Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_613.13*31231216770.0
YDL108W (KIN28)30630014720.0
CAGL0H10318g30730314370.0
KLLA0E14828g31030513380.0
ADL283W30630113190.0
Kwal_23.347126025411371e-158
KLLA0D11990g3043015794e-73
CAGL0L12474g3022995631e-70
AGL242C3033015571e-69
Scas_568.9*3062965561e-69
KLLA0B09790g2952945317e-66
ADR058C2952945212e-64
CAGL0H07535g2983125072e-62
Scas_721.462962945056e-62
YBR160W (CDC28)2983025048e-62
Scas_610.76683295262e-61
AFR205C4573024774e-56
Kwal_27.118032462434581e-55
CAGL0D02002g5533094755e-55
CAGL0I08349g6673344781e-54
Scas_721.1105203064658e-54
Kwal_26.75524612944592e-53
Kwal_55.219006253274682e-53
KLLA0E12177g4552944487e-52
ABR177C7533254601e-51
Kwal_27.119192092054281e-51
AFR019W3593064331e-50
Kwal_17.26873623294322e-50
CAGL0L12650g5673234442e-50
KLLA0D10527g6453364472e-50
KLLA0E10527g3713314244e-49
Kwal_47.178683653054211e-48
YBL016W (FUS3)3533054164e-48
CAGL0L06820g3663074174e-48
CAGL0J04290g3573044157e-48
KLLA0D11814g5932894252e-47
Scas_710.283523014112e-47
Kwal_27.118305752904233e-47
Scas_623.113783064081e-46
KLLA0F17006g4152934082e-46
KLLA0A02497g3623034025e-46
ADR253W3803104002e-45
CAGL0J00539g4883083992e-44
AGL249C5812904004e-44
CAGL0D01694g4323103882e-43
Kwal_14.14163653063834e-43
Scas_713.384322933858e-43
ACL191C3653003818e-43
YGR040W (KSS1)3683273809e-43
Scas_683.63773143792e-42
Scas_667.184373173822e-42
KLLA0F20053g4442933804e-42
CAGL0M11748g4472933796e-42
Kwal_56.238414322933752e-41
KLLA0B11902g4953023782e-41
Kwal_27.125594143063715e-41
Scas_688.144793023721e-40
Kwal_23.55765043043703e-40
ADL315C4343003663e-40
AGR048C4532933622e-39
AER232C5693043662e-39
YHR030C (SLT2)4843023632e-39
CAGL0K04169g3983303531e-38
Scas_680.204822963553e-38
KLLA0B11946g4393053533e-38
Scas_22.12482303213e-35
YDL079C (MRK1)5013093273e-34
Scas_711.157272843032e-30
YJL106W (IME2)6452203023e-30
Kwal_26.72766462823013e-30
CAGL0G04455g7512152962e-29
AEL230W6082972891e-28
CAGL0E01683g3753012821e-28
KLLA0F02838g7552792873e-28
Scas_678.134622952825e-28
Scas_660.286232872802e-27
CAGL0M08910g6122832792e-27
Kwal_47.182335982832774e-27
Kwal_55.220013633142698e-27
KLLA0A03806g6022942759e-27
AFR076W8202112732e-26
YDR477W (SNF1)6332832722e-26
Scas_635.13783012584e-25
KLLA0E07414g3653032566e-25
ADL168C3623182541e-24
Kwal_26.735514462962582e-24
YDR507C (GIN4)11423112573e-24
KLLA0F11143g8132912573e-24
CAGL0K05709g11033082563e-24
Scas_673.20*7582022546e-24
YDL101C (DUN1)5133242526e-24
AFR092W14232062511e-23
Scas_493.211173112502e-23
YJL095W (BCK1)14782992493e-23
YCL024W (KCC4)10372062493e-23
KLLA0F14190g13382032484e-23
CAGL0J11638g7462562475e-23
Scas_711.2515152022459e-23
CAGL0C05005g10762072441e-22
KLLA0C01650g11123082432e-22
AFR696C11423082423e-22
ABL011C7012682413e-22
KLLA0C04191g7972142395e-22
ABR014W9712292395e-22
CAGL0K02673g9153082379e-22
Kwal_55.203267502742361e-21
ACR249C6432192351e-21
Scas_618.84272982332e-21
YFR014C (CMK1)4462922332e-21
AER223C9022012342e-21
YAR019C (CDC15)9742102333e-21
Kwal_23.35904993202314e-21
KLLA0E03487g6472192316e-21
CAGL0B02739g6762962306e-21
Scas_613.55173162306e-21
YGL179C (TOS3)5602222298e-21
YHL007C (STE20)9392962291e-20
Kwal_23.632515422942291e-20
CAGL0L03520g14472972291e-20
ABL034W14252042291e-20
Scas_651.37932352281e-20
AFR377C7262152281e-20
CAGL0I05896g7782252281e-20
Scas_700.546982902272e-20
Scas_477.57033282272e-20
CAGL0K08514g14892212272e-20
CAGL0L07326g5063042262e-20
KLLA0C06138g7083012262e-20
CAGL0K01661g4822062243e-20
KLLA0F23155g4272222225e-20
Scas_707.315981662246e-20
Scas_668.228932932237e-20
Kwal_0.964272142209e-20
KLLA0B13607g9891952229e-20
KLLA0F13552g12672032229e-20
CAGL0F04741g4423052201e-19
Kwal_47.180983742562181e-19
KLLA0E01584g4153142182e-19
Kwal_26.89416612442202e-19
Scas_718.906472892202e-19
Kwal_26.778812672002202e-19
Scas_713.79832002192e-19
Scas_644.157262272183e-19
Kwal_56.224766972292183e-19
AFL188C4723102173e-19
KLLA0A05819g7042252183e-19
Scas_648.173402272133e-19
Kwal_26.78619552292183e-19
ADL102C3722502144e-19
CAGL0K12496g3602252134e-19
KLLA0C08525g15512022166e-19
Scas_698.373473062091e-18
CAGL0G02035g3393012091e-18
YJL141C (YAK1)8072262131e-18
Kwal_33.139846492252121e-18
ACL006W7082022122e-18
ADR204W3393012082e-18
CAGL0C02893g6492132112e-18
Scas_720.9416833152113e-18
CAGL0M10153g8672132103e-18
ADR174C6712432103e-18
Scas_633.297893142094e-18
KLLA0B13112g7302592094e-18
Kwal_33.144347592122094e-18
Kwal_26.87098292272094e-18
YGL180W (ATG1)8973192077e-18
AER264C14832922087e-18
YFL033C (RIM15)17701522078e-18
CAGL0K12562g16821662078e-18
Kwal_33.138317002012069e-18
Scas_653.256662092061e-17
AEL284C4792232051e-17
KLLA0F16467g3403072021e-17
Kwal_27.97638682092061e-17
CAGL0M02233g7673072051e-17
YDL025C6202092051e-17
Scas_700.348642242051e-17
Kwal_26.87967963062051e-17
Scas_616.1014611562052e-17
AAR009W4532032032e-17
Kwal_27.97734062542012e-17
KLLA0E04136g3732652003e-17
KLLA0C17160g8312522033e-17
AFR335C10332192023e-17
CAGL0E05720g3582091993e-17
CAGL0I05192g3733421994e-17
YCR073C (SSK22)13312532024e-17
KLLA0D07348g9092042014e-17
Scas_692.247181902014e-17
Scas_640.14*7282162014e-17
Kwal_55.217093402981975e-17
ADR313W5782892005e-17
Scas_704.503693441976e-17
KLLA0A06820g7722272006e-17
AEL118C6831911997e-17
ACR142W8373051998e-17
KLLA0F08877g3211411941e-16
AFR150C3492891941e-16
YFL029C (CAK1)3682311942e-16
Kwal_33.141925773071952e-16
CAGL0K10604g4462851942e-16
Scas_707.73762211933e-16
KLLA0E06413g11612621953e-16
CAGL0L07810g5962971934e-16
YCR008W (SAT4)6033001934e-16
KLLA0D08415g7742081934e-16
CAGL0F09075g7463061935e-16
Scas_651.198012461925e-16
KLLA0C07535g6242441926e-16
Kwal_33.131125051931916e-16
CAGL0M02299g8931961926e-16
YIL035C (CKA1)3721701897e-16
KLLA0F09020g9281511927e-16
Scas_700.288961891927e-16
Scas_715.3411501991927e-16
ACR119W9312231918e-16
Kwal_47.172528723461918e-16
AER222C4232711899e-16
ADR317C8193221911e-15
KLLA0F11319g8432891911e-15
KLLA0B03586g7343091901e-15
CAGL0L06006g9423251901e-15
Kwal_14.12493441451871e-15
CAGL0F03707g6082541891e-15
Kwal_33.141678383171892e-15
CAGL0J03872g6612301882e-15
Kwal_47.183076212211882e-15
ADL389W7112281882e-15
YBL105C (PKC1)11511991882e-15
Scas_690.133541931852e-15
CAGL0G09020g3611931852e-15
KLLA0B12716g7161941863e-15
Kwal_56.240593531931843e-15
Kwal_26.76356911941864e-15
Scas_703.57493061864e-15
CAGL0M09361g11442931865e-15
YHR205W (SCH9)8243061855e-15
Scas_660.209572171855e-15
CAGL0I07513g10762211855e-15
AFL101C3672031826e-15
Scas_201.1*2741911797e-15
ACL054W9723341847e-15
AFL090W3461931818e-15
CAGL0J03828g4672171829e-15
Kwal_55.215458652891839e-15
Kwal_47.167617442491839e-15
ACR133C8512041831e-14
KLLA0B02332g3612231801e-14
KLLA0A07403g8792191831e-14
KLLA0D03190g3721931801e-14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_613.13*
         (312 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_613.13*                                                          650   0.0  
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...   571   0.0  
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...   558   0.0  
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...   520   0.0  
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...   512   0.0  
Kwal_23.3471                                                          442   e-158
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...   227   4e-73
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...   221   1e-70
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...   219   1e-69
Scas_568.9*                                                           218   1e-69
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...   209   7e-66
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...   205   2e-64
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...   199   2e-62
Scas_721.46                                                           199   6e-62
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...   198   8e-62
Scas_610.7                                                            207   2e-61
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...   188   4e-56
Kwal_27.11803                                                         181   1e-55
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...   187   5e-55
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...   188   1e-54
Scas_721.110                                                          183   8e-54
Kwal_26.7552                                                          181   2e-53
Kwal_55.21900                                                         184   2e-53
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...   177   7e-52
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...   181   1e-51
Kwal_27.11919                                                         169   1e-51
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...   171   1e-50
Kwal_17.2687                                                          171   2e-50
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...   175   2e-50
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...   176   2e-50
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...   167   4e-49
Kwal_47.17868                                                         166   1e-48
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...   164   4e-48
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...   165   4e-48
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...   164   7e-48
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...   168   2e-47
Scas_710.28                                                           162   2e-47
Kwal_27.11830                                                         167   3e-47
Scas_623.11                                                           161   1e-46
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...   161   2e-46
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...   159   5e-46
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...   158   2e-45
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...   158   2e-44
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...   158   4e-44
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...   154   2e-43
Kwal_14.1416                                                          152   4e-43
Scas_713.38                                                           152   8e-43
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...   151   8e-43
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...   150   9e-43
Scas_683.6                                                            150   2e-42
Scas_667.18                                                           151   2e-42
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...   150   4e-42
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...   150   6e-42
Kwal_56.23841                                                         149   2e-41
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...   150   2e-41
Kwal_27.12559                                                         147   5e-41
Scas_688.14                                                           147   1e-40
Kwal_23.5576                                                          147   3e-40
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...   145   3e-40
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...   144   2e-39
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...   145   2e-39
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...   144   2e-39
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...   140   1e-38
Scas_680.20                                                           141   3e-38
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...   140   3e-38
Scas_22.1                                                             128   3e-35
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...   130   3e-34
Scas_711.15                                                           121   2e-30
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...   120   3e-30
Kwal_26.7276                                                          120   3e-30
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...   118   2e-29
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...   115   1e-28
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...   113   1e-28
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...   115   3e-28
Scas_678.13                                                           113   5e-28
Scas_660.28                                                           112   2e-27
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   112   2e-27
Kwal_47.18233                                                         111   4e-27
Kwal_55.22001                                                         108   8e-27
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....   110   9e-27
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...   109   2e-26
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...   109   2e-26
Scas_635.1                                                            103   4e-25
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...   103   6e-25
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...   102   1e-24
Kwal_26.7355                                                          103   2e-24
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...   103   3e-24
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...   103   3e-24
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...   103   3e-24
Scas_673.20*                                                          102   6e-24
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...   101   6e-24
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...   101   1e-23
Scas_493.2                                                            100   2e-23
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...   100   3e-23
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...   100   3e-23
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...   100   4e-23
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...   100   5e-23
Scas_711.25                                                            99   9e-23
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    99   1e-22
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    98   2e-22
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    98   3e-22
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    97   3e-22
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    97   5e-22
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    97   5e-22
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    96   9e-22
Kwal_55.20326                                                          96   1e-21
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    95   1e-21
Scas_618.8                                                             94   2e-21
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    94   2e-21
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    95   2e-21
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    94   3e-21
Kwal_23.3590                                                           94   4e-21
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    94   6e-21
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    93   6e-21
Scas_613.5                                                             93   6e-21
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    93   8e-21
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    93   1e-20
Kwal_23.6325                                                           93   1e-20
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    93   1e-20
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    93   1e-20
Scas_651.3                                                             92   1e-20
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    92   1e-20
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    92   1e-20
Scas_700.54                                                            92   2e-20
Scas_477.5                                                             92   2e-20
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    92   2e-20
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    92   2e-20
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    92   2e-20
CAGL0K01661g complement(146952..148400) some similarities with t...    91   3e-20
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    90   5e-20
Scas_707.3                                                             91   6e-20
Scas_668.22                                                            91   7e-20
Kwal_0.96                                                              89   9e-20
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    90   9e-20
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    90   9e-20
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    89   1e-19
Kwal_47.18098                                                          89   1e-19
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    89   2e-19
Kwal_26.8941                                                           89   2e-19
Scas_718.90                                                            89   2e-19
Kwal_26.7788                                                           89   2e-19
Scas_713.7                                                             89   2e-19
Scas_644.15                                                            89   3e-19
Kwal_56.22476                                                          89   3e-19
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    88   3e-19
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    89   3e-19
Scas_648.17                                                            87   3e-19
Kwal_26.7861                                                           89   3e-19
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    87   4e-19
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    87   4e-19
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    88   6e-19
Scas_698.37                                                            85   1e-18
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    85   1e-18
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    87   1e-18
Kwal_33.13984                                                          86   1e-18
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    86   2e-18
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    85   2e-18
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    86   2e-18
Scas_720.94                                                            86   3e-18
CAGL0M10153g complement(1010688..1013291) some similarities with...    86   3e-18
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    86   3e-18
Scas_633.29                                                            85   4e-18
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    85   4e-18
Kwal_33.14434                                                          85   4e-18
Kwal_26.8709                                                           85   4e-18
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    84   7e-18
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    85   7e-18
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    84   8e-18
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    84   8e-18
Kwal_33.13831                                                          84   9e-18
Scas_653.25                                                            84   1e-17
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    84   1e-17
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    82   1e-17
Kwal_27.9763                                                           84   1e-17
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    84   1e-17
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    84   1e-17
Scas_700.34                                                            84   1e-17
Kwal_26.8796                                                           84   1e-17
Scas_616.10                                                            84   2e-17
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    83   2e-17
Kwal_27.9773                                                           82   2e-17
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    82   3e-17
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    83   3e-17
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    82   3e-17
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    81   3e-17
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    81   4e-17
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    82   4e-17
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    82   4e-17
Scas_692.24                                                            82   4e-17
Scas_640.14*                                                           82   4e-17
Kwal_55.21709                                                          80   5e-17
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    82   5e-17
Scas_704.50                                                            80   6e-17
KLLA0A06820g complement(615686..618004) some similarities with s...    82   6e-17
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    81   7e-17
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    81   8e-17
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    79   1e-16
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    79   1e-16
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    79   2e-16
Kwal_33.14192                                                          80   2e-16
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    79   2e-16
Scas_707.7                                                             79   3e-16
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    80   3e-16
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    79   4e-16
