Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_613.1462862833430.0
Scas_669.1469063915410.0
Kwal_23.346466858014620.0
ADL285C64463714130.0
CAGL0E04950g67362814140.0
YDL109C64764514060.0
YGL144C (ROG1)68558213990.0
KLLA0E14872g67760812951e-171
CAGL0H10340g59259810111e-129
AER322C6366237642e-92
YDR444W6876417498e-90
KLLA0B01375g6406437362e-88
CAGL0M10043g6586497191e-85
Kwal_47.184826236347064e-84
Scas_717.506584085801e-65
KLLA0F16709g5312051863e-14
Kwal_55.217034412171782e-13
AFR386C5042091782e-13
YOR059C4502841773e-13
ADR202C4432241701e-12
CAGL0L10318g4572611702e-12
KLLA0F16423g4592311665e-12
Kwal_27.101022582181581e-11
Sklu_2393.45462161613e-11
Sklu_2232.44452181541e-10
Scas_698.394712801443e-09
Sklu_1381.145886692.6
Kwal_47.1813047478692.8
Scas_704.4647368658.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_613.14
         (628 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_613.14                                                          1292   0.0  
Scas_669.14                                                           598   0.0  
Kwal_23.3464                                                          567   0.0  
ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH] (2...   548   0.0  
CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces c...   549   0.0  
YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein ...   546   0.0  
YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of...   543   0.0  
KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces...   503   e-171
CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces...   394   e-129
AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)...   298   2e-92
YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unkn...   293   8e-90
KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyce...   288   2e-88
CAGL0M10043g complement(999113..1001089) similar to tr|Q04093 Sa...   281   1e-85
Kwal_47.18482                                                         276   4e-84
Scas_717.50                                                           228   1e-65
KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF134...    76   3e-14
Kwal_55.21703                                                          73   2e-13
AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp...    73   2e-13
YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protei...    73   3e-13
ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)...    70   1e-12
CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448 S...    70   2e-12
KLLA0F16423g complement(1516717..1518096) similar to sgd|S000558...    69   5e-12
Kwal_27.10102                                                          65   1e-11
Sklu_2393.4 , Contig c2393 3530-5170 reverse complement                67   3e-11
Sklu_2232.4 YOR059C, Contig c2232 3289-4626                            64   1e-10
Scas_698.39                                                            60   3e-09
Sklu_1381.1 YBR118W, Contig c1381 291-1667                             31   2.6  
Kwal_47.18130                                                          31   2.8  
Scas_704.46                                                            30   8.2  

>Scas_613.14
          Length = 628

 Score = 1292 bits (3343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/628 (100%), Positives = 628/628 (100%)

Query: 1   MAKSISDDQVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFK 60
           MAKSISDDQVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFK
Sbjct: 1   MAKSISDDQVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFK 60

Query: 61  AAYLMGPFTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWI 120
           AAYLMGPFTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWI
Sbjct: 61  AAYLMGPFTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWI 120

Query: 121 IDVISQSIFSLNSVTSFELTLGTTTNNYNSGSSLEVETLSTDVIWNEKATIPLLRESRKM 180
           IDVISQSIFSLNSVTSFELTLGTTTNNYNSGSSLEVETLSTDVIWNEKATIPLLRESRKM
Sbjct: 121 IDVISQSIFSLNSVTSFELTLGTTTNNYNSGSSLEVETLSTDVIWNEKATIPLLRESRKM 180

Query: 181 IHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEMGIKFLGEGL 240
           IHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEMGIKFLGEGL
Sbjct: 181 IHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEMGIKFLGEGL 240

Query: 241 AKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFITLATPFLG 300
           AKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFITLATPFLG
Sbjct: 241 AKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFITLATPFLG 300

Query: 301 IVTDNPSYVKMLLSAGIIGKTGVDLGLKEHYDNILYLLSGEPIKSIMKKFERRTLYANAM 360
           IVTDNPSYVKMLLSAGIIGKTGVDLGLKEHYDNILYLLSGEPIKSIMKKFERRTLYANAM
Sbjct: 301 IVTDNPSYVKMLLSAGIIGKTGVDLGLKEHYDNILYLLSGEPIKSIMKKFERRTLYANAM 360

Query: 361 NDGIVPLYTSCLLFLDYADVLSELDNLKRSIKITIDTPESGRESEKIINTSSSWSKVFKH 420
           NDGIVPLYTSCLLFLDYADVLSELDNLKRSIKITIDTPESGRESEKIINTSSSWSKVFKH
Sbjct: 361 NDGIVPLYTSCLLFLDYADVLSELDNLKRSIKITIDTPESGRESEKIINTSSSWSKVFKH 420

Query: 421 RKEDKHSVKLPKTSIIESMASILQPPSPTDEYITNPSSRAKVIIHDKVYTEDDIERIESN 480
           RKEDKHSVKLPKTSIIESMASILQPPSPTDEYITNPSSRAKVIIHDKVYTEDDIERIESN
Sbjct: 421 RKEDKHSVKLPKTSIIESMASILQPPSPTDEYITNPSSRAKVIIHDKVYTEDDIERIESN 480

Query: 481 FYKLKNDRLLSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRKVIVALGSEAHNNIIVRRR 540
           FYKLKNDRLLSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRKVIVALGSEAHNNIIVRRR
Sbjct: 481 FYKLKNDRLLSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRKVIVALGSEAHNNIIVRRR 540

Query: 541 FSNGYGWEVIDHLIENHFNGSDSLLVHNNEEQAVMKATMEPNKEFSWITKVEDPCSYSGG 600
           FSNGYGWEVIDHLIENHFNGSDSLLVHNNEEQAVMKATMEPNKEFSWITKVEDPCSYSGG
Sbjct: 541 FSNGYGWEVIDHLIENHFNGSDSLLVHNNEEQAVMKATMEPNKEFSWITKVEDPCSYSGG 600

Query: 601 LLSRTTKLLDTMYVSNPEDRVTNKQVKP 628
           LLSRTTKLLDTMYVSNPEDRVTNKQVKP
Sbjct: 601 LLSRTTKLLDTMYVSNPEDRVTNKQVKP 628

>Scas_669.14
          Length = 690

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/639 (49%), Positives = 417/639 (65%), Gaps = 39/639 (6%)

Query: 8   DQVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFKAAYLMGP 67
           + +LYQ+ S +      RYII YNLY  +EIP+ I LDPL L IKN    S++AAYLMGP
Sbjct: 2   NDLLYQNKSTLGAAQQDRYIITYNLYDTEEIPSDIKLDPLYLRIKNIEPISYRAAYLMGP 61

Query: 68  FTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWIIDVISQS 127
           F LYCDVR ++YHH QRI S+ D PQF SNL P    I  LSLH+I+K+YVWI+DV+SQ 
Sbjct: 62  FILYCDVRLETYHHSQRIYSTCDQPQFESNLLPSQDAIWSLSLHQIQKRYVWIVDVVSQI 121

Query: 128 IFSLNSVTSFELTLGTT-------TNNYNSGSS-LEVETLSTDVIWNEKATIPLLRESRK 179
           +F+ N+  ++E+++G T        NN   GS  L V  L+T  +W     +      R+
Sbjct: 122 LFTTNTDITYEISMGYTKESLHHSINNERLGSDRLVVTKLNTLDLWKLPVQLAPSDRRRR 181

Query: 180 MIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEMGIKFLGEG 239
             HLVILTHG+HSN+T DM Y+MEQIY +Q  Y NE+IVV GY GN+C+TE G+K+LGE 
Sbjct: 182 RKHLVILTHGLHSNLTVDMEYIMEQIYKSQDNYPNEQIVVDGYPGNICQTERGVKYLGER 241

Query: 240 LAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFITLATPFL 299
           LAKYI++ LY   + KISFIGHSLGGL+Q+FAI+ I V +PWFF+KV+P+NFI +A+P L
Sbjct: 242 LAKYIVNELYDASIVKISFIGHSLGGLVQTFAIAYINVKYPWFFQKVQPINFIAMASPLL 301

Query: 300 GIVTDNPSYVKMLLSAGIIGKTGVDLGL---KEHYDNILYLLSGEPIKSIMKKFERRTLY 356
           GIVTDNP+YVK+LLS G+IGKTG DLGL    E    +LYLL GEP +S++ KF+RRTLY
Sbjct: 302 GIVTDNPAYVKLLLSFGVIGKTGQDLGLDRVSETDRPLLYLLPGEPTRSVLLKFKRRTLY 361

Query: 357 ANAMNDGIVPLYTSCLLFLDYADVLSEL----DNLKRSIKITIDTPESGRESEKIINTSS 412
           ANA+NDGIVPLYT+ LLFLDY D+L +L    D      +  +  PE+     K  N  S
Sbjct: 362 ANAINDGIVPLYTASLLFLDYDDILEQLHKNEDEELAKDEQNVTIPENTASFNK--NFIS 419

Query: 413 SWSKVFKHRKEDKH----SVKLPKTSIIESMASILQPPSPTDEYITNPSSRAKVIIHDKV 468
             +K+       K       KLPK S+++S  SIL PP P  EY+ NP +R  VIIHDK 
Sbjct: 420 PLTKMLSIWAPQKFPQGPDSKLPKVSMLQSATSILLPPLPDQEYLLNPKARHPVIIHDKT 479

Query: 469 YTEDDIER----IESNFYKLKNDRLLSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRKVI 524
           YT++D+ +    +E  F+  +N  LL  F    +  K+ ++LE  IA+RWH G  WRKV+
Sbjct: 480 YTQEDLPKGDTELEDTFFNSEN-MLLQAFTDIKAGRKRYQKLEESIARRWHEGMSWRKVV 538

Query: 525 VALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHFNGSDSLLVHNNEEQAVMKATM----- 579
           VAL  +AHNNIIVRRRF+N YGW VIDHLI  HFNG D L     + +A ++A +     
Sbjct: 539 VALKPDAHNNIIVRRRFANAYGWNVIDHLIGVHFNGDDRL--EEEQTKAGLEAPLPNDQS 596

