNKRLDALDQENIYRTSGHVKPSESV 120
           QEYADDSEEVENIEAGDLQLFRDSVRENQIVLKNYNKRLDALDQENIYRTSGHVKPSESV
Sbjct: 61  QEYADDSEEVENIEAGDLQLFRDSVRENQIVLKNYNKRLDALDQENIYRTSGHVKPSESV 120

Query: 121 SHSAAISTPKASNSIYL 137
           SHSAAISTPKASNSIYL
Sbjct: 121 SHSAAISTPKASNSIYL 137

>YDL110C (YDL110C) [759] chr4 complement(264512..264964) Protein of
           unknown function [453 bp, 150 aa]
          Length = 150

 Score =  153 bits (386), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 96/121 (79%), Gaps = 1/121 (0%)

Query: 1   MSSPGAMKRPIQIEEFKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEGLE 60
           M S G ++RPIQIEEFKTAI  MS+ EL  I+ +IENS++HL+RSN +L KYIAKLEG +
Sbjct: 1   MCSAGGIRRPIQIEEFKTAISGMSDMELAQIKTEIENSINHLQRSNARLGKYIAKLEGAD 60

Query: 61  QEY-ADDSEEVENIEAGDLQLFRDSVRENQIVLKNYNKRLDALDQENIYRTSGHVKPSES 119
               ADDS+++ENI++GDL L++DSVREN+IVL NYN+R+DAL+QE +YR +GH K    
Sbjct: 61  DRLEADDSDDLENIDSGDLALYKDSVRENEIVLNNYNERVDALEQETVYRKTGHGKSKHE 120

Query: 120 V 120
           V
Sbjct: 121 V 121

>Sklu_1742.3 YDL110C, Contig c1742 2887-3351 reverse complement
          Length = 154

 Score =  131 bits (330), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 73/159 (45%), Positives = 105/159 (66%), Gaps = 27/159 (16%)

Query: 1   MSSPGAMKRPIQIEEFKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEG-- 58
           MS+ G+++RPIQI EFKTAI+D+ +++L  IR +++NS+ HL+RSN +L KYIA+++G  
Sbjct: 1   MSTAGSIRRPIQIAEFKTAIRDLPQDQLSKIRQELQNSIKHLDRSNARLTKYIARIQGKK 60

Query: 59  ------LEQEYADDSEEVENIEAGDLQLFRDSVRENQIVLKNYNKRLDALDQENIYRTSG 112
                 LE E  +D+     I+A DLQL++DS+REN+IVL+N+  RLDALDQE  YRTSG
Sbjct: 61  PESNVELEGESDEDT-----IDANDLQLYQDSLRENEIVLRNHYARLDALDQEEAYRTSG 115

Query: 113 HVKPSESVSH-----SAAIST---------PKASNSIYL 137
               SE+ +      +AAIS            A NS++L
Sbjct: 116 STSASENKASRGPAVAAAISGIDTDNTQGDANAPNSVFL 154

>Kwal_23.3458
          Length = 153

 Score =  116 bits (290), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 83/114 (72%), Gaps = 2/114 (1%)

Query: 1   MSSPGAMKRPIQIEEFKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEGLE 60
           MS   + +RP++I EFK  IKD+ + +L  IR ++ENS+ HL+RSN +L+KYIAK+EG  
Sbjct: 1   MSDATSRRRPVEITEFKAVIKDLPDGQLNKIRSELENSMKHLDRSNLRLKKYIAKIEGKR 60

Query: 61  QEYAD--DSEEVENIEAGDLQLFRDSVRENQIVLKNYNKRLDALDQENIYRTSG 112
           +   D  D EE++ ++A DLQLF+DS REN+IVL+N+ +RL+ALD E  YR  G
Sbjct: 61  ESTPDGVDEEELDKVDANDLQLFQDSYRENEIVLRNHYERLEALDLEASYRDRG 114

>CAGL0H10362g 1009858..1010307 similar to tr|Q12513 Saccharomyces
           cerevisiae YDL110c, start by similarity
          Length = 149

 Score =  108 bits (270), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 78/113 (69%)

Query: 1   MSSPGAMKRPIQIEEFKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEGLE 60
           M+S   MKRP+ +  FK AI+DM ++EL  ++ ++ENS+ HL RSN++L +YI KL+G  
Sbjct: 1   MTSASGMKRPVDVANFKIAIRDMGDDELGRVKQEVENSIRHLTRSNERLHRYIKKLQGHA 60