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    79   4e-16
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    79   4e-16
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    79   5e-16
Scas_651.19                                                            79   5e-16
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    79   6e-16
Kwal_33.13112                                                          78   6e-16
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    79   6e-16
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    77   7e-16
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    79   7e-16
Scas_700.28                                                            79   7e-16
Scas_715.34                                                            79   7e-16
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    78   8e-16
Kwal_47.17252                                                          78   8e-16
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    77   9e-16
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    78   1e-15
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    78   1e-15
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    78   1e-15
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    78   1e-15
Kwal_14.1249                                                           77   1e-15
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    77   1e-15
Kwal_33.14167                                                          77   2e-15
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    77   2e-15
Kwal_47.18307                                                          77   2e-15
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    77   2e-15
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    77   2e-15
Scas_690.13                                                            76   2e-15
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    76   2e-15
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    76   3e-15
Kwal_56.24059                                                          75   3e-15
Kwal_26.7635                                                           76   4e-15
Scas_703.5                                                             76   4e-15
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    76   5e-15
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    76   5e-15
Scas_660.20                                                            76   5e-15
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    76   5e-15
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    75   6e-15
Scas_201.1*                                                            74   7e-15
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    75   7e-15
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    74   8e-15
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    75   9e-15
Kwal_55.21545                                                          75   9e-15
Kwal_47.16761                                                          75   9e-15
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    75   1e-14
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    74   1e-14
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    75   1e-14
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    74   1e-14
Kwal_27.10581                                                          75   1e-14
Scas_598.6                                                             74   2e-14
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    74   2e-14
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    74   2e-14
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    74   2e-14
Kwal_14.1159                                                           74   2e-14
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    74   3e-14
Kwal_0.307                                                             73   3e-14
Scas_685.24                                                            73   3e-14
Kwal_56.24584                                                          73   3e-14
Kwal_26.8751                                                           74   3e-14
Kwal_56.22693                                                          74   3e-14
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    73   4e-14
KLLA0C03938g complement(358851..360632) some similarities with s...    73   4e-14
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    73   4e-14
KLLA0E11979g complement(1060048..1061892) some similarities with...    73   5e-14
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    73   5e-14
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    72   6e-14
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    72   6e-14
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    72   9e-14
Scas_628.9                                                             72   9e-14
Scas_502.2                                                             72   9e-14
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    72   1e-13
Scas_336.1                                                             72   1e-13
Scas_580.6                                                             72   1e-13
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    71   1e-13
Scas_700.35                                                            71   1e-13
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    71   1e-13
Scas_683.12                                                            70   2e-13
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    71   2e-13
KLLA0B07205g complement(624606..625973) some similarities with s...    71   2e-13
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    70   2e-13
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    70   2e-13
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    71   2e-13
Scas_689.25*                                                           70   2e-13
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    70   3e-13
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    70   3e-13
Kwal_33.13222                                                          67   3e-13
Kwal_56.22788                                                          70   3e-13
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    70   3e-13
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    71   3e-13
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    70   3e-13
Scas_651.18                                                            70   3e-13
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    70   3e-13
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    70   3e-13
Kwal_33.13846                                                          70   3e-13
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    70   3e-13
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    70   3e-13
CAGL0M08404g complement(836791..838179) some similarities with s...    70   4e-13
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    70   4e-13
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    70   4e-13
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    69   5e-13
KLLA0D12100g complement(1031728..1033161) some similarities with...    69   5e-13
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    70   5e-13
Scas_693.17                                                            70   5e-13
CAGL0M08360g complement(833220..835520) some similarities with s...    70   5e-13
Kwal_26.7682                                                           69   5e-13
Scas_689.24                                                            69   6e-13
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    70   6e-13
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    69   6e-13
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    69   7e-13
Scas_640.16                                                            69   7e-13
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    69   8e-13
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    69   9e-13
Kwal_23.5290                                                           69   9e-13
Scas_721.124                                                           69   9e-13
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    69   1e-12
KLLA0C16577g complement(1451181..1452695) some similarities with...    69   1e-12
Scas_619.5*                                                            69   1e-12
Scas_678.24                                                            69   1e-12
Kwal_14.1273                                                           68   1e-12
Scas_675.2                                                             68   1e-12
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    68   2e-12
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    68   2e-12
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    68   2e-12
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    67   2e-12
Kwal_23.5668                                                           67   4e-12
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    67   4e-12
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    67   4e-12
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    67   4e-12
Scas_655.2                                                             67   4e-12
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    67   5e-12
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    67   5e-12
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    67   5e-12
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    67   5e-12
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    66   6e-12
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    66   6e-12
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    66   6e-12
Scas_634.5                                                             66   7e-12
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    66   7e-12
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    66   8e-12
Kwal_26.8703                                                           65   9e-12
Kwal_33.13681                                                          66   9e-12
Kwal_56.24091                                                          65   9e-12
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    65   1e-11
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    65   1e-11
Scas_582.1                                                             65   1e-11
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    65   1e-11
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    65   1e-11
Kwal_33.14554                                                          65   1e-11
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    65   1e-11
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    65   2e-11
Scas_627.7                                                             65   2e-11
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    64   2e-11
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    65   2e-11
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    65   2e-11
Scas_564.7                                                             65   2e-11
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    65   2e-11
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    65   2e-11
Scas_593.14d                                                           64   2e-11
Scas_548.6                                                             65   2e-11
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    64   3e-11
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    65   3e-11
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    64   3e-11
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    64   3e-11
Scas_654.12                                                            64   3e-11
Scas_677.18                                                            64   4e-11
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    64   4e-11
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    64   4e-11
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    64   4e-11
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    64   4e-11
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    64   5e-11
Scas_544.6                                                             64   5e-11
Scas_721.132                                                           64   6e-11
KLLA0D09328g complement(788565..791705) some similarities with s...    64   6e-11
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    63   6e-11
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    64   7e-11
Scas_584.11                                                            64   7e-11
Scas_629.16                                                            63   8e-11
Scas_602.11                                                            63   8e-11
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    63   9e-11
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    63   1e-10
Kwal_14.2497                                                           62   1e-10
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    63   1e-10
Kwal_0.155                                                             62   1e-10
Scas_717.69                                                            62   1e-10
Scas_568.13                                                            62   1e-10
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    62   1e-10
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    62   1e-10
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    62   1e-10
Scas_707.36                                                            62   1e-10
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    62   2e-10
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    62   2e-10
Scas_721.61                                                            62   2e-10
Scas_716.73                                                            61   2e-10
Scas_707.34                                                            62   2e-10
Scas_705.23                                                            62   2e-10
Kwal_56.23717                                                          62   3e-10
Kwal_26.7154                                                           62   3e-10
Kwal_23.6458                                                           62   3e-10
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    62   3e-10
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    61   4e-10
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    60   4e-10
Kwal_55.20189                                                          61   4e-10
Scas_716.33                                                            60   4e-10
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    60   6e-10
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    60   6e-10
Scas_713.21                                                            60   6e-10
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    60   7e-10
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    60   7e-10
Kwal_47.17263                                                          60   8e-10
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    60   9e-10
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    59   1e-09
Kwal_23.3992                                                           59   1e-09
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    59   1e-09
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    60   1e-09
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    59   1e-09
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    59   1e-09
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    59   2e-09
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    59   2e-09
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    59   2e-09
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    59   2e-09
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    59   2e-09
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    59   2e-09
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    59   2e-09
Kwal_55.20221                                                          59   2e-09
Scas_643.20                                                            59   2e-09
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    58   2e-09
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    58   2e-09
Kwal_23.4276                                                           58   2e-09
Kwal_27.11777                                                          58   3e-09
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    58   5e-09
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    57   6e-09
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    57   6e-09
Scas_673.34*                                                           57   8e-09
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    56   9e-09
YHR079C (IRE1) [2368] chr8 complement(258245..261592) Protein ki...    56   1e-08
Kwal_33.14081                                                          56   1e-08
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    55   3e-08
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    55   3e-08
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    55   3e-08
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    55   3e-08
Scas_720.103                                                           55   4e-08
Scas_601.6                                                             55   4e-08
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    55   4e-08
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    54   5e-08
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    54   5e-08
Scas_703.47                                                            54   6e-08
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    54   7e-08
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    54   1e-07
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    53   1e-07
Scas_695.33                                                            53   2e-07
Scas_618.15                                                            52   2e-07
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    51   6e-07
Scas_573.10                                                            50   9e-07
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    50   1e-06
Scas_671.16                                                            50   1e-06
Scas_584.8                                                             50   1e-06
AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH] complement...    50   1e-06
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    50   2e-06
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    49   2e-06
Scas_690.12                                                            49   2e-06
Scas_720.24                                                            49   2e-06
Kwal_27.10004                                                          49   2e-06
Kwal_56.24064                                                          49   3e-06
Kwal_47.17345                                                          48   5e-06
CAGL0H03553g complement(328668..330155) highly similar to sp|P29...    48   5e-06
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    48   6e-06
Kwal_27.9804                                                           47   7e-06
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    47   8e-06
CAGL0F03905g complement(377962..380088) similar to sp|Q03656 Sac...    47   1e-05
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    47   1e-05
Kwal_27.11542                                                          47   1e-05
AER216C [2718] [Homologous to ScYDL017W (CDC7) - SH] (1032840..1...    47   2e-05
KLLA0D03168g 265761..267278 some similarities with sp|P29295 Sac...    46   2e-05
KLLA0C04345g 397899..399326 similar to sp|P06243 Saccharomyces c...    46   2e-05
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...    46   2e-05
KLLA0F22297g complement(2083448..2085547) some similarities with...    46   3e-05
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    46   3e-05
Scas_697.12                                                            45   3e-05
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    45   3e-05
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...    45   5e-05
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    45   6e-05
Scas_718.72                                                            45   6e-05
Scas_649.30                                                            45   6e-05
Kwal_33.14596                                                          44   7e-05
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    44   9e-05
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    44   1e-04
Kwal_56.24274                                                          44   1e-04
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    44   2e-04
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...    43   2e-04
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...    43   2e-04
KLLA0C07216g 626227..628278 similar to sp|Q03656 Saccharomyces c...    43   2e-04
YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I isof...    43   3e-04
AER348C [2849] [Homologous to ScYMR216C (SKY1) - SH] (1275897..1...    43   3e-04
Kwal_27.10945                                                          42   4e-04
Scas_684.28                                                            42   4e-04
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    42   5e-04
Scas_653.33                                                            42   5e-04
Scas_654.17                                                            41   7e-04