Query: 580 ---EPNKEFSWITKVEDPCSYS---GGLLSRTTKLLDTM 612
              EP  E++W+TK E    +     G++S   ++L+T 
Sbjct: 597 SVIEPIDEYAWVTKAESESLFDEGPTGMISTMGEMLETF 635

>Kwal_23.3464
          Length = 668

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/580 (51%), Positives = 381/580 (65%), Gaps = 29/580 (5%)

Query: 5   ISDDQVLYQDTSEVKIGGIRRYIIKYNLYTGDE-IPTTISLDPLKLTIKNKVRKSFKAAY 63
           ++ D V+Y   S VK+G + RYII Y LY  DE +P  ++L+ L L ++N    +F+AAY
Sbjct: 1   MTKDGVVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAY 60

Query: 64  LMGPFTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWIIDV 123
           LMGP+ LYCDVRA  YHH QR+  S D P F   LQP   FI ELSLH +KK YVW++DV
Sbjct: 61  LMGPYLLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDV 120

Query: 124 ISQSIFSLNSVTSFELTLGTTTNNYN--------SGS---SLEVETLSTDVIWNEKATIP 172
           +SQ IF+  +   FE+++GT+             SGS    L V  L++  +WN    + 
Sbjct: 121 VSQIIFTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWN--LPVQ 178

Query: 173 LLRESRKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEMG 232
           L   + +  HLVILTHG+HSNV ADM YL EQI   Q  Y  E+IVVKG+ GNVCKTE G
Sbjct: 179 LSTHTHQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKG 238

Query: 233 IKFLGEGLAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFI 292
           I +LG  LA+YI+  LY   V KISFIGHSLGGL+Q+FAI+ I V +PWFF+ V P+NFI
Sbjct: 239 INYLGTRLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFI 298

Query: 293 TLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKEHYDN---ILYLLSGEPIKSIMKK 349
           TLATP LGIVTDNP+YV +LLS GI+GKTG DLGL E   +   +LYLL G+P K++++ 
Sbjct: 299 TLATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKDGKPLLYLLPGKPTKTVLRM 358

Query: 350 FERRTLYANAMNDGIVPLYTSCLLFLDYADVLSELDN---LKRSIKITIDTPESGRESEK 406
           F+RRT+YANA+NDGIVPLY++ LLFLDY DVL +L     L+  +     +    R    
Sbjct: 359 FKRRTIYANAVNDGIVPLYSASLLFLDYEDVLGQLKTKPELRERLSSNTSSDFISRNFLS 418

Query: 407 IINTS-SSWSKVFKHRKEDKHSVKLPKTSIIESMASILQPPSPTDEYITNPSSRAKVIIH 465
            I+ + S W+     +  D  S+K+PK S+IES  S+L PP P   YI NPSSR  +IIH
Sbjct: 419 PISKAISFWA---PQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPSSRENIIIH 475

Query: 466 DKVYTEDDIERIESNFYK---LKNDRLLSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRK 522
           DK+Y + ++   ES   K     N+ LL  F R  S+GK N RLE EIA+RWH G  WRK
Sbjct: 476 DKIYCDQEVPPRESQSEKELLESNNTLLKAFTR--SSGKDNRRLEEEIARRWHEGISWRK 533

Query: 523 VIVALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHFNGSD 562
           V+V L  +AHNNIIVRRRFSN YGW V+DHL +NHFN  D
Sbjct: 534 VVVGLKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHFNSMD 573

>ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH]
           (201714..203648) [1935 bp, 644 aa]
          Length = 644

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/637 (45%), Positives = 398/637 (62%), Gaps = 33/637 (5%)

Query: 9   QVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFKAAYLMGPF 68
           +VLY   S V+IG + RY+I Y+LY  +E+P  I L  L L +KN    +++AAYLMGP+
Sbjct: 8   EVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRAAYLMGPY 67

Query: 69  TLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWIIDVISQSI 128
            LYCD+R + YHH Q++ SS D+PQF   +QP  +F+AELSLH ++K+YVW++DV+SQ I
Sbjct: 68  MLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLLDVVSQII 127

Query: 129 FSLNSVTSFELTLG--------TTTNNYNSGS---SLEVETLSTDVIWNEKATIPLLRES 177
           F+ NSV  FE+T+         T T    +GS    L V   +T  +WN    +    + 
Sbjct: 128 FTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQQV--FDDY 185

Query: 178 RKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEMGIKFLG 237
            K  HLV+LTHG+HSNVTADM YL E I   Q  Y NE IVVKG+  NVCKTE GIK+LG
Sbjct: 186 TKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKGIKYLG 245

Query: 238 EGLAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFITLATP 297
             L +YI+  LY+  + +ISFIGHSLGGL Q+FAI+ IA+ +PWFFEKV PVNF+ L++P
Sbjct: 246 GRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVALSSP 305

Query: 298 FLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKEHYDN---ILYLLSGEPIKSIMKKFERRT 354
            LGIVT+NP+YV +LLS G++GKTG DLGL+ H  +   +L  L G   + I++KF++RT
Sbjct: 306 LLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTTRRILRKFKKRT 365

Query: 355 LYANAMNDGIVPLYTSCLLFLDYADVLSELDNLKRSIKITIDTPESGRESEKIINTSSSW 414
           LYANA+NDGIVPLYTS LL+LDY  +L +LD  +  +       +    ++ +IN     
Sbjct: 366 LYANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQVD------KQDFFTKTLINPLVKA 419

Query: 415 SKVFKHRKEDKHSVKLPKTSIIESMASILQPPSPTDEYITNPSSRAKVIIHDKVYTEDDI 474
             V   + +   S+  PK S+ +S  S+L PP P   Y+ NPS    VI+HDK+Y+E DI
Sbjct: 420 INVLMPQTQSSSSI--PKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKMYSEADI 477

Query: 475 ERIESNFYKLKNDRLLSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRKVIVALGSEAHNN 534
             +     K     + S         ++ ++LE EIAK+WH G  WRKVIV L  +AHNN
Sbjct: 478 PEVGQPPEK----NIWSSLLLNIGNNEEYKQLEEEIAKKWHKGMTWRKVIVHLKPDAHNN 533

Query: 535 IIVRRRFSNGYGWEVIDHLIENHFNGSDSLLVHNNEEQAVMKATMEPNKEFSWITKVEDP 594
           IIVRRRF+N YGW VIDHL++NHFNGSD        E+A +   +E  +E  WI +  + 
Sbjct: 534 IIVRRRFANAYGWPVIDHLVQNHFNGSDYPYTEGETEEAALDELIE--QEKKWINRPHNE 591

Query: 595 CSYS---GGLLSRTTKLLDTMYVSNPEDRVTNKQVKP 628
             +     G++S   ++L+ +  S  +   +   +KP
Sbjct: 592 TFFDVGPTGMISSVGEILENIKNSAFQKTASASSLKP 628

>CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 673

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/628 (47%), Positives = 403/628 (64%), Gaps = 50/628 (7%)

Query: 6   SDDQVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFKAAYLM 65
           ++  +LY   S VK+G I RY+I+Y LY  DEIP  + LD L + +KN    SF+A YL 
Sbjct: 6   ANKDILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFRAGYLA 65

Query: 66  GPFTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWIIDVIS 125
           GPF LY DVR+ +YHH Q IVSS D PQF +NLQ     + ELSLH I+ KYVWI+DV+S
Sbjct: 66  GPFILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWILDVVS 125

Query: 126 QSIFSLNSVTSFELT-------------------LGTTTNNYNSGSSLEVETLSTDVIWN 166
           Q +F+ N+   FE+T                   LG+T+NN      L V  L+TD +W 
Sbjct: 126 QILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNN------LIVSRLTTDDLWK 179

Query: 167 EKATIPLLRESRKMI-HLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGN 225
               +P     +K I HLVILTHG+HSNV+AD+SYLME+IY +Q+ + NE ++V GY  N
Sbjct: 180 ----LPRELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDN 235

Query: 226 VCKTEMGIKFLGEGLAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEK 285
           VC+TE G+++LG  LA YIID LY  +V KISF+GHSLGGL+Q+FAI ++A  +PWFF+K
Sbjct: 236 VCETEKGVRYLGTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDK 295

Query: 286 VKPVNFITLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKEHYDN---ILYLLSGEP 342
           VKPVNFIT+A+P LGIVTDNP+Y+ +LLS G++G+TG DL L     +   +LY LSGE 
Sbjct: 296 VKPVNFITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSLSGEF 355

Query: 343 IKSIMKKFERRTLYANAMNDGIVPLYTSCLLFLDYADVLSEL------DNLKRSIKITID 396
           I+SI++KFERRT+YANA+NDGIVPLYTS LL+LDY  +L +L       +L     IT+ 
Sbjct: 356 IRSILRKFERRTIYANAVNDGIVPLYTSGLLYLDYDAILKKLREKEENKSLSGPNNITV- 414

Query: 397 TPESGRESEKIINTSSSWSKVFKHRKEDKHSVKLPKTSIIESMASILQPPSPTDEYITNP 456
           +  +   ++  I+  +    ++  +K  +   K+PK S  +S ASIL PP P   +I NP
Sbjct: 415 SDNTAFFNKNFISPLTKMLSLWAPQKFPESDPKIPKVSFFQSAASILLPPLPDINFIVNP 474

Query: 457 SSRAKVIIHDKVYTEDDIERIE----SNFYKLKNDRLLSRFYRRHSTGKQNERLEVEIAK 512
             R  +IIHDK+YTE+DI+ +E    S+F+  KN   L       S   + + LE  IA 
Sbjct: 475 KHRNDIIIHDKIYTEEDIKDVEKDPDSSFFNNKN-IFLQALSTVTSEKTKYQELEKTIAI 533

Query: 513 RWHSGTPWRKVIVALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHFNGSDSLLVHNNEEQ 572
           RWH G  WRKVIVAL  +AHNNIIVRRRFSN YGW VIDHLI  HF+G +  +  ++++ 
Sbjct: 534 RWHKGLSWRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGENFEM--DSQKD 591

Query: 573 AVMKATMEPNKEFSWITKVEDPCSYSGG 600
             +  T E   + +WI + ++   +  G
Sbjct: 592 VSITTTRE---DLNWIKRPDEDGLFKEG 616

>YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Rog1p [1944 bp, 647 aa]
          Length = 647

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/645 (46%), Positives = 401/645 (62%), Gaps = 48/645 (7%)

Query: 1   MAKSISDDQVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFK 60
           M    S D+VLY + S VK+G + RY+I Y LY GD IP  I+LD L + IKN  + S+K
Sbjct: 1   MEAGRSADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYK 60

Query: 61  AAYLMGPFTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWI 120
            AYL+GPF LYCDVRA+ Y    +I+ S D P F SNLQ   KFIAELSLH IK +YVWI
Sbjct: 61  PAYLLGPFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWI 120

Query: 121 IDVISQSIFSLNSVTSFELTLGTTTNNYNSG----------------SSLEVETLSTDVI 164
           +D++SQ +F+  +  +FE+ +G +  +                    + L V  L+T  I
Sbjct: 121 VDIVSQILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADI 180

Query: 165 WNEKATIPLLRESRKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVG 224
           W     I + ++S    HLVILTHG  SNV+ADM YLME+IY  Q    NE++V+KGY+ 
Sbjct: 181 WKVPRPIDMSQKS----HLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMK 236

Query: 225 NVCKTEMGIKFLGEGLAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFE 284
           N C+TE GIKFLG GLA YIID LY   V KISFIGHSLGGL Q+FAI  I   +P+FF+
Sbjct: 237 NACETEKGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFK 296

Query: 285 KVKPVNFITLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKE-HYDN--ILYLLSGE 341
           KV+P+NFI+LA+P LGI T  P+YVKM LS GIIG TG +LGLK+ +Y +  +LYLLS E
Sbjct: 297 KVEPINFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPLLYLLSEE 356

Query: 342 PIKSIMKKFERRTLYANAMNDGIVPLYTSCLLFLDYADVLSELDNLKRSIKITIDTPESG 401
            + S++ +F+RRTLYANA+NDGIVPLY+S LLFLDY+ +L +L     +    +  PE  
Sbjct: 357 SLISVLARFKRRTLYANAVNDGIVPLYSSSLLFLDYSQLLQKLGGQTTAPCDPLFQPEVS 416

Query: 402 RESE-----KIIN-----TSSSWSKVFKHRKE--DKHSVKLPKTSIIESMASILQPPSPT 449
              E      + N      +SSW+  +K ++   DK S +L   S+I+SM S+L  P P 
Sbjct: 417 PIGELPNHSDVANDDDGINASSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVLLSPCPD 476

Query: 450 DEYITNPSSRAKVIIHDKVYTEDDIERIESNFYKLKNDRLLSRFYRRHSTGKQNERLEVE 509
            ++ ++P +R   IIHDK+YTE ++       Y+           +   T K  + +E  
Sbjct: 477 AKFFSDPDARVATIIHDKIYTEKNLPPPSPTLYE-------GTAAKEGETRKTRKEMEEI 529

Query: 510 IAKRWHSGTPWRKVIVALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHFNGSDSLLVHNN 569
           IA+RWH G  WRKV+V L  +AHNNIIVRRRFSN YGW V+DHL+  HF   D +     
Sbjct: 530 IARRWHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQRDDPIASPMQ 589

Query: 570 EEQ------AVMKATMEPNKEFSWITKVEDPCSYSGGLLSRTTKL 608
           ++Q       +    +EPNK +SW+TK+EDP  Y GG++S  ++L
Sbjct: 590 DKQFAEEDINMATGGVEPNKFYSWLTKIEDPSVYHGGIVSTASQL 634

>YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Ydl109p [2058 bp, 685 aa]
          Length = 685

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/582 (48%), Positives = 384/582 (65%), Gaps = 41/582 (7%)

Query: 8   DQVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFKAAYLMGP 67
           +++L+   S VK+G + RY+I Y+LY G+EIP  ++L+ L L ++N    S++AAYLMGP
Sbjct: 7   NEILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLMGP 66

Query: 68  FTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWIIDVISQS 127
           F LYCDV+   YHH Q+IV+S D P+F  N+Q    F+AELS+H I++KYVWI DV+SQ 
Sbjct: 67  FMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIADVMSQI 126

Query: 128 IFSLNSVTSFELTLGTTTNNYNS--------GS---SLEVETLSTDVIWNEKATIPLLRE 176
           +F+ N+  ++E+T+GT+  +  +        GS    L V  L+T  +WN    I     
Sbjct: 127 LFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPVQI---TT 183

Query: 177 SRKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEMGIKFL 236
            +K  HLV+LTHG+HSNV+ D+ Y+MEQIY  Q  Y +E+IVVKGY GNVC+TE G+K+L
Sbjct: 184 PQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGVKYL 243

Query: 237 GEGLAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFITLAT 296
           G  LA+YII  LY   + KISF+GHSLGGLIQ+FAI+ I  ++PWFF+KV P+NFITLA+
Sbjct: 244 GTRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFITLAS 303

Query: 297 PFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKEHYDNILYLLSGEPIK---------SIM 347
           P LGIVTDNP+Y+K+LLS G+IGKTG DLGL+   +       G+P+           I+
Sbjct: 304 PLLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVE------VGKPLLYLLSGLPLIEIL 357

Query: 348 KKFERRTLYANAMNDGIVPLYTSCLLFLDYADVLSELDNLKR-SIKITIDTPESGRESEK 406
           ++F+RRT+YANA+NDGIVPLYT+ LLFLDY D+L +L  LK  S K  +    S   ++ 
Sbjct: 358 RRFKRRTVYANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSKKSPLINDASTPVNQD 417

Query: 407 IINTS--SSWSKVFK----HRKEDKHSVKLPKTSIIESMASILQPPSPTDEYITNPSSRA 460
             N +  S  +K+       +   ++  ++PK S  ES +SIL PP P   YI +P SR 
Sbjct: 418 FFNKTFISPLTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRD 477

Query: 461 KVIIHDKVYTEDDIER----IESNFYKLKNDRLLSRFYRRHSTGKQNERLEVEIAKRWHS 516
            VIIHDK+Y EDDI +    IE  F+  KN  LL  F+       +   LE  IA+RWH 
Sbjct: 478 PVIIHDKIYNEDDIPQSEFDIEDGFFGKKN-ILLQAFFAGKKERAKYRNLEETIARRWHE 536

Query: 517 GTPWRKVIVALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHF 558
           G  WRKV+VAL  +AHNNIIVRR+F+N YGW VIDHLI+ HF
Sbjct: 537 GMAWRKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHF 578

>KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c, start by similarity
          Length = 677

 Score =  503 bits (1295), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 272/608 (44%), Positives = 384/608 (63%), Gaps = 45/608 (7%)

Query: 6   SDDQVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFKAAYLM 65
           SD  ++Y   S ++IG + RYI  Y+LY GDEIP+ ++LD L L IKN    + +AAYLM
Sbjct: 30  SDHDIMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAYLM 89

Query: 66  GPFTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWIIDVIS 125
           GP+ LY DVR + YHHKQR+  S D PQF SN+QP   FIAELSLH +KK+YVWI+D+ S
Sbjct: 90  GPYVLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKRYVWIVDIAS 149

Query: 126 QSIFSLNSVTSFELTLG--------TTTNNYNSG---SSLEVETLSTDVIWNEKATIPLL 174
           Q +F+  +  +F +T+G         +  N   G   S ++V+ L+T  +WN      LL
Sbjct: 150 QILFTKQASINFSITVGGSKESISVDSARNIQLGVQSSRMKVDRLTTADLWNAS----LL 205

Query: 175 RES---RKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEM 231
            +S   R+  HLVILTHG+HSNVT+D+ Y+ EQI  TQ+ +  E +VVKG+  NVCKTE 
Sbjct: 206 SKSVFGRRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQNQHE-EMLVVKGFTDNVCKTEK 264

Query: 232 GIKFLGEGLAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNF 291
           GIK+LG  LA++I+  LY+    KISFIGHSLGGL+QSFAI+ I+  +P FFE+V+PVNF
Sbjct: 265 GIKWLGTRLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNF 324

Query: 292 ITLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKEHYDNILYLL----SGEPIKSIM 347
           IT+A+P LGIV+DN  Y++ LL+ GI GKTG DL L+ +      LL    S   ++ I+
Sbjct: 325 ITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRIL 384

Query: 348 KKFERRTLYANAMNDGIVPLYTSCLLFLDYADVLSELDNLKRSIKITIDTPESGRESEKI 407
           K F+  T+YANA NDGIVPLYTS LLFLDY D+L +L+       +  +  ++       
Sbjct: 385 KCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLN-------MNTEDLQTDFFQRNF 437

Query: 408 INTSSSWSKVFKHRKEDKHSVKLPKTSIIESMASILQPPSPTDEYITNPSSRAKVIIHDK 467
           I+  +    +   ++  ++  K+P  S+++S  S+L PP P   YIT+P +R  V++HDK
Sbjct: 438 ISPLTKAMDILMPQRVSQNGTKIPVASMLDSAYSVLIPPLPDKSYITDPKTRKDVVVHDK 497

Query: 468 VYTEDDIERIESN--FYKLKNDRLLSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRKVIV 525
           VY+  DI   +SN     + +  +L + +   + G Q ++LE +IA+ WH    WRKVI+
Sbjct: 498 VYSGQDIPDHQSNSQLEVMNSSNVLLKTFNI-AFGGQYKKLEEQIARNWHKDVKWRKVII 556