Query: 61  QEYADDSEEVENIEAGDLQLFRDSVRENQIVLKNYNKRLDALDQENIYRTSGH 113
            E  D  E  EN+ + D++LF++S+REN++VL N  +RL+AL  E  YR + H
Sbjct: 61  VELEDGEEMDENLGSDDIELFQESIRENELVLDNSRERLEALHDELAYRKAQH 113

>KLLA0E09229g complement(827035..827517) similar to sgd|S0002268
           Saccharomyces cerevisiae YDL110c hypothetical protein,
           start by similarity
          Length = 160

 Score =  102 bits (255), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 79/121 (65%), Gaps = 15/121 (12%)

Query: 1   MSSPGAMKRPIQIEEFKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEG-- 58
           M+    ++RPIQI+EF  AI++ SE EL+ IR +I N+V HL+RSN++LE Y+AKL+G  
Sbjct: 1   MAHSSGIRRPIQIQEFVIAIRESSEHELQEIRKEINNAVKHLQRSNRRLEAYVAKLKGEE 60

Query: 59  --------LEQEYADDSEEVENIEAGDLQLFRDSVRENQIVLKNYNKRLDALDQENIYRT 110
                    E  ++DD     +I+  DLQ+F+DS+ EN  VL NYN+RL ALD E  +R 
Sbjct: 61  VLNRQELDAEGNFSDD-----DIDEKDLQVFQDSLAENGKVLDNYNERLQALDLEEQHRA 115

Query: 111 S 111
           S
Sbjct: 116 S 116

>AGR378C [4689] [Homologous to ScYDL110C - SH] (1426104..1426457)
           [354 bp, 117 aa]
          Length = 117

 Score = 77.4 bits (189), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 67/109 (61%), Gaps = 12/109 (11%)

Query: 1   MSSPGAMKRPIQIEEFKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEGLE 60
           M+     +RP+QI EFKTA++++S++EL   R  +E     L R++++L +++ +LE  +
Sbjct: 1   MAGSEVARRPVQIAEFKTAVRELSQQELAAARQALEARARQLARTSERLARHVQELE--Q 58

Query: 61  QEYADDSEEVENIEAGDLQLFRDSVRENQIVLKNYNKRLDALDQENIYR 109
           QE           E G+L LFR S+REN++VL N  +RL+A+  E  +R
Sbjct: 59  QEG----------EGGNLALFRTSLRENEVVLGNCRERLEAVGLEEEFR 97

>Scas_578.5
          Length = 1179

 Score = 35.4 bits (80), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 47/92 (51%), Gaps = 6/92 (6%)

Query: 13  IEEFKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEGL--EQEYADDSEEV 70
           I++++T IKD+ E E  N   +IEN    +E  N  +EKY   +E    EQ   + +  +
Sbjct: 146 IKKYRTKIKDLIERE--NAVAKIENDTESIEWLNHFMEKYWCLIEPTISEQVVTNVNTTL 203

Query: 71  ENIEAGDLQLFRDSVRENQIVLKNYNKRLDAL 102
            N+ +  L  F  SV  +Q+ L   + R+D L
Sbjct: 204 NNLYS--LPKFVQSVWIDQLTLGVKSPRIDGL 233

>AEL270W [2235] [Homologous to ScYPR179C (PLO1) - SH]
           complement(132790..134703) [1914 bp, 637 aa]
          Length = 637

 Score = 34.3 bits (77), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 59/115 (51%), Gaps = 23/115 (20%)

Query: 13  IEEFKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIA-------KLEGLEQEYAD 65
           +E+ +TAI +  +E L  I+ Q+E+++S  +R+N  +++Y+        +LE LE + +D
Sbjct: 434 VEQNQTAIFESHKEALSTIKKQLEDAISKKQRNNTLVDEYLKNSQNERDQLEVLEADISD 493

Query: 66  DSEEVENIEAGDLQLFRD-SVRENQIVLKNYNKRLDALDQENIYRTSGHVKPSES 119
              +++    G  QL+ D +  EN + L               YRT+ + K SE+
Sbjct: 494 LLGQLDGRHQGFKQLWDDLNQTENTLAL---------------YRTNANAKRSEA 533

>YPR115W (YPR115W) [5536] chr16 (754873..758124) Protein containing
           a pleckstrin homology (PH) domain, which mediate
           protein-protein and protein-lipid interactions, has
           moderate similarity to S. cerevisiae Ask10p, which may
           be a transcription factor in the S. cerevisiae
           Skn7p-mediated regulatory system [3252 bp, 1083 aa]
          Length = 1083