>Scas_613.13*
          Length = 312

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/312 (100%), Positives = 312/312 (100%)

Query: 1   MSTEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR 60
           MSTEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR
Sbjct: 1   MSTEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR 60

Query: 61  EVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMT 120
           EVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMT
Sbjct: 61  EVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMT 120

Query: 121 LRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAP 180
           LRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAP
Sbjct: 121 LRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAP 180

Query: 181 ELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVS 240
           ELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVS
Sbjct: 181 ELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVS 240

Query: 241 SFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEM 300
           SFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEM
Sbjct: 241 SFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEM 300

Query: 301 PPPSDPSEIKIK 312
           PPPSDPSEIKIK
Sbjct: 301 PPPSDPSEIKIK 312

>YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699)
           Cyclin-dependent serine/threonine protein kinase,
           component of TFIIK subcomplex of transcription factor
           TFIIH, phosphorylates C-terminal domain (CTD) of Rpo21p
           [921 bp, 306 aa]
          Length = 306

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/300 (88%), Positives = 289/300 (96%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDN 72
           EYTK KKVGEGTYAVVYLG + STGR+IA+KEIKTSEFKDGLDMSAIREVKYLQE+QH N
Sbjct: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65

Query: 73  VIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFI 132
           VIEL+DIFMAYDNLNLVLEFLP+DLEV+IKD+SILFTPADIK+WMLMTLRGV+HCHRNFI
Sbjct: 66  VIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125

Query: 133 LHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192
           LHRDLKPNNLL SPDG IKVADFGLARA+P+PHE+LTSNVVTRWYRAPELLFGAKHYTSA
Sbjct: 126 LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSA 185

Query: 193 IDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYP 252
           IDIWSVGVIFAELMLRIPYLPGQND+DQMEVTFRALGTPTD++WPEVSSF +YNKLQIYP
Sbjct: 186 IDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYP 245

Query: 253 PPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSDPSEIKIK 312
           PPS DELRKRFIAASE AL+FMCGMLTMNP+KRW A++CLES+YFKE+PPPSDPS IKI+
Sbjct: 246 PPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSDPSSIKIR 305

>CAGL0H10318g complement(1006299..1007222) highly similar to
           sp|P06242 Saccharomyces cerevisiae YDL108w KIN28
           cyclin-dependent ser/thr protein kinase, hypothetical
           start
          Length = 307

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/303 (85%), Positives = 287/303 (94%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEI 68
           + + EYTK KKVGEGTYAVVY+GTKQSTGR+IAVKEIKTSEFKDGLDMSAIREVKYLQE+
Sbjct: 1   MERAEYTKEKKVGEGTYAVVYVGTKQSTGRRIAVKEIKTSEFKDGLDMSAIREVKYLQEM 60

Query: 69  QHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCH 128
           QH NVIELVDIFM+Y NLNLVLE+LP+DLEV+IKD+SILFTPADIKSWMLM++RGVHHCH
Sbjct: 61  QHVNVIELVDIFMSYGNLNLVLEYLPTDLEVVIKDKSILFTPADIKSWMLMSVRGVHHCH 120

Query: 129 RNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKH 188
           RNFILHRDLKPNNLL++PDG IKVADFGLARAVPSPHE+LTSNVVTRWYRAPELLFGAKH
Sbjct: 121 RNFILHRDLKPNNLLIAPDGQIKVADFGLARAVPSPHEVLTSNVVTRWYRAPELLFGAKH 180

Query: 189 YTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKL 248
           YTSAID+WS+GVIFAELMLRIPYLPGQND++QMEVTFRALGTPTDK+WPEVSSF SYNKL
Sbjct: 181 YTSAIDVWSLGVIFAELMLRIPYLPGQNDLEQMEVTFRALGTPTDKDWPEVSSFNSYNKL 240

Query: 249 QIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSDPSE 308
           Q+YPPPS DELRKRFIAA+ENALNFM GM+ +NP KRW+  +CLESEYFKE+P PSDP+ 
Sbjct: 241 QMYPPPSRDELRKRFIAATENALNFMNGMMCLNPAKRWSTAQCLESEYFKELPRPSDPAT 300

Query: 309 IKI 311
           I I
Sbjct: 301 IDI 303

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 237/305 (77%), Positives = 279/305 (91%)

Query: 5   ITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKY 64
           +T   T  +YTK KK GEGTYAVVYLGTK+STGR IAVKEIKTS+FKDGLDMSA+REVK+
Sbjct: 1   MTLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKF 60

Query: 65  LQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGV 124
           LQE++H NVIELVD+FMA DNLNLVLEFLP+DLE+IIKD SI+F+PADIKSW+LMTLRGV
Sbjct: 61  LQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGV 120

Query: 125 HHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLF 184
           HHCHRNFILHRDLKPNNLLL+PDG +K+ADFGLAR + SP E+LTSNVVTRWYRAPELLF
Sbjct: 121 HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180

Query: 185 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGS 244
           GAKHYTSA+DIWSVGVIFAELMLRIPYLPG++D+DQ+ VTFRALGTPTD +WPEVSSF +
Sbjct: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240

Query: 245 YNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPS 304
           YNK+QIYPPPS +ELR+RFIAA+ENAL  + GM+ MNPKKRW+A++CL+S+YF+E+P P+
Sbjct: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPT 300

Query: 305 DPSEI 309
            P ++
Sbjct: 301 LPQDL 305

>ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH]
           complement(205175..205199,205252..206147) [921 bp, 306
           aa]
          Length = 306

 Score =  512 bits (1319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 231/301 (76%), Positives = 273/301 (90%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEI 68
           +T   YTK KKVGEGTYAVVYLG +Q+ GRQIA+KEIKTS+FKDGLDMSAIREVKYLQEI
Sbjct: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI 60

Query: 69  QHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCH 128
           +H NVIELVD+FMA +NLNLVLEFLP+DLE++IKD S+LFT ADIKSW+LMTLRGVHHCH
Sbjct: 61  RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120

Query: 129 RNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKH 188
           R+FILHRDLKPNNLLL+PDG +K+ADFGLAR + +PHE +TSNVVTRWYRAPELLFGA+H
Sbjct: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARH 180

Query: 189 YTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKL 248
           YT+A+D+WSVGVIFAELMLRIPYLPG++D+DQ++VTFRALGTPTDK+WPEVSSF +YNK+
Sbjct: 181 YTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKI 240