Query: 526 ALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHFNGSDSLLVHNNEEQAVMKATMEP---N 582
            L  +AHNNII RRRFSN YGW V+DHL E HF          N++++     ++P   +
Sbjct: 557 NLKPDAHNNIITRRRFSNAYGWPVVDHLTETHF---------LNDDKSSRSWKLDPISKD 607

Query: 583 KEFSWITK 590
           ++F WI K
Sbjct: 608 EDFDWIVK 615

>CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 592

 Score =  394 bits (1011), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 235/598 (39%), Positives = 349/598 (58%), Gaps = 67/598 (11%)

Query: 46  PLKLTIKNKVRKSFKAAYLMGPFTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFI 105
           P+ + ++N+ + + +A YL+GPF LYCD R     ++   V     PQF +N++P  KF 
Sbjct: 27  PVFVRLRNRTKATRRATYLLGPFVLYCDSRPVIPANQNEYV-----PQFKANIEPQGKFT 81

Query: 106 AEL---SLHEIKKKYVWIIDVISQSIFSLNSVTSFELTLGTTTNNYNSGSSLE--VETLS 160
            +L      ++  K  WIIDV+S+ +F+  +   +EL +    NN+      +   E++ 
Sbjct: 82  FQLKPEDARDVGGKRCWIIDVVSEVLFNQITKVDYELLISLDINNFKKSKYQQDIYESIE 141

Query: 161 TDVIWNE------------KATIPLLRESRKMIHLVILTHGMHSNVTADMSYLMEQIYNT 208
            DV+  +             A I   +   +  HLVI+THGM SNV+ DM Y+MEQ+   
Sbjct: 142 GDVVAKQYSNHDIQEFIEVGAKIKKSQTKERNQHLVIVTHGMISNVSNDMMYIMEQLRAI 201

Query: 209 QSLYSNEKIVVKGYVGNVCKTEMGIKFLGEGLAKYIIDTLYSVEVAKISFIGHSLGGLIQ 268
                +E++++ GY GNVC+TE+GIK LG  LA YI+   Y+  + KISFIGHSLGGL+Q
Sbjct: 202 DRDDLDEELILDGYTGNVCRTELGIKNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQ 261

Query: 269 SFAISSIAVLHPWFFEKVKPVNFITLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLK 328
           +FAI+ I +LH WFF+ VKPVNFI+LATPFLG+ +   +Y K LLS+G +G+TG DL   
Sbjct: 262 TFAIAYIYILHGWFFDAVKPVNFISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYH 321

Query: 329 EHYD----NILYLLSGEPIKSIMKKFERRTLYANAMNDGIVPLYTSCLLFLDYADVLSEL 384
            H      +ILYLLSG+P  SI++KFERRTLYANA+NDGIVPL +S LL+LDY+ +L + 
Sbjct: 322 SHNKLKNFSILYLLSGDPAHSILQKFERRTLYANAINDGIVPLASSALLYLDYSKILKDS 381

Query: 385 DNLKR---SIKITIDTPESGRESE--KIINTSSSWSKVFKHRKEDKHSVKLPKTSIIESM 439
             LK+    I+  + T +  ++SE  K+    +  SK+F+            + S+  ++
Sbjct: 382 KLLKKETDDIRSIVMTWKEFQDSEDFKVYKKVNPKSKIFR------------RVSLTNTV 429

Query: 440 ASILQPPSPTDEYITNPSSRAKVIIHDKVYTEDDIERIESNFYKLKN-DRLLSRFYRRHS 498
            +++ P  P      N +S  KV+IHD+VY  +DI   +S ++     D +++    RH 
Sbjct: 430 GNLVLPEPP-----KNITSDMKVLIHDQVYQYNDIP--DSEYFPPDGIDEIMA--MDRH- 479

Query: 499 TGKQNERLEVEIAKRWHSGTPWRKVIVALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHF 558
                 +L+  +A+RWH+G  WRKVIV L  +AHN+I VRRR+SN  GW VI H+I NHF
Sbjct: 480 ------QLQECMARRWHAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHF 533

Query: 559 NGSDSLLVHN----NEEQAVMKATMEPNKEFSWITKVEDPCSYSGGLLSRTTKLLDTM 612
                  V      ++  +  +A MEPNK ++W+ K ED     GGL+ R T  L+ +
Sbjct: 534 IKPQKCDVPEADIVSQPASRDEADMEPNKTYAWLLK-ED--KEKGGLIRRATNALNPI 588

>AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)
           [1911 bp, 636 aa]
          Length = 636

 Score =  298 bits (764), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 206/623 (33%), Positives = 308/623 (49%), Gaps = 92/623 (14%)

Query: 10  VLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFKAAYLMGPFT 69
           +LY D   +  G + RYIIK +     ++     ++ L L IKN      +  YL GP++
Sbjct: 24  LLYNDQRGISQGEVFRYIIKVD---KAQLDAKTKIEELVLRIKNVESPLLRPIYLTGPYS 80

Query: 70  LYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKK-----YVWIIDVI 124
           +Y +VR   Y++ +      D  QFIS+L+P   F A L L+   +      Y W  DV+
Sbjct: 81  VYAEVRP--YNYDENTAFQGDDLQFISDLKPDEAFSATLKLNGDSQVLESTVYSWTADVL 138

Query: 125 SQSIFSLNSVTSFELTLGTTTNNYNSG-----------SSLEVETLSTDVIWNEKATIPL 173
           SQ  + ++      L++G T +   +            S   VE   T  +WNE    P 
Sbjct: 139 SQMTWMVDHPILVRLSIGNTRSIGKAAMKTPARAVEPVSGFTVEIQDTMTVWNEPPLFP- 197

Query: 174 LRESRKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLY---SNEKIVVKGYVGNVCKTE 230
                + +HLVI+THG+ SN+  DM YL +++           N+ +VV+GY GN+ K+ 
Sbjct: 198 ----ERPVHLVIVTHGIFSNIGCDMLYLRDRLKKCAHAVEENCNQNVVVRGYHGNIGKSH 253

Query: 231 MGIKFLGEGLAKYIIDTLYSVE----VAKISFIGHSLGGLIQSFAISSIAVLHPWFFEK- 285
            GI++L   +A Y++ T+  +     + +ISFIGHSLGGL+Q+FAI  +    P  F   
Sbjct: 254 KGIEYLAMRVADYVLKTIAQMPNEYFLDRISFIGHSLGGLVQTFAIQYMLERDPGIFSPQ 313

Query: 286 ---VKPVNFITLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKEHY----------- 331
              ++P+NFI LA+PFLG++ D P Y  + L+ G +G+TG DL LK  +           
Sbjct: 314 AGGLRPMNFIALASPFLGVIGDFPLYATVALNFGALGRTGKDLNLKNDFAISELVRNPKQ 373

Query: 332 ----DNILYLLSGEPIKSIMKKFERRTLYANAMNDGIVPLYTSCLLFLDYADV------- 380
                 +L  +    +KS+++ F  RTLYANA++DGIVPL TS LL+LD+  +       
Sbjct: 374 AYNRRPVLESIVSGSMKSVLQAFSNRTLYANALHDGIVPLRTSALLYLDWYSLQEVNLIG 433

Query: 381 ---------LSELDN-LKR--SIKITIDTPESGRE-----SEKIINTSSSWSKVFKHRK- 422
                    L E D+ LKR  +++I  D  E            +I     W K  +  K 
Sbjct: 434 AQEGAETFDLGEEDHALKRYDTVEIPPDLSEKKDTIRWLLPRALIKRRHKWYKRSQTVKP 493

Query: 423 -------EDKHSVKLPKTSIIESMASILQPPSPTDEYITNPSSRAKVIIHDKVYTEDDIE 475
                  ED     L K S + S A+IL  P PT +Y  +P SR   I HDK Y+    E
Sbjct: 494 GIEQLWDEDSDYHPLTKASALSSAANILVAPPPTQDYYKDPQSRTDYIFHDKRYSP---E 550

Query: 476 RIESNFYKLKNDRLLSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRKVIVALGSEAHNNI 535
            +   +Y  +N  LL +         +  R + +IA+ +     WRKV+V +  E+HNNI
Sbjct: 551 ELPPAYY--RNRELLKKIL---YPNDKVHRTQEKIARGYQESMSWRKVLVNIQPESHNNI 605

Query: 536 IVRRRFSNGYGWEVIDHLIENHF 558
           IVRRRF N +GW VI+HL+  HF
Sbjct: 606 IVRRRFVNSFGWIVIEHLVNEHF 628

>YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unknown
           function, has low similarity to C. albicans Orf6.7404p
           [2064 bp, 687 aa]
          Length = 687

 Score =  293 bits (749), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 203/641 (31%), Positives = 319/641 (49%), Gaps = 110/641 (17%)

Query: 10  VLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFKAAYLMGPFT 69
           +L  +   ++IG + RY    N     E    + +  L L IKN+     +  YL GP++
Sbjct: 21  LLVDERKRLRIGELYRYKFSVNKDVIKE--QGLDVSHLFLRIKNEESALLRPLYLTGPYS 78

Query: 70  LYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKK-----YVWIIDVI 124
            Y DVR  +Y+  ++    + +P F+ NL+P  +F  ++ L+E  +      Y W ID+I
Sbjct: 79  FYIDVRPHNYNENRKFPGKEIIP-FVENLKPDERFKVKILLNENSRVGDTSLYSWTIDII 137

Query: 125 SQSIFSLNSVTSFELTLGTT------TNN-YNSGSSLEVETLSTDVIWNEKATIPLLRES 177
           SQ   +      F   +GTT      +N  + S   + +E   T+ +W+     P     
Sbjct: 138 SQLAVTTIPKLEFSFRIGTTRKVVKKSNGLFKSIEGVSLEMWDTETLWDLPPKFP----- 192