 Score = 31.2 bits (69), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 51/107 (47%), Gaps = 29/107 (27%)

Query: 24  SEEELKNIRYQIENSVSHL------ERSNKKLEKYIAKL------------EGLEQEYAD 65
           S+E++  I YQ++N+V         + +NK ++  I+KL            + L+ +Y  
Sbjct: 183 SQEQIARINYQMKNAVKFAFLTDLEDETNKLVDPSISKLPTKKPQPVPLAAQKLDSKYDT 242

Query: 66  D-----------SEEVENIEAGDLQLFRDSVRENQIVLKNYNKRLDA 101
           D           SEEV +  +G ++    S+++ Q++LK Y+  L +
Sbjct: 243 DVEQPQSIQSVPSEEVASASSGFMKFGSGSIQDIQVILKKYHLSLGS 289

>KLLA0F23089g 2145083..2146084 weakly similar to sp|P43597
           Saccharomyces cerevisiae YFR016c, hypothetical start
          Length = 333

 Score = 30.0 bits (66), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 5   GAMKRPIQIEE--FKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEGLEQE 62
           G++++P Q+EE   K   K  +++ L N     E S+ H E S  ++EK   + +GL QE
Sbjct: 66  GSLEKPDQVEEEQPKNTEKGYADDTLSNETEFAEESIDHSENSEIRIEKEATQDQGLNQE 125

>KLLA0F26499g 2456560..2458689 similar to sp|P36085 Saccharomyces
           cerevisiae YKL072w STB6 SIN3 binding protein, start by
           similarity
          Length = 709

 Score = 29.3 bits (64), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 70  VENIEAGDLQLFRDSVRENQIVLKNYN 96
           +EN++ G L LF    R+N+I L+++N
Sbjct: 382 IENVQGGYLGLFWSGKRQNKITLQSHN 408

>YLR392C (YLR392C) [3771] chr12 complement(904749..906305) Protein
           of unknown function [1557 bp, 518 aa]
          Length = 518

 Score = 29.3 bits (64), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 10/35 (28%), Positives = 24/35 (68%)

Query: 84  SVRENQIVLKNYNKRLDALDQENIYRTSGHVKPSE 118
           S+R+  ++LK +++ L  +DQE +++ +G + P +
Sbjct: 37  SIRKISVILKGFSETLTKIDQEYMFQQNGMMMPGQ 71

>Scas_706.21
          Length = 1304

 Score = 28.5 bits (62), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 54/94 (57%), Gaps = 6/94 (6%)

Query: 12  QIEEFKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEGLEQEYADDSEEVE 71
           QI+E++  +KD+ E EL+ I  Q +     L +SN++ ++ ++K++ L        EE+E
Sbjct: 232 QIDEYQMKVKDI-EIELQKITEQSD----KLFKSNQEFQQVLSKIQNLRMLDKHLKEEIE 286

Query: 72  NIEAGDLQLFRDSVRENQIVLKNYNKRLDALDQE 105
           N+ +  ++L     +E + +L N++K  D  +QE
Sbjct: 287 NV-SNSVELISLPKQELEELLANFSKSFDENEQE 319

>YPR084W (YPR084W) [5510] chr16 (706968..708338) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.6533p [1371 bp, 456 aa]
          Length = 456

 Score = 28.5 bits (62), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 58  GLEQEYADD--SEEVENIEAGDLQLF---RDSVRENQIVLKNYNKRLDALDQENIY 108
           G   EY DD  + + EN+  G  +L    R+ + +     +NY KR +   +++IY
Sbjct: 251 GGPPEYGDDVMNTDTENVSDGGFELLKVIRNCILDAWTEFRNYEKRWEEGKEDDIY 306

>KLLA0C10593g 911134..911859 some similarities with sp|P38771
           Saccharomyces cerevisiae YHR038w FIL1 Killed in Mutagen,
           sensitive to Diepoxybutane and/or Mitomycin C singleton,
           hypothetical start
          Length = 241

 Score = 28.1 bits (61), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 11/65 (16%)

Query: 10  PIQIEEFKTAIKDMSE-----------EELKNIRYQIENSVSHLERSNKKLEKYIAKLEG 58
           PI  E  +   KD+ +           E L ++R +I   + HL++ N  ++K I  +E 
Sbjct: 159 PITTETRQAVCKDLKKVFEDYKHSALKESLGHVRGEIMKELKHLQKKNDDVKKVIQDVEK 218