Query: 249 QIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSDPSE 308
           Q+YPPPS  ELR RFIAA+ENAL+ MCGMLTM+P KRW+   CL S+YF E+P  + P+E
Sbjct: 241 QVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATPPTE 300

Query: 309 I 309
           +
Sbjct: 301 L 301

>Kwal_23.3471
          Length = 260

 Score =  442 bits (1137), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 203/254 (79%), Positives = 234/254 (92%)

Query: 56  MSAIREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKS 115
           MSAIREVKYLQEI+H NVIEL+D++MA  NLNLVLEFLP+DLE+IIKD SILFT ADIKS
Sbjct: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKS 60

Query: 116 WMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTR 175
           W+LMTLRGVHHCHRNFILHRDLKPNNLLL+PDG +K+ADFGLAR + SP +MLTSNVVTR
Sbjct: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR 120

Query: 176 WYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKE 235
           WYRAPELLFGAKHYT AID+WSVGVIFAELMLRIPYLPG++DIDQ++VTFRALGTPTDK+
Sbjct: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKD 180

Query: 236 WPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESE 295
           WPE+S+FG+YNK+Q YPPPS +E+R+RFIAA+ENALN M GMLTMNP KRW+ I+CL SE
Sbjct: 181 WPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240

Query: 296 YFKEMPPPSDPSEI 309
           YF E+P P+ PSE+
Sbjct: 241 YFVELPVPTTPSEL 254

>KLLA0D11990g join(complement(1023928..1023944),
           gi|2499590|sp|Q92241|PH85_KLULA Kluyveromyces lactis
           NEGATIVE REGULATOR OF THE PHO SYSTEM, hypothetical start
          Length = 304

 Score =  227 bits (579), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 114/301 (37%), Positives = 183/301 (60%), Gaps = 13/301 (4%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEI 68
           +  +++ + +KVG GTYA VY G  ++TG  +A+KE+K    ++G   +AIRE+  ++E+
Sbjct: 2   VAPSQFKQLEKVGNGTYATVYKGLNKTTGVYVALKEVKLDS-EEGTPSTAIREISLMKEL 60

Query: 69  QHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPAD-----IKSWMLMTLRG 123
           +HDN++ L D+    + L LV EF+ +DL+  + +R+   +        +K +    L+G
Sbjct: 61  KHDNIVRLFDVIHTENKLTLVFEFMDNDLKKFMDNRNKGNSHKGLEMDLVKYFQWQLLQG 120

Query: 124 VHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELL 183
           V  CH N ILHRDLKP NLL++  G +K+ DFGLARA   P    +S VVT WYRAP++L
Sbjct: 121 VAFCHENRILHRDLKPQNLLINNRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVL 180

Query: 184 FGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFG 243
            G+++Y ++IDIWS G I AE+++  P  PG ND +Q+++ F  +GTP ++ WP+V+   
Sbjct: 181 MGSRNYCTSIDIWSCGCILAEMIMGKPLFPGSNDEEQLKLIFDTMGTPVEQTWPQVTQLA 240

Query: 244 SYNKLQIYPPPSIDELRKRFIAASE-----NALNFMCGMLTMNPKKRWNAIECLESEYFK 298
            YN L   PP    +L++     +E     N ++ + G+L +NP  R +A + L   +F 
Sbjct: 241 KYNPL--LPPHMPRDLKQLLQNNTEEVLDDNVVDLLHGLLQLNPDARLSAKDALNHPWFA 298

Query: 299 E 299
           E
Sbjct: 299 E 299

>CAGL0L12474g complement(1345044..1345952) highly similar to
           sp|P17157 Saccharomyces cerevisiae YPL031c
           cyclin-dependent protein kinase, start by similarity
          Length = 302

 Score =  221 bits (563), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 111/299 (37%), Positives = 179/299 (59%), Gaps = 9/299 (3%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEI 68
           ++ +++ + +K+G GTYA VY G  +STG  +A+KE+K    ++G   +AIRE+  ++E+
Sbjct: 1   MSSSQFKQLEKLGNGTYATVYKGLNKSTGVYVALKEVKLDS-EEGTPSTAIREISLMKEL 59

Query: 69  QHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPAD-----IKSWMLMTLRG 123
           +HDN++ L D+    + L LV E++ +DL+  +  R++   P       +K +    L G
Sbjct: 60  KHDNIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNAPRGLEMNLVKYFQWQLLEG 119

Query: 124 VHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELL 183
           +  CH N ILHRDLKP NLL++  G +K+ DFGLARA   P    +S VVT WYRAP++L
Sbjct: 120 LAFCHENKILHRDLKPQNLLITKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVL 179

Query: 184 FGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFG 243
            G++ Y+++IDIWS G I AE++   P  PG ND +Q+++ F  +GTP +  WP V+S  
Sbjct: 180 MGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDKMGTPNETTWPGVTSLP 239

Query: 244 SYN-KLQIYPPPSIDELRKRFIAA--SENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
            YN   Q   P  +    + ++     +N ++ + G+L +NP  R +A + L   +F E
Sbjct: 240 KYNPNFQQRLPKDLKAELQPYVKEPLDDNVIDLLHGLLQLNPDMRLSAKQALLHPWFSE 298

>AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH]
           (246896..247790,247838..247854) [912 bp, 303 aa]
          Length = 303

 Score =  219 bits (557), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 113/301 (37%), Positives = 178/301 (59%), Gaps = 9/301 (2%)

Query: 7   TPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQ 66
           T  +   + + +++G GTYA VY G  ++TG  +A+KE+K    ++G   +AIRE+  ++
Sbjct: 2   TSTSHIRFKQLERLGNGTYATVYKGLNKTTGLYVALKEVKLDS-EEGTPSTAIREISLMK 60

Query: 67  EIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPAD-----IKSWMLMTL 121
           E++H+N++ L D+    + L LV EF+ +DL+  +  R     P       +K +    L
Sbjct: 61  ELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRLDREMPRGLELSLVKYFQWQLL 120

Query: 122 RGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPE 181
           +GV  CH N ILHRDLKP NLL++  G +K+ DFGLARA   P    +S VVT WYRAP+
Sbjct: 121 QGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPD 180

Query: 182 LLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSS 241
           +L G++ Y ++IDIWS G I AE+++     PG ND +Q+++ F  +GTPT++ W  VS 
Sbjct: 181 VLMGSRTYCTSIDIWSCGCILAEMIMGKALFPGTNDDEQLKLIFETMGTPTEQTWVGVSQ 240

Query: 242 FGSYN-KLQIYPPPSIDELRKRFIAA--SENALNFMCGMLTMNPKKRWNAIECLESEYFK 298
              YN ++ +YP   I +L +       S+  +N + G+L +NP  R +A + L    F+
Sbjct: 241 LPKYNPQIPLYPNKDIKQLLQATTKEQISDVLVNLIQGLLQLNPSMRLSAQQALSHPLFE 300

Query: 299 E 299
           E
Sbjct: 301 E 301

>Scas_568.9*
          Length = 306

 Score =  218 bits (556), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 111/296 (37%), Positives = 174/296 (58%), Gaps = 21/296 (7%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELV 77
           +K+G GTYA VY G  ++TG  +A+KE+K    ++G   +AIRE+  ++E++H+N++ L 
Sbjct: 6   EKLGNGTYATVYKGLNKTTGAYVALKEVKLDS-EEGTPSTAIREISLMKELKHENIVRLY 64

Query: 78  DIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPAD-----IKSWMLMTLRGVHHCHRNFI 132
           D+    + L LV E++ +DL+  +  R++  +P       +K +    L G+  CH N I
Sbjct: 65  DVIHTENKLTLVFEYMDNDLKKYMDSRTVGNSPRGLELNLVKYFQWQLLEGLAFCHENKI 124

Query: 133 LHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192
           LHRDLKP NLL++  G +K+ DFGLARA   P    +S VVT WYRAP++L G++ Y+++
Sbjct: 125 LHRDLKPQNLLINKKGALKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTS 184

Query: 193 IDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYN------ 246
           IDIWS G I AE++   P  PG ND +Q+++ F  +GTPT+  WP VS+   YN      
Sbjct: 185 IDIWSCGCILAEMITGKPLFPGSNDEEQLKLIFETMGTPTEATWPGVSALPKYNPNFPQR 244

Query: 247 ---KLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
               L++   P   E         +N ++ + G+L +NP  R +A + L   +F E
Sbjct: 245 LPKDLRMVLQPYCKE------PLDDNVIDLLHGLLQLNPDMRLSAKQALHHPWFAE 294

>KLLA0B09790g complement(855327..856214) highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28 cyclin-dependent
           protein kinase, start by similarity
          Length = 295

 Score =  209 bits (531), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 172/294 (58%), Gaps = 10/294 (3%)

Query: 12  TEYTKGKKVGEGTYAVVYLGTK-QSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQH 70
           T Y + +KVGEGTY VVY     +   R +A+K+I+     +G+  +AIRE+  L+E++ 
Sbjct: 5   TNYKRLEKVGEGTYGVVYKAVDLRHQNRVVAMKKIRLESEDEGVPSTAIREISLLKELKD 64

Query: 71  DNVIELVDIFMA-YDNLNLVLEFLPSDL----EVIIKDRSILFTPADIKSWMLMTLRGVH 125
           DN++ L DI  +    L LV EFL  DL    E I KD+ +      IK +M+   +G+ 
Sbjct: 65  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQPL--GGNIIKKFMMQLCKGIA 122

Query: 126 HCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFG 185
           +CH + I+HRDLKP NLL++ DG +K+ DFGLARA   P    T  +VT WYRAPE+L G
Sbjct: 123 YCHAHRIIHRDLKPQNLLINRDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLG 182

Query: 186 AKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSY 245
            K Y++ +D+WS+G IFAE+  R P   G ++IDQ+   FR LGTP ++ WP++     +
Sbjct: 183 GKQYSTGVDVWSIGCIFAEMCNRKPLFSGDSEIDQIFKIFRVLGTPNERTWPDIIYLPDF 242

Query: 246 NKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
                +P  +   L +   +   N ++ +  ++T +P  R +A   ++  YFKE
Sbjct: 243 K--TTFPKWNRRNLSEVIPSLDANGIDLLDKLITYDPIHRISAKRAVQHPYFKE 294

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score =  205 bits (521), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 173/294 (58%), Gaps = 10/294 (3%)

Query: 12  TEYTKGKKVGEGTYAVVYLGTKQSTGRQI-AVKEIKTSEFKDGLDMSAIREVKYLQEIQH 70
           T Y + +KVGEGTY VVY       G++I A+K+I+     +G+  +AIRE+  L+E++ 
Sbjct: 5   TNYKRLEKVGEGTYGVVYKAVDLRHGQRIVALKKIRLESEDEGVPSTAIREISLLKELKD 64

Query: 71  DNVIELVDIFMA-YDNLNLVLEFLPSDL----EVIIKDRSILFTPADIKSWMLMTLRGVH 125
           DN++ L DI  +    L LV EFL  DL    E + KD+ +      IK +M+   +G+ 
Sbjct: 65  DNIVRLYDIVHSDAHKLYLVFEFLELDLKRYMESVPKDQPL--GDKIIKKFMMQLCKGIA 122