Query: 178 RKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYS---NEKIVVKGYVGNVCKTEMGIK 234
            K +HLVI+THG+ SN+  DM Y+ ++I           N  I+V+G++GNV K+  GI 
Sbjct: 193 EKPVHLVIMTHGIFSNIGCDMLYMKDKIEEMTFPMDESINPNIIVRGFMGNVGKSGHGIH 252

Query: 235 FLGEGLAKYIIDTLYSV----EVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVK--- 287
            LG  + KY+++T+  +    +V +ISFIGHSLGG  QS A+  I++  P FF+ VK   
Sbjct: 253 CLGVRVGKYVLETVDKLNKKYKVDRISFIGHSLGGPTQSMAVRYISIKRPDFFDAVKGVK 312

Query: 288 PVNFITLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLK------------------E 329
           PVNFITLA+PF+G++ D P Y+ + L  G +G TG DL LK                  E
Sbjct: 313 PVNFITLASPFIGVIGDFPFYLSVPLDMGALGLTGRDLNLKYTPLTSKDGLYADDEVYPE 372

Query: 330 HYDNILYLLSGEPIKSIMKKFERRTLYANAMNDGIVPLYTSCLLFLDYADVLSELDNLKR 389
           H   IL +L   P K + + F+RRT+YAN M+DGIVPL T+ LL+LD+  +  ++  +++
Sbjct: 373 HSKYILEILPQAPAKKVFESFKRRTIYANVMDDGIVPLRTAALLYLDWRSI-HKVQKIRK 431

Query: 390 SIK--------ITIDTPE-SGRESEKIINTSS---------------SW---------SK 416
             K        ++ D+PE SG  S    N ++                W         SK
Sbjct: 432 KNKNSPTSSEFVSSDSPESSGASSPSNENGNNVGEIPAESPNKKATLQWTLPQAVIHGSK 491

Query: 417 VFKHRKE-----------------DKHSVKLPK-TSIIESMASILQPPSPTDEYITNPSS 458
           + K+++                  D    + PK  + + S  S+L    P  EYI NP+ 
Sbjct: 492 INKYKRGQTNEANSDSDNEQGVFLDGQKFEPPKEANTVLSALSVLTAAIPDQEYIKNPAV 551

Query: 459 RAKVIIHDKVYTEDDIERIESNFYKLKNDRLLSRF-YRRHSTGKQNERLEVEIAKRWHSG 517
           R   +IHDK+Y  +++          +N  ++ +  Y   S  +  ER    IA+ W   
Sbjct: 552 RKDEVIHDKLYHPEELPPPH-----YENRPIVKKLIYPNESVNRIQER----IAREWQET 602

Query: 518 TPWRKVIVALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHF 558
             WRKV+V +  ++HNNI+VRRRF N YG+  ++H++E+HF
Sbjct: 603 MTWRKVLVQIQPDSHNNIVVRRRFVNLYGYVAVEHMVEHHF 643

>KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyces
           cerevisiae YDR444w, start by similarity
          Length = 640

 Score =  288 bits (736), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 206/643 (32%), Positives = 322/643 (50%), Gaps = 109/643 (16%)

Query: 10  VLYQDTSEVKIGGIRRY--IIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFKAAYLMGP 67
           +L ++T  + IG + RY  I+  N    D I  T   D L L  KN+     +  ++ GP
Sbjct: 19  LLLRETGSLGIGDVNRYKIIVDKNKLLSDGIECTD--DTLYLEFKNQESALLRPLWITGP 76

Query: 68  FTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKK-----KYVWIID 122
           +++Y ++   +Y  +++ +   D  +F+S+L+P   F A+L L+   +      Y W ID
Sbjct: 77  YSIYVEITPNNYDERKQFIG--DGIEFMSDLKPDENFKAKLYLNSNARVDGTSCYAWKID 134

Query: 123 VISQSIFSLNSVT--SFELTLGTTTNN-----------YNSGSSLEVETLSTDVIWNEKA 169
           +I+Q  F++ ++    F  TL TT                    L++  L T+ +WN   
Sbjct: 135 LIAQ--FTVVTIVRLPFVFTLATTYKTAKHSQKDKNIEVQQTDGLKISKLDTEQLWNLPP 192

Query: 170 TIPLLRESRKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLY---SNEKIVVKGYVGNV 226
             P      K +HLVI+THG+ S++  DM  L + I    +     +N  +V++GY GNV
Sbjct: 193 PFP-----DKPVHLVIITHGIFSSIGGDMLCLKDTIERASNFLPDDNNGNLVIRGYPGNV 247

Query: 227 CKTEMGIKFLGEGLAKYIIDTLYSVE----VAKISFIGHSLGGLIQSFAISSIAVLHPWF 282
            K+  GI+ LG  LA+YIIDT+  ++    + +ISF+GHSLGG +Q+ AI  I+V  P  
Sbjct: 248 GKSHKGIRHLGFKLAEYIIDTIDKLQQQFTLTRISFVGHSLGGPVQAMAIHYISVERPDI 307

Query: 283 FEK---VKPVNFITLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKEHY-------- 331
           F+K   + PVNF+  A+PFLG++ D P Y+ ++L  G +G+TG DL LK  Y        
Sbjct: 308 FDKTTGLTPVNFVAAASPFLGVIGDLPKYISIVLDIGALGQTGRDLTLKRSYFLPSKGIV 367

Query: 332 -----------DNILYLLSGEPIKSIMKKFERRTLYANAMNDGIVPLYTSCLLFLDYADV 380
                        IL LL   P   + ++F+ RT+YAN   DGIVPL T+ LL+LD+   
Sbjct: 368 NNDGSHDRIKSKPILELLPKHPALEVFQRFKCRTVYANVAFDGIVPLRTAALLYLDWRG- 426

Query: 381 LSELDNLKRSIKITI-------------DTPESGRESEKIINTSSSWSKVFKHRKED--- 424
           LS++  ++                    + PES  +++ I+      S + K + +    
Sbjct: 427 LSDVQQVRSENNAQSEEGVEEQKGSSLGEIPESSSDNKSILQWLLPQSLIKKEKYKPYVR 486

Query: 425 --------------------KHSVKLP-KTSIIESMASILQPPSPTDEYITNPSSRAKVI 463
                                 + K P K + +++ AS +  P P   Y+ +PSSR   I
Sbjct: 487 TQTTSSVESASSDSNNNSDSPTTFKPPKKANTLQAAASTISAPLPGMSYLVDPSSRTDRI 546

Query: 464 IHDKVYTEDDIERIESNFYKLKNDRLLSR-FYRRHSTGKQNERLEVEIAKRWHSGTPWRK 522
           IHDKVYT    E +    YK K  +L+ +  Y  +S   + ER    IA+ W     WRK
Sbjct: 547 IHDKVYTP---EELPDKHYKHK--KLVKKIIYPNYSIHMKEER----IARYWQETMDWRK 597

Query: 523 VIVALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHFNGSDSLL 565
           VIV L  ++HNNIIVRRRF N +GW V++H+ + HF GS +++
Sbjct: 598 VIVELQPDSHNNIIVRRRFVNSFGWIVVNHIADEHF-GSKAMI 639

>CAGL0M10043g complement(999113..1001089) similar to tr|Q04093
           Saccharomyces cerevisiae YDR444w, hypothetical start
          Length = 658

 Score =  281 bits (719), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 214/649 (32%), Positives = 309/649 (47%), Gaps = 118/649 (18%)

Query: 10  VLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFKAAYLMGPFT 69
           +L  + + + IGG+ RYI++ +     E    I    L L  KN      +  YL GP+ 
Sbjct: 8   LLVHEKNSLGIGGMCRYILQVDHKKLKE--DGIDTQELYLRFKNLESPLLRPVYLTGPYA 65

Query: 70  LYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLH---EIKKK------YVWI 120
            Y DVR  +Y   +  + S+DV  F S+L+P  KF A+L  +    ++ K      Y W 
Sbjct: 66  FYIDVRPCNYDEDKTYIGSEDV-AFCSDLKPDEKFKAKLYFNANSRLQTKNARDEIYSWT 124

Query: 121 IDVISQSIFSLNSVTSFELTLGTTTNNY--------NSGSSLEVETLSTDVIWNEKATIP 172
           ID+ISQ       +  +   +GT+             S   L ++      +WN     P
Sbjct: 125 IDIISQLAVVTFPILKYSFKVGTSKKIVKKSKGKKVTSVRGLSLKMWDEKSLWNLPPKYP 184

Query: 173 LLRESRKMIHLVILTHGMHSNVTADMSYLMEQI----YNTQSLYSNEKIVVKGYVGNVCK 228
                 K IHLVILTHG+ SNV  DM Y+ ++I     N +  Y N  +VV+G + N+ K
Sbjct: 185 -----DKPIHLVILTHGIFSNVGCDMLYMKDKIEQTAMNIEERY-NPNVVVRGCMDNMGK 238

Query: 229 TEMGIKFLGEGLAKYIIDTLYSVE----VAKISFIGHSLGGLIQSFAISSIAVLHPWFFE 284
           +  GI +LG+ LAK+++ T+  +     V KISFIGHSLGG  QS AI  I+V++P FF 
Sbjct: 239 SAHGIYYLGKRLAKFVVRTVEELRKEYHVDKISFIGHSLGGPTQSMAIHYISVMYPDFFN 298

Query: 285 KV---KPVNFITLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLK------------- 328
            V   KP++FI LA+PF+G++ D P Y+ + L  G +G TG DL LK             
Sbjct: 299 TVSGIKPMHFIALASPFIGVIGDFPLYLSVPLDMGALGLTGRDLNLKYTPLTSNEGLSAL 358

Query: 329 ------EHY-DNILYLLSGEPIKSIMKKFERRTLYANAMNDGIVPLYTSCLLFLDYADVL 381
                  H   NIL ++   P + + + F  RTLYAN ++DGIVPL T+ LL+LD+   L
Sbjct: 359 TLAQENSHLPKNILEIIPQPPAQQVFQLFMNRTLYANIVHDGIVPLRTAALLYLDWRS-L 417