Query: 59  LEQEY 63
           + +EY
Sbjct: 219 IHKEY 223

>Sklu_2115.6 YGL156W, Contig c2115 5286-8525 reverse complement
          Length = 1079

 Score = 28.1 bits (61), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 45  SNKKLEKYIAKLEGLEQEYADDSEEVENIEAGDLQLFRDSVRENQIVL 92
           +NKKL+  I+KL G+     D + +VE +   DL+  R+++  NQ VL
Sbjct: 705 TNKKLQVSISKLSGVITSVVDLNSDVEYL---DLKNGRNNLGGNQFVL 749

>ADL298C [1443] [Homologous to ScYBL034C (STU1) - SH] (174376..178806)
            [4431 bp, 1476 aa]
          Length = 1476

 Score = 28.1 bits (61), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 6/79 (7%)

Query: 56   LEGLEQEYADDSEEVENIEAGDLQLFRD-----SVRENQIV-LKNYNKRLDALDQENIYR 109
            +E ++ E   D  E EN E G  ++FRD     SV+ N I  + + NK  D  D E+I  
Sbjct: 1061 VEMVDDEKFKDPVEQENQETGLDEIFRDEKHDQSVKFNDIPRIIDVNKSWDRYDGESIED 1120

Query: 110  TSGHVKPSESVSHSAAIST 128
            TSG+       +  A+  T
Sbjct: 1121 TSGNTSHGTDENRPASFGT 1139

>Sklu_1809.3 YDR195W, Contig c1809 3856-5268
          Length = 470

 Score = 27.7 bits (60), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 5/50 (10%)

Query: 37 NSVSHLER-SNKKLEKYIAKLEGLEQEYADDSEEVE----NIEAGDLQLF 81
          N V  L +  + K+++YI+ LE    ++A D+E +E    N+   D+QL+
Sbjct: 32 NQVPELSKEQSDKIDRYISSLETAFAQFAKDNEHIEKKEDNVTVIDIQLY 81

>KLLA0B06303g complement(555780..559391) highly similar to sp|P22138
           Saccharomyces cerevisiae YPR010c RPA135 DNA-directed RNA
           polymerase I, 135 KD subunit, start by similarity
          Length = 1203

 Score = 27.7 bits (60), Expect = 3.9,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 20  IKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKL 56
           +K+  EE L+NIR QI+  ++     N K +KY+ K+
Sbjct: 412 VKEKIEEYLQNIRLQIQTDINRGLAINFKDQKYMNKV 448

>Scas_697.3
          Length = 634

 Score = 27.7 bits (60), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 17  KTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKY 52
           KT  K  +E+ LK +R   + S++++E  +KKL KY
Sbjct: 327 KTYEKKFTEDLLKKVRLSFKESITNVEDFHKKLLKY 362

>Sklu_2415.3 YJL216C, Contig c2415 5464-7221
          Length = 585

 Score = 26.9 bits (58), Expect = 5.8,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 17/28 (60%)

Query: 59  LEQEYADDSEEVENIEAGDLQLFRDSVR 86
           +E++Y  DS+E+EN   G   + RD  R
Sbjct: 418 IEEKYGKDSKEIENFMKGAALISRDHAR 445

>CAGL0D00638g complement(80947..83028) similar to tr|Q07457
           Saccharomyces cerevisiae YDL074c BRE1, hypothetical
           start
          Length = 693

 Score = 26.9 bits (58), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 23  MSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEGLEQ----EYADDSEEVENI 73
           ++EEE K +  Q EN ++ LE  N  L + I +LE  +Q    E A    E+ N+
Sbjct: 240 ITEEEKKKLFLQYENKITDLESHNSSLNRIIEELENYKQLNEKELAQTRLEISNL 294

>Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement
          Length = 1083

 Score = 26.6 bits (57), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 20  IKDMSEEE--LKNIRYQIENSVSHLERSNKKLE 50
           IKD+ ++E  L+N  YQ+ N   HL R    LE
Sbjct: 476 IKDLKQKEFKLRNESYQLSNDTEHLRRKTANLE 508

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.125    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,554,441
Number of extensions: 196369
Number of successful extensions: 1530
Number of sequences better than 10.0: 210
Number of HSP's gapped: 1510
Number of HSP's successfully gapped: 244
Length of query: 137
Length of database: 16,596,109
Length adjustment: 91
Effective length of query: 46
Effective length of database: 13,445,871
Effective search space: 618510066
Effective search space used: 618510066
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 56 (26.2 bits)