Query: 126 HCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFG 185
           +CH + I+HRDLKP NLL++ +G +K+ DFGLARA   P    T  +VT WYRAPE+L G
Sbjct: 123 YCHAHRIIHRDLKPQNLLINRNGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLG 182

Query: 186 AKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSY 245
            K Y++ +D+WS+G IFAE+  R P   G ++IDQ+   FR LGTP +  WP++     +
Sbjct: 183 GKQYSTGVDVWSIGCIFAEMCNRKPLFSGDSEIDQIFKIFRLLGTPNESVWPDIVYLPDF 242

Query: 246 NKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
                +P     +L +   + +E+ L+ +  ++T +P  R +A   +   YFK+
Sbjct: 243 K--PTFPKWQRRDLAQVVPSLNEHGLDLLDKLVTYDPIHRISAKRAVTHPYFKD 294

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score =  199 bits (507), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 117/312 (37%), Positives = 173/312 (55%), Gaps = 28/312 (8%)

Query: 1   MSTEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTG---RQIAVKEIKTSEFKDGLDMS 57
           MS+E+        Y + +KVGEGTY VVY       G   R +A+K+I+     +G+  +
Sbjct: 1   MSSELAN------YKRLEKVGEGTYGVVYKALDLRPGKGQRVVALKKIRLESEDEGVPST 54

Query: 58  AIREVKYLQEIQHDNVIELVDIFMA-YDNLNLVLEFLPSDL----EVIIKDRSILFTPAD 112
           AIRE+  L+E++ DN++ L DI  +    L LVLEFL  DL    E I KD+ +      
Sbjct: 55  AIREISLLKELKDDNIVRLYDIVHSDAHKLYLVLEFLDLDLKRYMESIPKDQPLGVNI-- 112

Query: 113 IKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNV 172
           IK +M+   +G+ +CH + ILHRDLKP NLL+  +G +K+ DFGLARA   P    T  +
Sbjct: 113 IKKFMVQLCKGIAYCHAHRILHRDLKPQNLLIDKEGNLKLGDFGLARAFGVPLRAYTHEI 172

Query: 173 VTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPT 232
           VT WYRAPE+L G K Y++ +D WS+G IFAE+  R P   G ++IDQ+   FR LGTP+
Sbjct: 173 VTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRILGTPS 232

Query: 233 DKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAA-----SENALNFMCGMLTMNPKKRWN 287
           +  WP++     +        PS  + R++ +A        + ++ +  +L  +P  R +
Sbjct: 233 EAVWPDIVYLPDFK-------PSFPQWRRKDLAEVVPSLDPHGIDLLDKLLAYDPINRIS 285

Query: 288 AIECLESEYFKE 299
           A       YF E
Sbjct: 286 ARRAANHPYFHE 297

>Scas_721.46
          Length = 296

 Score =  199 bits (505), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 167/294 (56%), Gaps = 10/294 (3%)

Query: 12  TEYTKGKKVGEGTYAVVYLGTKQSTG-RQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQH 70
             Y + +KVGEGTY VVY       G R +A+K+I+     +G+  +AIRE+  L+E++ 
Sbjct: 6   ANYKRLEKVGEGTYGVVYKALDMRQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKD 65

Query: 71  DNVIELVDIFMA-YDNLNLVLEFLPSDL----EVIIKDRSILFTPADIKSWMLMTLRGVH 125
           DN++ L DI  +    L LV EFL  DL    E I KD+S+      IK +M    +G+ 
Sbjct: 66  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQSL--GSDIIKKFMRQLCKGIA 123

Query: 126 HCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFG 185
           +CH + ILHRDLKP NLL++ +G +K+ DFGLARA   P    T  +VT WYRAPE+L G
Sbjct: 124 YCHAHRILHRDLKPQNLLINKEGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLG 183

Query: 186 AKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSY 245
            K Y++ +D WS+G IFAE+  R P   G ++IDQ+   FR LGTP +  WP++     +
Sbjct: 184 GKQYSTGVDTWSIGCIFAEMCNRSPIFSGDSEIDQIFKIFRILGTPNESVWPDIVYLPDF 243

Query: 246 NKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
                +P     +L++   +     ++ +  +L  +P  R +A   +   YF++
Sbjct: 244 KP--NFPQWRRKDLKQVVPSLDPQGIDLLDKLLAYDPINRISARRAVVHPYFQQ 295

>YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent
           protein kinase essential for completion of START and for
           mitosis, associates with Cks1p and cyclins [897 bp, 298
           aa]
          Length = 298

 Score =  198 bits (504), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 115/302 (38%), Positives = 169/302 (55%), Gaps = 24/302 (7%)

Query: 12  TEYTKGKKVGEGTYAVVYLGTKQSTG---RQIAVKEIKTSEFKDGLDMSAIREVKYLQEI 68
             Y + +KVGEGTY VVY       G   R +A+K+I+     +G+  +AIRE+  L+E+
Sbjct: 6   ANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKEL 65

Query: 69  QHDNVIELVDIFMA-YDNLNLVLEFLPSDL----EVIIKDRSILFTPADI-KSWMLMTLR 122
           + DN++ L DI  +    L LV EFL  DL    E I KD+ +    ADI K +M+   +
Sbjct: 66  KDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPL---GADIVKKFMMQLCK 122

Query: 123 GVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPEL 182
           G+ +CH + ILHRDLKP NLL++ DG +K+ DFGLARA   P    T  +VT WYRAPE+
Sbjct: 123 GIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEV 182

Query: 183 LFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF 242
           L G K Y++ +D WS+G IFAE+  R P   G ++IDQ+   FR LGTP +  WP++   
Sbjct: 183 LLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYL 242

Query: 243 GSYNKLQIYPPPSIDELRKRFIAA-----SENALNFMCGMLTMNPKKRWNAIECLESEYF 297
             +        PS  + R++ ++          ++ +  +L  +P  R +A       YF
Sbjct: 243 PDFK-------PSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYF 295

Query: 298 KE 299
           +E
Sbjct: 296 QE 297

>Scas_610.7
          Length = 668

 Score =  207 bits (526), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 119/329 (36%), Positives = 182/329 (55%), Gaps = 40/329 (12%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           Y + KK+G+GT+  VY G   +T RQIA+K+I  +  KD   ++A RE+  L+ + H N+
Sbjct: 72  YREDKKLGQGTFGEVYKGVHLATQRQIAMKKILVNVEKDLFPITAQREIVILKRLNHKNI 131

Query: 74  IELVDIFMAY--------------------------DNLNLVLEFLPSDLEVIIKDRSIL 107
           I+L+++   Y                           +  ++L ++ +DL  I+ +  I 
Sbjct: 132 IKLIEMVYDYAPDSSSSRAAEVKSLSTAAGPPASPSKHFYMILPYMVADLSGILHNPRIT 191

Query: 108 FTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAV-PSPHE 166
               DIK+ ML  L GV++ H    +HRD+K  N+L+  +G++K+ADFGLAR    SP  
Sbjct: 192 LEMPDIKNIMLQVLEGVNYIHCQKFMHRDIKAANILIDHNGILKLADFGLARTYYGSPPN 251

Query: 167 M-----------LTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQ 215
           +            TS VVTRWYRAPEL+ G KHYT+A+DIW VG +FAEL  + P L G 
Sbjct: 252 LKYPGGAGSGAKYTSVVVTRWYRAPELVLGDKHYTTAVDIWGVGCVFAELFEKKPILQGS 311

Query: 216 NDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMC 275
           +DIDQ  + F+ +GTPT++EW            +     +IDE   +++  S   L+F+ 
Sbjct: 312 SDIDQGHIIFKLMGTPTEEEWKLAHYLPGSELTRTNYKSTIDERFGKWLDKS--GLDFLK 369

Query: 276 GMLTMNPKKRWNAIECLESEYFKEMPPPS 304
           G+L ++P KR  A+  ++ E+FKE P PS
Sbjct: 370 GLLALDPYKRLTAMSAVKHEFFKEEPLPS 398

>AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH]
           (805583..806956) [1374 bp, 457 aa]
          Length = 457

 Score =  188 bits (477), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 100/302 (33%), Positives = 170/302 (56%), Gaps = 7/302 (2%)

Query: 7   TPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQ 66
           T   ++ Y +  +VGEGTY  VY      T + +A+K+++    +DG  +++IRE+K LQ
Sbjct: 115 THSVESSYQRITQVGEGTYGKVYKCRNIYTNKLVALKKLRLETERDGFPITSIREIKLLQ 174

Query: 67  EIQHDNVIELVDIFM-AYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVH 125
             QH+NV  + +I   A   + ++ E+  +DL  ++ ++ I F+ A+ K      L+G+ 
Sbjct: 175 HCQHENVSTIAEIMCEAQKTVYMIFEYADNDLSGLLMNKEIHFSDANCKHLFRQLLKGME 234

Query: 126 HCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFG 185
           + H   ILHRD+K +N+L+   G +K+ DFGLAR +    +  T+ V+T WYR PELL G
Sbjct: 235 YLHECRILHRDIKGSNILIDNRGNLKITDFGLARKMKQEPDY-TNRVITLWYRPPELLLG 293

Query: 186 AKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSS---- 241
              Y + +D+W  G +  EL L+  +  G N+++Q+   F+ LGTPT ++WP +      
Sbjct: 294 TTRYGTEVDMWGCGCLLVELFLKAAFFQGTNELEQLRCIFQVLGTPTIEQWPGLFDMPWW 353

Query: 242 FGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMP 301
           F    + +   P   DE +   +  +++  +   G+L  + KKR++A E L+S YF E+P
Sbjct: 354 FMMIPQQKENYPSRFDE-KVSGVLPTQSCRDLARGLLLYDQKKRFSASEALKSAYFYELP 412

Query: 302 PP 303
            P
Sbjct: 413 RP 414

>Kwal_27.11803
          Length = 246

 Score =  181 bits (458), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 145/243 (59%), Gaps = 8/243 (3%)

Query: 65  LQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPAD-----IKSWMLM 119
           ++E++H+N++ L D+    + L LV EF+ +DL+  +  R +  TP       +K +   
Sbjct: 1   MKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQ 60

Query: 120 TLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRA 179
            L+GV  CH N ILHRDLKP NLL++  G +K+ DFGLARA   P    +S VVT WYRA
Sbjct: 61  LLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRA 120

Query: 180 PELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEV 239
           P++L G++ Y+++IDIWS G I AE++   P  PG ND +Q+++ F  +GTPT++ WP V
Sbjct: 121 PDVLMGSRTYSTSIDIWSCGCILAEMITGRPLFPGTNDEEQLKLIFETMGTPTERTWPGV 180