Query: 382 SELDNLKRSI------KITIDTP---ESGRESEKI-----INTSSSWSKVFKHRKEDKHS 427
           +++ ++K+S       KIT D+P   ES   + K      I + S  SK F      +  
Sbjct: 418 TQVKDIKKSAGEKSNNKITEDSPTDNESVSTTNKDNKMGEIPSESPNSKNFLQWALPQVI 477

Query: 428 VKLPK--------------------------------------TSIIESMASILQPPSPT 449
           +K PK                                       S   S  S L  P PT
Sbjct: 478 IKGPKMNKFKRGQIMDTKSNESSDTDTESSDSKQEQKFKGPSEASTFMSALSTLTAPVPT 537

Query: 450 DEYITNPSSRAKVIIHDKVYTEDDIERIESNFYKLKNDRLLSRFYRRHSTGKQNERLEVE 509
            EYI NP  R   ++HD+VY   D+   E ++  LK   +    Y   S  +  ER    
Sbjct: 538 QEYIKNPKVRKDRVVHDRVYEPQDLP--EQHY--LKRSTMKRVVYPNESVNRIQER---- 589

Query: 510 IAKRWHSGTPWRKVIVALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHF 558
           IA+ W     WRKV+V +  ++HNNI+VRRRF N YG   + H++  HF
Sbjct: 590 IARAWQMNMSWRKVLVEIQPDSHNNIVVRRRFVNLYGNVAVSHMVREHF 638

>Kwal_47.18482
          Length = 623

 Score =  276 bits (706), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 196/634 (30%), Positives = 316/634 (49%), Gaps = 95/634 (14%)

Query: 1   MAKSISDDQVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFK 60
           M  +  +D +L  D  ++ +G + RY +  +    D+  + I+     LT KN      +
Sbjct: 1   MTFTTEEDLLLVDDRLKLGLGELVRYNVTVDRSLLDDHLSHIT--EFYLTFKNTESAFLR 58

Query: 61  AAYLMGPFTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLH-----EIKK 115
             YL GP++ Y DV  Q  ++ +RI  ++ + QF  +++P+ ++ A L L+     E  +
Sbjct: 59  PIYLTGPYSFYVDV--QPCNYDERIPFNEKL-QFCEDVKPNEEYRAVLQLNDNSRVEESE 115

Query: 116 KYVWIIDVISQSIFSLNSVTSFELTLGT------TTNNYNSGSSLEVETLSTDVIWNEKA 169
           ++VW I+V+SQ   +   V  F L +         ++   S      E   T  +WN   
Sbjct: 116 RFVWQINVMSQLSVTKIPVLGFRLCISCGKSSEIPSSPVTSIKGFVCEKWDTHGLWNLPP 175

Query: 170 TIPLLRESRKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNE----KIVVKGYVGN 225
             P      + +HLV+LTHG+ SNV  D+ YL ++I    S+   +     +VV+GY+GN
Sbjct: 176 RFP-----DRPLHLVVLTHGIFSNVGCDLVYLKDRIEAAASVAGKDSKTSNLVVRGYMGN 230

Query: 226 VCKTEMGIKFLGEGLAKYIIDTLYSV----EVAKISFIGHSLGGLIQSFAISSIAVLHPW 281
             ++  GIK  G  LAK+II+T+  +    ++  ISF+ HSLGG  Q+ AI  I +  P 
Sbjct: 231 QGRSSKGIKANGVRLAKFIIETVDDLKEEYDLQYISFVAHSLGGPSQAMAIRYICLERPD 290

Query: 282 FFEK---VKPVNFITLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKEHY----DNI 334
            F+    +KP+NFITLA+P+LGI  + P +V + L  G++G+TG DL L   +    D I
Sbjct: 291 IFDPAKGLKPLNFITLASPYLGIAGEVPPFVTLALDVGVLGQTGADLNLNRTFFLSKDGI 350

Query: 335 ---------------LYLLSGEPIKSIMKKFERRTLYANAMNDGIVPLYTSCLLFLDYAD 379
                          L ++   P+  ++++FE RT+YAN ++DGIVPL T+ LL+LD+  
Sbjct: 351 VRKDEKLGSYRRKPLLEIIPSRPLTELIQRFENRTIYANILHDGIVPLRTAALLYLDWK- 409

Query: 380 VLSELDNLKR-SIKITIDTPESGRESEKI-------INTSSSWSKVFKHRKEDKHSVKLP 431
            L ++  ++R + K    TP S  E + I       ++  S+   +       +   K  
Sbjct: 410 ALGDVRGIRRENGKDDEGTPYSSNEKDAIGKIPEEKMDKQSALKYLMPQAALRRKYKKYT 469

Query: 432 KTSII------------ESMASILQPPS---------------PTDEYITNPSSRAKVII 464
           +T I+            ES   I  PPS               PT +Y+ NP  R   I+
Sbjct: 470 RTQILSQESGNENSYSEESTEPISPPPSANPLVSAANIIVAPLPTQKYLQNPKEREDKIV 529

Query: 465 HDKVYTEDDIERIESNFYKLKNDRLLSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRKVI 524
           HDK+Y  D+   +    Y+ K D L    Y      +  ER    IA++W     WRKV+
Sbjct: 530 HDKIYYPDE---LPPAHYR-KRDVLKKIIYPNDRIYRVQER----IARQWQETMNWRKVL 581

Query: 525 VALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHF 558
           V++  ++HNNI+VRR+F N +GW V+DHL++ HF
Sbjct: 582 VSIEPDSHNNIVVRRKFVNAFGWVVVDHLVKEHF 615

>Scas_717.50
          Length = 658

 Score =  228 bits (580), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 142/408 (34%), Positives = 219/408 (53%), Gaps = 48/408 (11%)

Query: 10  VLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFKAAYLMGPFT 69
           +L  +T ++ IG + RYII  +    ++  + I ++ L L IKN+     +  YL GP+T
Sbjct: 18  LLLNETKKLGIGDLSRYIISVDKKKLED--SGICIEELFLRIKNEESPLLRPVYLTGPYT 75

Query: 70  LYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKK-----KYVWIIDVI 124
            Y DVR  +YH  + I    +V  F  +L+P ++F  ++ L++  +      Y W +D++
Sbjct: 76  FYVDVRPHNYHEDE-IFEGDEVIPFCEHLKPDARFKTKIFLNKHSRVANTNTYSWTVDIL 134

Query: 125 SQSIFSLNSVTSFELTLGTTTNNYNSGS---------SLEVETLSTDVIWNEKATIPLLR 175
           SQ          +   + TT     +GS           EV+ L T  +W+     P   
Sbjct: 135 SQLCVIPTPTLKYSFRIATTKKETKNGSKGKKPVKMDGFEVKLLDTSSLWSFPPKYP--- 191

Query: 176 ESRKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYS---NEKIVVKGYVGNVCKTEMG 232
              K +HLVI+THG+ SN+  DM Y+ ++I  T +      N  +VV+G + N+ K+  G
Sbjct: 192 --NKPVHLVIMTHGIFSNIGCDMLYMKDKIEETANSVPEDINPNVVVRGCMKNMGKSAHG 249

Query: 233 IKFLGEGLAKYIIDTLYSV----EVAKISFIGHSLGGLIQSFAISSIAVLHPWFF---EK 285
           + +LG+ +A+YII+T+  +    +V KISFIGHSLGG  Q  A+  I+V  P  F   + 
Sbjct: 250 VHYLGKRVAEYIIETVDELNKKYKVDKISFIGHSLGGPTQGMAVHYISVKRPDIFHPTKG 309

Query: 286 VKPVNFITLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLK----------------E 329
           +KPVNFITLA+PF+G++ D P YV + L AG +G TG DL LK                 
Sbjct: 310 IKPVNFITLASPFIGVIGDFPLYVSLPLDAGSLGLTGRDLNLKYTPLTSKDGLTTDGNAA 369

Query: 330 HYDNILYLLSGEPIKSIMKKFERRTLYANAMNDGIVPLYTSCLLFLDY 377
               IL ++   P  +I ++F  RTLYAN ++DGIVPL T+ LL+LD+
Sbjct: 370 KTKLILEIIPQPPALAIFERFVHRTLYANVVHDGIVPLRTAALLYLDW 417

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 71/130 (54%), Gaps = 11/130 (8%)

Query: 431 PKTSIIESMASILQPPSPTDEYITNPSSRA-KVIIHDKVYTEDDIERIE-SNFYKLKNDR 488
           P+ S + +  S+L  P P+ EYI NP  R    I+HDK+YT  +I R   +N   +K   
Sbjct: 526 PEASTMLAALSVLTAPLPSQEYIKNPEVRHHDAIVHDKIYTPKEIPRAHYANRPAIKK-- 583

Query: 489 LLSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRKVIVALGSEAHNNIIVRRRFSNGYGWE 548
                Y   S  +  ER    IA++W     WRKV+V +  ++HNNI+VRRRF N YG  
Sbjct: 584 ---VIYPNESVNRTQER----IARQWQMTMNWRKVLVKIKPDSHNNIVVRRRFVNLYGDV 636

Query: 549 VIDHLIENHF 558
            + H++E HF
Sbjct: 637 AVSHMVEEHF 646

>KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF13423
           Candida albicans unknown function, start by similarity
          Length = 531

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 105/205 (51%), Gaps = 15/205 (7%)

Query: 181 IHLVILTHGM---HSNVTADMSYLMEQIYNTQSLYS-NEKIVV-KGYVGNVCKTEMGIKF 235
           IHLV+L HG+    S++    +YL+    ++    S NE IVV + ++    KT  GI  
Sbjct: 15  IHLVVLVHGLWGNRSHMNEICNYLLSLNDSSAGHKSLNEMIVVHQTHLNEGYKTYDGIDV 74