Query: 240 SSFGSYN-KLQIYPPPSIDELRKRFIAASEN--ALNFMCGMLTMNPKKRWNAIECLESEY 296
           S+   YN +L  + P  +  L +       +   ++ + G+L  NP +R +A + L   +
Sbjct: 181 STLPKYNPQLPQHLPKDLGALLQSQTREKMDLTLIDLLYGLLQPNPDRRLSAKQALNHPW 240

Query: 297 FKE 299
           F E
Sbjct: 241 FAE 243

>CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces
           cerevisiae YKL139w CTK1 carboxy-terminal domain kinase,
           hypothetical start
          Length = 553

 Score =  187 bits (475), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 99/309 (32%), Positives = 169/309 (54%), Gaps = 7/309 (2%)

Query: 2   STEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIRE 61
           +T ++ P+  + Y +  +VGEGTY  VY      T   +A+K+++    ++G  +++IRE
Sbjct: 209 TTFLSRPMNDSVYERLLQVGEGTYGKVYKARNTVTKELVALKKLRLQGEREGFPITSIRE 268

Query: 62  VKYLQEIQHDNVIELVDIFMAYDNL-NLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMT 120
           +K LQ   H+NV  + +I +    +  ++ E+  +DL  ++ ++ I    A  K      
Sbjct: 269 IKLLQSFNHENVSTIKEIMVESQKIIYMIFEYADNDLGGLLLNKQININAAQSKHIFKQI 328

Query: 121 LRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEML---TSNVVTRWY 177
           L G+ + H N ILHRD+K +N+L+   G +K+ DFGLAR +    + +   T+ V+T WY
Sbjct: 329 LHGIEYLHDNNILHRDIKGSNILIDNQGSLKLTDFGLARKIDCNRDAIRDYTNRVITIWY 388

Query: 178 RAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWP 237
           R PELL G  +Y   +D+W  G I  EL  ++    G N+++Q+E  F+ +G+P+ ++WP
Sbjct: 389 RPPELLLGTTNYGPEVDMWGCGCILVELFNKMAIFQGTNELEQLEAIFKVMGSPSIEQWP 448

Query: 238 EVSS---FGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLES 294
            +     F      Q    P++ E + R +  ++N      G+L  + +KR  A E L+S
Sbjct: 449 NIFDMPWFFMIMPQQATKYPNVFEEKFRAVLETDNCFKLAQGLLRYDQEKRLTASEALQS 508

Query: 295 EYFKEMPPP 303
           EYFKE P P
Sbjct: 509 EYFKEDPQP 517

>CAGL0I08349g complement(813728..815731) similar to sp|P23293
           Saccharomyces cerevisiae YPR161c SGV1 ser/thr protein
           kinase, hypothetical start
          Length = 667

 Score =  188 bits (478), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 115/334 (34%), Positives = 178/334 (53%), Gaps = 43/334 (12%)

Query: 11  QTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQH 70
           Q  Y + +K+G+GT+  VY G    T R++A+K I  ++  D   ++A RE+  L+ + H
Sbjct: 57  QGNYKEEEKLGQGTFGEVYKGLHLQTQRKVAMKRIIVNQENDLFPITAQREITILKRLNH 116

Query: 71  DNVIELVDIFMAYD-------------NLN--------------LVLEFLPSDLEVIIKD 103
            N+I+L++  M YD             N N              ++L ++ +DL  I+ +
Sbjct: 117 KNIIKLLE--MVYDFPPESNNKDYAQFNQNNSANPPAVPKKFFYMILPYMVADLSGILHN 174

Query: 104 RSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAV-P 162
             I    ADIK+ M   L GV+  H +  +HRD+K  NLL+  +GV+K+ADFGLAR    
Sbjct: 175 PRIELKMADIKNMMKQILEGVNFIHCSKFMHRDIKTANLLIDHNGVLKLADFGLARQYYG 234

Query: 163 SPHEM-----------LTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPY 211
           SP  +            TS VVTRWYRAPEL+ G K+YT+A+DIW VG +FAE   + P 
Sbjct: 235 SPPNIKFPGSAGSGAKYTSVVVTRWYRAPELVLGDKYYTTAVDIWGVGCVFAEFFEKKPI 294

Query: 212 LPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENAL 271
           L G+ DIDQ  V F+ +GTP ++ W            +     +IDE   + +  +   L
Sbjct: 295 LQGKTDIDQGHVIFKLMGTPDERTWELAKYLPGAELTKTEYKSTIDERFGKHLTPT--GL 352

Query: 272 NFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSD 305
           +F+ G+L ++P KR  A+  ++  +F+E P  +D
Sbjct: 353 SFLKGLLALDPYKRLTAMSAMKHPFFQEEPLAAD 386

>Scas_721.110
          Length = 520

 Score =  183 bits (465), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 104/306 (33%), Positives = 164/306 (53%), Gaps = 15/306 (4%)

Query: 10  TQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ 69
           T + Y +  +VGEGTY  VY    + T   +A+K+++ +  KDG  +++IRE+K LQ   
Sbjct: 181 TSSIYERIVQVGEGTYGKVYKARNEVTSHLVALKKLRLNNEKDGFPITSIREIKLLQTFH 240

Query: 70  HDNVIELVDIFMAYDNL-NLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCH 128
           H N+  LV+I +    +  ++ E+  +DL  ++ D++++ +    K      LRGV + H
Sbjct: 241 HPNIATLVEIMVESSKMVYMIFEYADNDLTGLLGDKNVVMSLGQRKHLFQQLLRGVKYLH 300

Query: 129 RNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSN-----VVTRWYRAPELL 183
            + ILHRD+K +N+L+   G +K+ DFGLAR +    +   SN     V+T WYR PELL
Sbjct: 301 DSLILHRDIKGSNILIDNKGNLKITDFGLARKMHVKSDSDGSNDYTNRVITLWYRPPELL 360

Query: 184 FGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFG 243
            G  +Y++ +D+W  G I  EL   +    GQN+I+Q+   F+ +G+P    WP      
Sbjct: 361 MGTTNYSTEVDMWGCGCILMELFNNVSIFQGQNEIEQLLSIFKIMGSPNLDNWPNFFEMP 420

Query: 244 SYNKLQIYP------PPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYF 297
            +    I P      P   +E  K  + +SE   N   G+L  + KKR +A E L+S YF
Sbjct: 421 WF--FMIIPMLTEKYPDLFEEKYKNLLPSSE-CFNLAKGLLLYDQKKRLSAEEALKSPYF 477

Query: 298 KEMPPP 303
            E P P
Sbjct: 478 TEDPQP 483

>Kwal_26.7552
          Length = 461

 Score =  181 bits (459), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 164/294 (55%), Gaps = 5/294 (1%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           Y + ++VGEGTY  VY      TG+ +A+K ++    ++G  +++IRE+K LQ   H N+
Sbjct: 131 YERIQQVGEGTYGKVYKARNTVTGQLVALKRLRLEGEREGFPITSIREIKLLQSFDHRNI 190

Query: 74  IELVDIFM-AYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFI 132
             L +I + +   + ++ E+  +DL  ++ +  I  + A+ K      L G+H+ H N I
Sbjct: 191 STLSEIMVESQKTVYMIFEYADNDLSGLLMNEQITLSNANCKHLFKSLLEGIHYLHDNGI 250

Query: 133 LHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192
           LHRD+K +N+L+   G +K+ DFGLAR +    +  T+ V+T WYR PELL G+ +Y +A
Sbjct: 251 LHRDIKGSNILIDNKGQLKITDFGLARKMRDDSD-YTNRVITLWYRPPELLMGSTNYGTA 309

Query: 193 IDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWP---EVSSFGSYNKLQ 249
           +D+W  G +  EL  +     G N+++Q+   F  +GTPT ++WP   E+  F      Q
Sbjct: 310 VDMWGCGCLLVELFKKTAIFQGTNEVEQLNAIFSIMGTPTVEQWPNLFEMPWFFMMIPQQ 369

Query: 250 IYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPP 303
                S  + +   I  S  A +   G+L  + K+R++A + L+ +YF+E P P
Sbjct: 370 TRKHESKFDEKFGPILPSSAAADLAKGLLLYDEKRRFSASDALKHQYFREEPEP 423

>Kwal_55.21900
          Length = 625

 Score =  184 bits (468), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 114/327 (34%), Positives = 172/327 (52%), Gaps = 36/327 (11%)

Query: 11  QTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQH 70
           Q  Y + KK+G+GT+  VY G    T RQ+A+K       KD   ++A RE+  L+++ H
Sbjct: 54  QGHYKEDKKLGQGTFGEVYRGVHLETQRQVAMKRTIVKAEKDLFPITAQREITILRKLNH 113

Query: 71  DNVIELVDIFMAY----------------------DNLNLVLEFLPSDLEVIIKDRSILF 108
            NVI+L+++   Y                       +  ++L ++ +DL  I+ +  I  
Sbjct: 114 KNVIKLIEMVYDYPPTSSNGSSNTTTLPNPNTPSTKSFYMILPYMIADLSGILHNPRIKL 173

Query: 109 TPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLAR----AVPS- 163
               IK+ +L  L G+++ H    +HRD+K  NLLL   GV+K+ADFGLAR    A P+ 
Sbjct: 174 GMEGIKNILLQILEGINYIHCQKFMHRDIKAANLLLDHKGVLKIADFGLARNYYGAPPNL 233

Query: 164 -------PHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQN 216
                       TS VVTRWYRAPEL+ G KHYT+A+D+W VG +F EL  + P L GQ 
Sbjct: 234 KYPGGAGVDAKYTSVVVTRWYRAPELVLGDKHYTTAVDMWGVGCVFGELFEKKPILQGQT 293

Query: 217 DIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCG 276
           DIDQ  V F+ LGTP+++EWP           +    P+I E    ++  ++  L+ +  
Sbjct: 294 DIDQGHVIFKLLGTPSEEEWPLARFLPGAELTRTKYSPNIRERFGEYL--TDTGLDLLSQ 351

Query: 277 MLTMNPKKRWNAIECLESEYFKEMPPP 303
           +L ++P KR  A+   +  +F E P P
Sbjct: 352 LLCLDPYKRLTAMAAKKHPFFTEEPLP 378

>KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1
           Kluyveromyces lactis CTD kinase largest subunit,
           hypothetical start
          Length = 455

 Score =  177 bits (448), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 160/294 (54%), Gaps = 14/294 (4%)

Query: 19  KVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELVD 78
           +VGEGTY  VY      TG+ IA+K ++  + +DG  +++IRE+K LQ++ H N+  + +
Sbjct: 134 QVGEGTYGKVYKAENVHTGKLIALKRLRLEQERDGFPITSIREIKLLQQLNHPNISLIHE 193

Query: 79  IFMAYDN-LNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDL 137
           I ++  N +++  +++ +DL  ++ D+SI F+ ++IK  M     G+ + H+  I+HRD+
Sbjct: 194 IIVSDKNTISMGFQYMENDLSGMLMDKSIQFSDSNIKHLMKQLFVGLQYLHQQQIVHRDI 253

Query: 138 KPNNLLLSPDGVIKVADFGLARA---VPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAID 194
           K +NLL+   G +K+ DFGLA+    V SP    T+ V+T WYR PELL GA  Y   +D
Sbjct: 254 KGSNLLIDNRGNLKITDFGLAKKLTDVSSPASN-TNRVITLWYRPPELLLGATDYKYEVD 312