Query: 236 LGEGLAKYIIDTLY---SVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFI 292
            G  ++K I D +    S  V K S IG+SLGGLI  +A+  +     +    ++ VNFI
Sbjct: 75  CGIRVSKEIKDQINHYGSDHVVKFSLIGYSLGGLICRYALGVLYQAQTFKKNDIELVNFI 134

Query: 293 TLATPFLGIVTDNPSYVKMLLS---AGIIGKTGVDLGLKEHYDN--ILYLLSGEP--IKS 345
           T  TP +G++    +    L +     ++G +G  + LK+ Y+   +LY++S        
Sbjct: 135 TFCTPHVGVLAPGNNVAVNLFNIIVPLVLGNSGKQMFLKDKYNGYPLLYVMSSPSSVFYK 194

Query: 346 IMKKFERRTLYANAMNDGIVPLYTS 370
            +K+F+ R LYAN +ND     +TS
Sbjct: 195 ALKQFKYRALYANIINDKRTAWWTS 219

>Kwal_55.21703
          Length = 441

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 98/217 (45%), Gaps = 27/217 (12%)

Query: 182 HLVILTHGM-----HSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTE-MGIKF 235
           HL +L HG+     H N   D+       +     +S  +    GY       E MG + 
Sbjct: 5   HLFVLVHGLWGNYKHMNAIRDVFAETFHDHENTLFFSPRQ---NGYFKTFDGIEIMGYRT 61

Query: 236 LGEGLAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFITLA 295
           L E L ++I +     E+ KISF+G+S+GGLI  F I  +       F+ ++P  FIT A
Sbjct: 62  LLE-LCRFI-EQFPKGEITKISFVGYSMGGLIARFMIGKMFTECHELFQCIEPQLFITFA 119

Query: 296 TPFLGI----VTDNPSYVKML------LSAGIIGKTGVDLGLKEHY--DNILYLLSGEPI 343
           TP LG+      D  S+ + L      L   I+G+TG  L +++     +IL  LS    
Sbjct: 120 TPHLGVHFFLKEDRASHRRALLRILSALGTTILGRTGRQLFIQDSLPEQSILVQLSSGEY 179

Query: 344 KSIMKKFERRTLYANAMNDGIVPLYTS----CLLFLD 376
              + +F+ R   AN  ND  V  YTS    C  FLD
Sbjct: 180 LHGLARFKHRLCVANVKNDRTVAFYTSFITDCDPFLD 216

>AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp,
           504 aa]
          Length = 504

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 100/209 (47%), Gaps = 22/209 (10%)

Query: 181 IHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEMGIKFLGEGL 240
           IHLV L HG+  NVT  M YL   +   Q       +V    +    +T  GI   G  +
Sbjct: 4   IHLVFLVHGLWGNVT-HMEYLGRAVSQLQERSPETLVVYAAKMNQGYRTYDGIDICGYRV 62

Query: 241 AKYI---IDTLYSVE----VAKISFIGHSLGGLIQSFAISSIAVLHPWFFEK--VKPVNF 291
           AK I   + TL   E    V K S +G+S+GGLI  +A+  +      FF+K  +K +NF
Sbjct: 63  AKEIQEQVATLNCPETGTVVTKFSIVGYSMGGLISRYAVGLLYSNQ--FFKKQDIKLINF 120

Query: 292 ITLATPFLGIVTDNPSY---VKMLLSAGIIGKTGVDLGLKEHYDN------ILYLLSGEP 342
            T  +P +G++    +    V   + + I+G +G  + LK+          I+ +  G+ 
Sbjct: 121 TTFCSPHVGVLAPGKNLAVRVFNFVCSLILGNSGRQMFLKDRIKAANGMPLIVLMSVGDS 180

Query: 343 I-KSIMKKFERRTLYANAMNDGIVPLYTS 370
           I    +++F+ R+LYAN +ND     +TS
Sbjct: 181 IFYKALEQFQHRSLYANIVNDKRTAWWTS 209

>YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.7873p [1353 bp, 450 aa]
          Length = 450

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 131/284 (46%), Gaps = 27/284 (9%)

Query: 182 HLVILTHGMHSNVTADMSYLMEQIYNT---QSLYSNEKIVVKGYVGNVCKTEMGIKFLGE 238
           HL +L HG+  N T   S  M  I +T   +   +++ I        + KT  GI+ +G 
Sbjct: 6   HLFVLIHGLWGNYTHMES--MRTILSTTLKKEDVNDDMIYFLPKQNAMFKTFDGIEIIGY 63

Query: 239 G----LAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFITL 294
                + ++I D     ++ K+S +G+S GGL+  F I  +       FE ++P  FIT+
Sbjct: 64  RTLIEVCEFIRD-YKDGKITKLSVMGYSQGGLVARFMIGKMLTEFKELFEDIEPQLFITM 122

Query: 295 ATPFLGIVTDNP---SYVKMLLSA------GIIGKTGVDLGLKEHYDNILYLLSGEPIKS 345
           ATP LG+   NP   +Y   L SA       I+GK+G ++ +    +NIL  LS      
Sbjct: 123 ATPHLGVEFYNPTGIAYKSALYSALRTLGSTILGKSGREMFIANSSNNILVKLSQGEYLE 182

Query: 346 IMKKFERRTLYANAMNDGIVPLYTSCLLFLDYADVLSELDN-LKRSIKITIDTPESGRES 404
            +  F+ R  +AN  ND  V  YT+   F+   D   + DN LK + +  I  P SG + 
Sbjct: 183 ALSLFKWRIAFANVKNDRTVAFYTA---FITDCDPFIDFDNKLKYTFEEKI--PGSGYKG 237

Query: 405 --EKIINTSSSWSKVFKHRKEDKHSVKLPKTSIIESMASILQPP 446
              KI++ ++         K  K   K  +T +I  +A+ L  P
Sbjct: 238 ILPKIVDLNALNVNSHAPTKPTKTYKKWGRTILIILVATFLILP 281

>ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)
           [1332 bp, 443 aa]
          Length = 443

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 97/224 (43%), Gaps = 29/224 (12%)

Query: 182 HLVILTHGM---HSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEMGIKFLGE 238
           HL +L HG+   HS++ +  +   E + +    Y        GYV    KT  GI+ +G 
Sbjct: 6   HLFVLVHGLWGTHSHMNSIKTAFSEALGDDAVFYVPRS---NGYV----KTLHGIELVGY 58

Query: 239 GLAKYIIDTLYSVEVAK---ISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFITLA 295
                + + + + +  K   ISFIG+S+GGL+  F I +I       F  ++PV F+T A
Sbjct: 59  QTVVELTEFVQARDPQKFDRISFIGYSMGGLVSRFVIGTIFTECRVIFGHMRPVLFMTFA 118

Query: 296 TPFLGIVTDNPSY-------------VKMLLSAGIIGKTGVDLGLKEHYDNILYLLSGEP 342
           TP LG+    P               V   + +  +G++G  L L    D+ L  ++   
Sbjct: 119 TPHLGVQFYQPRNPQAKSTVMGAVLPVARFVGSHFLGRSGRQLFLAYENDDTLVRMTEGV 178

Query: 343 IKSIMKKFERRTLYANAMNDGIVPLYTSCLLFLDYADVLSELDN 386
               + +F  R   AN  ND  V  YT+   F+   D   E +N
Sbjct: 179 YLEQLARFRHRVCLANVKNDRTVAFYTA---FITDCDPFLETNN 219

>CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 457

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/261 (27%), Positives = 120/261 (45%), Gaps = 25/261 (9%)

Query: 182 HLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYV------GNVCKTEMGIKF 235
           HL +L HG+  N     S  +E++ +  +L   +    K YV          KT  GI+ 
Sbjct: 6   HLFVLIHGLWGNYKHMKS--LEKVLDA-TLNGKKSGKDKDYVFFLPKQNATFKTFDGIEI 62

Query: 236 LGEGLAKYIIDTLYSVE---VAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFI 292
           +G      + + +   +   + KISF+G+SLGGL+  F +  +       F  ++   F+
Sbjct: 63  IGYRTLLELCEFMKEFKDGNITKISFVGYSLGGLVARFVVGKMYSECNDIFGNIERCIFM 122

Query: 293 TLATPFLGIVTDNP-SYV--KMLLS------AGIIGKTGVDLGLKEHYDNILYLLSGEPI 343
           T+ATP LGI   NP  Y+  K+L S      + I+GK+G +L +    ++IL  LS    
Sbjct: 123 TMATPHLGIQFYNPLGYLHRKLLFSTFTGLGSTILGKSGRELFIANSSNDILVRLSEGKY 182

Query: 344 KSIMKKFERRTLYANAMNDGIVPLYTSCLLFLDYADVLSELDN-LKRSIKITIDTPESGR 402
              +++F  R L+AN  ND  V  +T    F+   D   E DN +K   +  I      R
Sbjct: 183 IEALEEFNHRILFANVKNDRTVAFFTG---FIADVDPFLESDNRIKFDFESKIPGKSYSR 239

Query: 403 ESEKIINTSSSWSKVFKHRKE 423
              +I++ +   S V K + +
Sbjct: 240 AKPRIVDLNKLDSNVKKEKTQ 260

>KLLA0F16423g complement(1516717..1518096) similar to sgd|S0005585
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 459

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 110/231 (47%), Gaps = 26/231 (11%)

Query: 174 LRESRKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEMGI 233
           + E++K  HL IL HG+  N    M+ + E +  T     ++ ++ K       KT  GI
Sbjct: 1   MTETKKK-HLFILVHGLWGN-HKHMNSIKEMLEKTLDDI-DDIVIFKPENSGYLKTLHGI 57

Query: 234 KFLG----EGLAKYIIDTLYSVE-VAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKP 288
           + +     + + K++++  Y  E   ++S IG+S+GGL+  F I  +       F+ ++P
Sbjct: 58  RVVSYNVLDEICKFVLN--YGPEKFDRVSMIGYSMGGLVSRFIIGKMVTECRDIFQHMEP 115