Query: 195 IWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKL-----Q 249
            W  G +  EL       PG N++DQ +     +G+PT ++WP++     +  L     +
Sbjct: 313 CWGCGCLLVELFAGAAIFPGSNEVDQFQRILSIMGSPTLEQWPKMLDMPWWFMLVPQISK 372

Query: 250 IYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPP 303
            Y     DE    F    ++AL+    +L  +   R+   E L+  YF   P P
Sbjct: 373 TYKNVFFDE----FSKVPQDALDLASKLLRYDQDTRFTTTEALQHHYFTNEPKP 422

>ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH]
           (735828..738089) [2262 bp, 753 aa]
          Length = 753

 Score =  181 bits (460), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 108/325 (33%), Positives = 174/325 (53%), Gaps = 37/325 (11%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           Y + KK+G+GT+  VY G   +T RQ+A+K+I      D   ++A RE+  L+ + H NV
Sbjct: 56  YKEEKKLGQGTFGEVYRGVHLATQRQVAMKKILVKTENDLFPITAQREITILKRLNHRNV 115

Query: 74  IELVDIFMAY-----------------------DNLNLVLEFLPSDLEVIIKDRSILFTP 110
           ++L+++   Y                        +  ++L ++ +DL  I+ +  +    
Sbjct: 116 VQLIEMVYDYPPAQNGAAYGQDSSQASASADTMKSFYMILPYMVADLSGILHNPRVTLEM 175

Query: 111 ADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLAR----AVPS--- 163
           ADIK+ ML  L G+++ H    +HRD+K  N+LL   G++K+ADFGLAR    A P+   
Sbjct: 176 ADIKNMMLQILEGINYIHCKKFMHRDIKTANILLDHKGILKIADFGLARNYYGAPPNLKY 235

Query: 164 -----PHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDI 218
                     TS VVTRWYRAPEL+ G K+YT+A+DIW +G +FAE   + P L G+ DI
Sbjct: 236 PGGAGTDAKYTSVVVTRWYRAPELVLGDKNYTTAVDIWGIGCVFAEFFEKRPILQGKTDI 295

Query: 219 DQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGML 278
           DQ  V F+ +GTP+D +W            +    P+  E   +++  +E  L+ +  +L
Sbjct: 296 DQGHVIFKLMGTPSDSDWQLARYLPGAELTRTSYEPTYKERFGKYL--TEKGLDLLSTLL 353

Query: 279 TMNPKKRWNAIECLESEYFKEMPPP 303
           +++P KR  A+  ++  +F E P P
Sbjct: 354 SLDPYKRLTAMAAMQHPFFSEDPLP 378

>Kwal_27.11919
          Length = 209

 Score =  169 bits (428), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 92/205 (44%), Positives = 128/205 (62%), Gaps = 8/205 (3%)

Query: 12  TEYTKGKKVGEGTYAVVYLGTKQSTG-RQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQH 70
             Y + +KVGEGTY VVY       G R +A+K+I+     +G+  +AIRE+  L+E++ 
Sbjct: 5   ANYKRLEKVGEGTYGVVYKALDLRHGQRVVALKKIRLESEDEGVPSTAIREISLLKELKD 64

Query: 71  DNVIELVDIFMA-YDNLNLVLEFLPSDL----EVIIKDRSILFTPADIKSWMLMTLRGVH 125
           DN++ L DI  +    L LV EFL  DL    E I K++ +      IK +M+   +G+ 
Sbjct: 65  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEAIPKEQPL--GDNIIKKFMMQLCKGIA 122

Query: 126 HCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFG 185
           +CH + ILHRDLKP NLL++ DG +K+ADFGLARA   P    T  +VT WYRAPE+L G
Sbjct: 123 YCHSHRILHRDLKPQNLLINRDGNMKLADFGLARAFGVPLRAYTHEIVTLWYRAPEVLLG 182

Query: 186 AKHYTSAIDIWSVGVIFAELMLRIP 210
            K Y++ +DIWS+G IFAE+  R P
Sbjct: 183 GKQYSTGVDIWSIGCIFAEMCNRKP 207

>AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH]
           complement(471481..472560) [1080 bp, 359 aa]
          Length = 359

 Score =  171 bits (433), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 99/306 (32%), Positives = 159/306 (51%), Gaps = 15/306 (4%)

Query: 12  TEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHD 71
           +E+     +GEG Y +V     + +G  +A+K+I+  E +    +  +RE+K L+  QH+
Sbjct: 11  SEFQLKALLGEGAYGIVCSAVHKPSGEVVAIKKIEPFE-RTLFSLRTLREIKILKHFQHE 69

Query: 72  NVIELVDI-----FMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHH 126
           N+I + DI     F  ++ + ++ E + +DL  +I  + +  +   I+ ++  TLRG+  
Sbjct: 70  NIISIYDIQKPASFDTFNEVYIIQELMQTDLHRVIATQPL--SDDHIQYFIYQTLRGLKA 127

Query: 127 CHRNFILHRDLKPNNLLLSPDGVIKVADFGLARA-------VPSPHEMLTSNVVTRWYRA 179
            H + I+HRDLKP+NLLL+ +  +K+ DFGLAR        +  P   +T  V TRWYRA
Sbjct: 128 LHGSGIIHRDLKPSNLLLNANCDLKICDFGLARIEHGGAADLEHPQAGMTEYVATRWYRA 187

Query: 180 PELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEV 239
           PE++  A  YT AIDIWS G I AEL ++ P   G++   Q+ + F  LGTP   +   V
Sbjct: 188 PEVMLTAAQYTKAIDIWSSGCILAELFMKRPLFAGKDYKHQLMLIFELLGTPQGDDLAAV 247

Query: 240 SSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
            S  +   +   P      LR     A+   L+ +  ML  +P++R  A + L   Y   
Sbjct: 248 KSRRAREYIATLPRYRRASLRAVIPHANPLGLDLLQRMLVFDPRRRITAADALRHPYLAT 307

Query: 300 MPPPSD 305
              P D
Sbjct: 308 YHDPRD 313

>Kwal_17.2687
          Length = 362

 Score =  171 bits (432), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 103/329 (31%), Positives = 175/329 (53%), Gaps = 22/329 (6%)

Query: 1   MSTEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR 60
           M  +I   I+ +E+   + +GEG Y VV       TG+ +A+K+I+  + +    +  +R
Sbjct: 1   MGKKIVFNIS-SEFQLQQLLGEGAYGVVCSARHLPTGQMVAIKKIEPFD-RPLFCLRTLR 58

Query: 61  EVKYLQEIQHDNVIELVDI-----FMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKS 115
           E+K L+  QH+N+I + DI     F  ++ + ++ E + +DL  +I  +++  +   I+ 
Sbjct: 59  EIKLLRCFQHENIISIFDIQRPASFETFNEVYIIQELMDTDLHRVIATQTL--SDDHIQY 116

Query: 116 WMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAV-----------PSP 164
           ++   LR +   H   ++HRDLKP NLL++ +  +K+ DFGLAR                
Sbjct: 117 FVYQILRALKCLHGAEVIHRDLKPANLLVNANCDVKLCDFGLARCAGMGPGASNTGKAGE 176

Query: 165 HEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVT 224
              +T  V TRWYRAPE++  A  YT A+D+WS G I AEL+LR P  PG++   Q+ + 
Sbjct: 177 AGQMTEYVATRWYRAPEVMLTAAEYTFAMDVWSCGCILAELLLRRPLFPGKDYHHQLLLI 236

Query: 225 FRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDE-LRKRFIAASENALNFMCGMLTMNPK 283
           F+ +G+PT+ +   V S  +   L   P  +  E LR+    AS  AL+ +  ML  +P+
Sbjct: 237 FQVIGSPTEADLECVRSRRARQYLGTLPRYAAREGLRQLLPQASAEALDLLKRMLVFDPR 296

Query: 284 KRWNAIECLESEYFKEMPPPSD-PSEIKI 311
           +R +A + L   Y +    P D P+  ++
Sbjct: 297 RRISAAQALRHPYLRAYHDPQDEPAATRV 325

>CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces
           cerevisiae YPL042c cyclin-dependent CTD kinase,
           hypothetical start
          Length = 567

 Score =  175 bits (444), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 111/323 (34%), Positives = 176/323 (54%), Gaps = 31/323 (9%)

Query: 2   STEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIRE 61
           ST I+     +E T  ++  E T   +Y   K+    +  ++++  +    G+  SA RE
Sbjct: 162 STIISGDKRNSENTDNRRKAETT---MYYAIKKFKTEKDGIEQLHYT----GISQSACRE 214

Query: 62  VKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRS----ILFTPADIKSWM 117
           +   +E+ ++++ +LV+IF+   ++ +V EF   DL  II   S     +  P  I+S M
Sbjct: 215 MALCRELDNNHLTKLVEIFLQKKSIYMVYEFAEHDLLQIIHFHSHPEKRMIPPRMIRSIM 274

Query: 118 LMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSN---VVT 174
              L GV + H+N++LHRDLKP N++++ DGV+K+ D GLAR   +  + + +    VVT
Sbjct: 275 WQILDGVSYLHQNWVLHRDLKPANIMVTMDGVVKIGDLGLARKFSNMLQTMYTGDKVVVT 334

Query: 175 RWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQN-----------DIDQMEV 223
            WYRAPELL GA+HYT AID+W+VG IFAEL+   P   G+              +Q++ 
Sbjct: 335 IWYRAPELLLGARHYTPAIDLWAVGCIFAELIGLQPIFKGEEAKMDSKKTVPFQANQLQR 394

Query: 224 TFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAAS---ENALNFMCGMLTM 280
             + LGTPT K WP +  +  Y +L  +P    D L   F +A    ++AL+ +  +L  
Sbjct: 395 ILKILGTPTPKSWPHLQKYPEYEQLSKFPKYR-DNLPGWFHSAGGRDKHALSLLYHLLNY 453

Query: 281 NPKKRWNAIECLESEYFK--EMP 301
           NP +R +AI  L+  YF   +MP
Sbjct: 454 NPIERIDAINALDHSYFTHGDMP 476

>KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces
           cerevisiae YPR161c SGV1 ser/thr protein kinase,
           hypothetical start
          Length = 645

 Score =  176 bits (447), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 113/336 (33%), Positives = 177/336 (52%), Gaps = 49/336 (14%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           Y + +K+G+GT+  V+ G    T R++A+K I     KD   ++A RE+  L+ + H N+
Sbjct: 55  YREEEKLGQGTFGEVFKGIHLGTNRKVAIKRILVRAEKDLFPITAQREITILKRMNHKNI 114

Query: 74  IELVDI--------------------FMAYDNLN-----------LVLEFLPSDLEVIIK 102
           ++L++I                    +   +  N           ++L ++ SDL  ++ 
Sbjct: 115 VKLIEIVYDESPTPKTDSTSPRPVGNYHGNNTANQQKLITGKHFFMILPYMVSDLTGLLH 174