Query: 289 VNFITLATPFLGIVTDNPS-----YV--KML------LSAGIIGKTGVDLGLKEHYDNIL 335
           + F+T ATP LG+    PS     YV  K+L      L   I+G++G ++ +    D IL
Sbjct: 116 MIFMTFATPHLGVNFYLPSDKTRRYVSRKILTSVLSGLGRTILGRSGAEIFISNKDDRIL 175

Query: 336 YLLSGEPIKSIMKKFERRTLYANAMNDGIVPLYTSCLLFLDYADVLSELDN 386
             LS       + +F  R  +AN  ND  V  YTS   F+  +D   E  N
Sbjct: 176 VDLSQGEYLYGLSRFHHRVCFANVKNDRTVAFYTS---FITDSDPFIETGN 223

>Kwal_27.10102
          Length = 258

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/218 (29%), Positives = 107/218 (49%), Gaps = 33/218 (15%)

Query: 177 SRKMIHLVILTHGMHSNVTADMSY----LMEQIYNTQSLYSNEKIVV------KGYVGNV 226
            +K  HLV+L HG+  N  + + Y    L E   + +   S E++VV      +GY    
Sbjct: 10  GKKPCHLVVLVHGLWGN-RSHLDYMSNALKESFESREDTCSKEELVVYTPHLNEGY---- 64

Query: 227 CKTEMGIKFLGEGLAKYIIDTLYSV-EVAKISFIGHSLGGLIQSFAISSIAVLHP-WFFE 284
            KT  GI   G  +A  I + + S+  V K S  G+SLGGLI  +A   + VLH    F+
Sbjct: 65  -KTYDGIDVCGVRVASEIEEQIVSLGSVTKFSICGYSLGGLISRYA---LGVLHKRQLFK 120

Query: 285 K--VKPVNFITLATPFLGIVTDNPSYVKMLLSA---GIIGKTGVDLGLKE--HYDNILYL 337
           K  ++ VNF T  TP +G+     +    L +A    ++G +G  + LK+   +   L L
Sbjct: 121 KRDIQLVNFTTFCTPHVGVYAPGKNVAVRLYNAIVPLVLGSSGKQMFLKDKPKFSGELPL 180

Query: 338 LSGEPIKS-----IMKKFERRTLYANAMNDGIVPLYTS 370
           +    +++      +++F+ ++LYAN +ND     +TS
Sbjct: 181 ILSMSLENSIFYKALQEFQTKSLYANVINDKRTAWWTS 218

>Sklu_2393.4 , Contig c2393 3530-5170 reverse complement
          Length = 546

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 101/216 (46%), Gaps = 30/216 (13%)

Query: 182 HLVILTHGMHSNVT--------ADMSYLMEQIYNTQSLYSNEKIVV------KGYVGNVC 227
           HLV+L HG+  N +         D S     ++      + E+IVV      +GY     
Sbjct: 10  HLVVLVHGLWGNGSHFDYISNSIDTSLKTHDVFQPGGKLAGEEIVVYTTCLNEGY----- 64

Query: 228 KTEMGIKFLGEGLAKYIIDTLYSV-EVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKV 286
           KT  GI   G  +AK I D + ++  V K S +G+SLGGLI  +A+  +     +    +
Sbjct: 65  KTYDGIDVCGLRVAKEIEDQIETLGSVIKFSLVGYSLGGLIARYALGILYKKQLFKKHDI 124

Query: 287 KPVNFITLATPFLGIVTDNPSYVKMLLSA---GIIGKTGVDLGLKEHYDN-----ILYLL 338
           + +NF T  TP +G+     +    L +     ++G +G  + LK+   +     ++YL+
Sbjct: 125 ELINFTTFCTPHVGVYAPGKNIAVNLFNTIVPFVLGNSGKQMFLKDQVRSAGNLPLVYLM 184

Query: 339 SGEP--IKSIMKKFERRTLYANAMNDGIVPLYTSCL 372
           S E       +++F+ + LYAN +ND     +TS +
Sbjct: 185 SMENSVFYKALQEFKYKALYANVINDKRTAWWTSGI 220

>Sklu_2232.4 YOR059C, Contig c2232 3289-4626
          Length = 445

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 93/218 (42%), Gaps = 43/218 (19%)

Query: 182 HLVILTHGMHSNVTADMSYLMEQIYNTQS-LYSNEKIVV-----KGYVGNVCKTEMGIKF 235
           HL +L HG+  N        M+ I    S  + +E ++       GY     KT  GI+ 
Sbjct: 5   HLFVLVHGLWGNYKH-----MDSIKGVFSKTFGDENVIFFAPKQNGYF----KTFDGIEI 55

Query: 236 LG--------EGLAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVK 287
           +G        E + KY +      ++ KISFIG+S+GGLI  F I  +       FE + 
Sbjct: 56  VGYRTLLELCEFIRKYGVG-----KITKISFIGYSMGGLISRFIIGKMETECQELFEGIN 110

Query: 288 PVNFITLATPFLGIVTDNPS-------------YVKMLLSAGIIGKTGVDLGL--KEHYD 332
              FIT ATP LG+    P               V   L + ++G++G  L +  K  +D
Sbjct: 111 RQLFITFATPHLGVEFYLPKEKPLQTRSRRFLHSVLSFLGSTVLGRSGRQLFIRDKHSWD 170

Query: 333 NILYLLSGEPIKSIMKKFERRTLYANAMNDGIVPLYTS 370
           + L  LS +     +  F+ R   AN  ND  V  YTS
Sbjct: 171 STLVKLSSDEYLLGLSAFKYRICIANVKNDRTVAFYTS 208

>Scas_698.39
          Length = 471

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 130/280 (46%), Gaps = 46/280 (16%)

Query: 174 LRESRKMIHLVILTHGMHSNVTADMSYLMEQIYNT-QSLYSNEKIVVKGYVGN-VCKTEM 231
           L  ++K  HL IL HG+  N    M  L E + N+ Q       +V      N + KT  
Sbjct: 9   LVSNQKDAHLFILLHGLWGNY-KHMESLKETLKNSIQDDTDRLPLVFFSPRQNAMFKTFD 67

Query: 232 GIKFLGEGLAKYIIDTLY---SVEVAKISFIGHSLGGLIQSFAISSIAVLHP-----WFF 283
           G++ +G      II  +      +  K+S +G+S+GGLI  F I  +   +        F
Sbjct: 68  GVEVVGYRALIEIIQFIQLHPEFKFTKLSILGYSMGGLIARFLIGVMFDKNNDEDEMKVF 127

Query: 284 EKVKPVNFITLATPFLGIVTDNP---------SYVKMLLSAGIIGKTGVDLGLKEHYDNI 334
           + ++P  FIT ATP LGI   NP         + +  L+ + IIG +G ++ +  + + +
Sbjct: 128 KGMEPQLFITFATPHLGIHFYNPLNNMLRTFLNPMLTLIGSNIIGVSGREMFIMRNTE-L 186

Query: 335 LYLLSGEPIKSIMKKFERRTLYANAMNDGIVPLYTS----CLLFLD-------------- 376
           + L SG+ + + + KF+ R ++AN  ND  V  YTS    C  F+D              
Sbjct: 187 VELSSGKYLDA-LSKFKWRIVFANVKNDRTVAFYTSFITDCDPFIDTGNDIKYNFEENIP 245

Query: 377 ---YADVLSELDNLKRSIKITIDTPESGRESEKIINTSSS 413
              Y ++L  + +L+R  K +++ P   R+ EK++  + S
Sbjct: 246 GENYTNILPRIVDLERLDK-SVNAPL--RQQEKVVKHTVS 282

>Sklu_1381.1 YBR118W, Contig c1381 291-1667
          Length = 458

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 9/86 (10%)

Query: 377 YADVLSELDNLKRSIKITIDT----PESGRESEKII--NTSSSWSKVFKHRKEDKHSVKL 430
           Y +++ E  N  + +     T    P SG   + +I   T++SW K ++  KE K  V  
Sbjct: 165 YQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEPTTNASWYKGWE--KETKAGVVK 222

Query: 431 PKTSIIESMASILQPPSPTDEYITNP 456
            KT ++E++ SI QP  PTD+ +  P
Sbjct: 223 GKT-LLEAIDSIEQPSRPTDKPLRLP 247

>Kwal_47.18130
          Length = 474

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 9/78 (11%)

Query: 490 LSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRKVIVALGSEAHNNIIVRRRFSNGYGWEV 549
           +SRF+  H  GK N  +E +      +  PWR  IV L S       +++ F +   WE 
Sbjct: 246 MSRFH--HLFGKDNYWIEYDRD----TDHPWR--IVVLDSMLLEGPPLQQEFVDA-TWEF 296

Query: 550 IDHLIENHFNGSDSLLVH 567
           +  L E  F GS  LL H
Sbjct: 297 LFQLFERRFEGSTVLLTH 314

>Scas_704.46
          Length = 473

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 29/68 (42%), Gaps = 7/68 (10%)

Query: 500 GKQNERLEVEIAKRWHSGTPWRKVIVALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHFN 559
           GK N  +E E      +  PWR  IV L S       ++  F     WE +  L E  FN
Sbjct: 254 GKDNFWIEYETD----TNHPWR--IVVLNSLLLEGPALQPEFIEN-NWEFLYQLFERRFN 306

Query: 560 GSDSLLVH 567
           GS  LL H
Sbjct: 307 GSTVLLTH 314

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,926,932
Number of extensions: 934408
Number of successful extensions: 3344
Number of sequences better than 10.0: 63
Number of HSP's gapped: 3351
Number of HSP's successfully gapped: 67
Length of query: 628
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 520
Effective length of database: 12,857,365
Effective search space: 6685829800
Effective search space used: 6685829800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)