Query: 103 DRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAV- 161
           +  + F  AD+K+ ML  L G+++ H N  LHRD+K  N+L+   GV+K+ADFGLAR   
Sbjct: 175 NPRVEFGMADVKNIMLQLLEGINYIHCNKFLHRDIKTANILIDHKGVVKIADFGLARNYY 234

Query: 162 PSPHEM-----------LTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIP 210
            SP  +            TS VVTRWYRAPE++ G +HYT+A+DIW +G +FAE   + P
Sbjct: 235 GSPPNLKYPGGAGSGAKYTSVVVTRWYRAPEIVLGDRHYTTAVDIWGIGCVFAEFFEKKP 294

Query: 211 YLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF-GSYNKLQIYPPPSIDELRKRFIAA-SE 268
            L GQ DIDQ  V F+ +GTP+  EW       GS      Y       L++RF  A +E
Sbjct: 295 ILQGQTDIDQGHVIFKLMGTPSMDEWGLAYHLPGSELTKTNY----KSTLQERFSKALNE 350

Query: 269 NALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPS 304
             L+ +  +L ++P KR  A++  +  +F E P P+
Sbjct: 351 TGLDLLSKLLALDPYKRVTAMKAKKHPFFFEEPLPN 386

>KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces
           cerevisiae YBL016w FUS3 mitogen-activated protein kinase
           (MAP kinase), start by similarity
          Length = 371

 Score =  167 bits (424), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 104/331 (31%), Positives = 170/331 (51%), Gaps = 37/331 (11%)

Query: 12  TEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHD 71
           +E+     +GEG Y VV     + +G  +A+K+I+  E K    +  +RE+K L+  QH+
Sbjct: 11  SEFQLQSLLGEGAYGVVCSAKHKPSGEIVAIKKIEPFE-KPLFSIRTLREIKILKHFQHE 69

Query: 72  NVIELVDI-----FMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHH 126
           N+I + D+     F  ++ + ++ E + +DL  +I  + +  +   ++ ++  TLR +  
Sbjct: 70  NIISIFDVQKPSSFEQFNEVYIIQELMQTDLHRVIVTQEL--SEDHVQYFVYQTLRALKV 127

Query: 127 CHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVP------------------SPHEM- 167
            H + ++HRDLKP+NLLL+ +  +K+ DFGLAR V                   SP    
Sbjct: 128 LHGSNVIHRDLKPSNLLLNSNCDLKICDFGLARIVSERATDGDAHVDADDTDDNSPSSAA 187

Query: 168 ---------LTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDI 218
                    +T  V TRWYRAPE++  A  Y+ ++D+WS G I AEL+ + P  PG++  
Sbjct: 188 NDGDPAISGMTEYVATRWYRAPEVMLTAAQYSKSMDVWSCGCILAELLGKQPLFPGKDYR 247

Query: 219 DQMEVTFRALGTPTDKEWPE-VSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGM 277
           DQ+ + F+ LGTPT++E  E V +  +   ++  P       R+RF  AS  AL+ +  M
Sbjct: 248 DQLILIFQTLGTPTEQELVELVENRRAREYIRSLPKHPKINWRRRFPNASAAALDLLDRM 307

Query: 278 LTMNPKKRWNAIECLESEYFKEMPPPSDPSE 308
           L  +P+ R  A E L   Y      P D  E
Sbjct: 308 LQFDPRLRITATEALSHPYLVSYHDPDDEPE 338

>Kwal_47.17868
          Length = 365

 Score =  166 bits (421), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 103/305 (33%), Positives = 169/305 (55%), Gaps = 26/305 (8%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDN 72
           Y   + VG G++ VV+    + TG ++A+K++ +   FK+       RE++ ++++QH  
Sbjct: 36  YPATEVVGHGSFGVVFTTQVRETGDRVAIKKVLQDRRFKN-------RELEIMKQLQHPQ 88

Query: 73  VIELVDIFMAYD-----NLNLVLEFLPSDL----EVIIKDRSILFTPADIKSWMLMTLRG 123
           V++L   F   D      LNL+LE++P  L       +  RS +    +IK +M    + 
Sbjct: 89  VVDLKYYFYETDPQGEVYLNLILEYMPQSLYQRLRHFVSQRSNM-PRIEIKLYMYQLAKS 147

Query: 124 VHHCHRNF-ILHRDLKPNNLLLSPDG-VIKVADFGLARAVPSPHEMLTSNVVTRWYRAPE 181
           +++ H N  + HRD+KP NLL+ P    +K+ DFG A+ +  P E   S + +R+YRAPE
Sbjct: 148 LNYLHTNARVCHRDIKPQNLLVDPQTFALKLCDFGSAKQL-KPSEPNVSYICSRYYRAPE 206

Query: 182 LLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVS- 240
           L+FGA +YT  IDIWS G + AEL+L  P  PG++ IDQ+    + LGTPT +E   ++ 
Sbjct: 207 LIFGASNYTVQIDIWSSGCVMAELILGQPMFPGESGIDQLVEIIKILGTPTKQEICSMNP 266

Query: 241 SFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEM 300
           ++  +   QI P P    L K F    +  + F+  +L  +P +R+ A++CL + YF E+
Sbjct: 267 NYMEHKFPQIRPIP----LAKVFKREDDETIRFLFDVLRYDPTERYTALQCLCAPYFDEL 322

Query: 301 PPPSD 305
               D
Sbjct: 323 RTTQD 327

>YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine protein
           kinase required for cell cycle arrest and for cell
           fusion during mating, member of the MAP kinase family of
           protein kinases [1062 bp, 353 aa]
          Length = 353

 Score =  164 bits (416), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 165/305 (54%), Gaps = 19/305 (6%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELVDI 79
           +GEG Y VV   T + TG  +A+K+I+  + K    +  +RE+K L+  +H+N+I + +I
Sbjct: 19  LGEGAYGVVCSATHKPTGEIVAIKKIEPFD-KPLFALRTLREIKILKHFKHENIITIFNI 77

Query: 80  -----FMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILH 134
                F  ++ + ++ E + +DL  +I  +  + +   I+ ++  TLR V   H + ++H
Sbjct: 78  QRPDSFENFNEVYIIQELMQTDLHRVISTQ--MLSDDHIQYFIYQTLRAVKVLHGSNVIH 135

Query: 135 RDLKPNNLLLSPDGVIKVADFGLARAV---------PSPHEM-LTSNVVTRWYRAPELLF 184
           RDLKP+NLL++ +  +KV DFGLAR +         P+  +  +T  V TRWYRAPE++ 
Sbjct: 136 RDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWYRAPEVML 195

Query: 185 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTP-TDKEWPEVSSFG 243
            +  Y+ A+D+WS G I AEL LR P  PG++   Q+ + F  +GTP +D +   + S  
Sbjct: 196 TSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPR 255

Query: 244 SYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPP 303
           +   ++  P      L K F   +   ++ +  ML  +P KR  A E LE  Y +    P
Sbjct: 256 AREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDP 315

Query: 304 SDPSE 308
           +D  E
Sbjct: 316 NDEPE 320

>CAGL0L06820g 767038..768138 highly similar to sp|P38615
           Saccharomyces cerevisiae YMR139w MDS1
           Serine/threonine-protein kinase, start by similarity
          Length = 366

 Score =  165 bits (417), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 101/307 (32%), Positives = 172/307 (56%), Gaps = 25/307 (8%)

Query: 6   TTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKY 64
           + PIT   +   + VG G++ VV+    Q T  ++A+K++ +   FK+       RE++ 
Sbjct: 30  SEPIT-ISFPATEVVGHGSFGVVFTTVIQETNEKVAIKKVLQDKRFKN-------RELEI 81

Query: 65  LQEIQHDNVIELVDIFMAYDN-----LNLVLEFLPSDLEVIIKDRSILFTPA---DIKSW 116
           ++ +QH N+I+L   F   D      LNL+L+++P  L   ++      TP    +IK +
Sbjct: 82  MKMLQHRNIIDLKYYFYEIDEREDVFLNLILDYMPQSLYQRLRHFVHQRTPMPRLEIKIY 141

Query: 117 MLMTLRGVHHCHRNF-ILHRDLKPNNLLLSPDG-VIKVADFGLARAVPSPHEMLTSNVVT 174
           M    + +++ H    + HRD+KP NLL+ P+   +++ DFG A+ +  P E   S + +
Sbjct: 142 MYQLFKALNYLHHTANVCHRDIKPQNLLVDPNSWCLRLCDFGSAKQL-KPTEPNVSYICS 200

Query: 175 RWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDK 234
           R+YRAPEL+FGA +YT+ IDIWS G + AEL+L  P  PG++ IDQ+    + LGTPT +
Sbjct: 201 RYYRAPELIFGATNYTNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPTKQ 260

Query: 235 EWPEVS-SFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLE 293
           E   ++ ++  +   QI P P    L K F    E  ++F+      +P +R+++++CL 
Sbjct: 261 EICVMNPNYMEHKFPQIKPIP----LAKVFKKEDEVTVDFLSNTFKYDPTQRYHSLQCLC 316

Query: 294 SEYFKEM 300
           + YF E+
Sbjct: 317 TPYFDEI 323

>CAGL0J04290g complement(400939..402012) similar to sp|P16892
           Saccharomyces cerevisiae YBL016w FUS3 or sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1, start by
           similarity
          Length = 357

 Score =  164 bits (415), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 99/304 (32%), Positives = 162/304 (53%), Gaps = 23/304 (7%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELVDI 79
           +GEG Y VV     + TG  +A+K+I   + K    +  +RE+K L+  QH+N+I + DI
Sbjct: 19  LGEGAYGVVCSAVHKPTGEIVAIKKIVPFD-KPLFALRTLREIKILRRFQHENIISIFDI 77

Query: 80  -----FMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILH 134
                F  ++ + ++ E + +DL  +I  +++  T   I+ ++  TLR +   H + ++H
Sbjct: 78  QKPESFEKFNEVYIIQELMQTDLHRVIATQTL--TDDHIQYFIYQTLRAIKTLHGSNVIH 135

Query: 135 RDLKPNNLLLSPDGVIKVADFGLARAVPSPHEM--------LTSNVVTRWYRAPELLFGA 186
           RDLKP+N+L++ +  +KV DFGLAR + S            +T  V TRWYRAPE++   
Sbjct: 136 RDLKPSNILINSNCDLKVCDFGLARIIDSGENGDNEVDKIGMTEYVATRWYRAPEVMLTN 195

Query: 187 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTP--TDKEWPEVSSFGS 244
             Y+ A+DIWS G I  EL L+ P  PG++   Q+ + F  +GTP  +DK    + S  +
Sbjct: 196 AKYSRAMDIWSCGCILGELFLKRPLFPGKDYRHQLLLIFGLIGTPDSSDKSMECIESRRA 255

Query: 245 YN---KLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMP 301
                 LQ YPP  +  L+K F   +   ++ +  ML  +P++R +A + L   Y     
Sbjct: 256 RQYIASLQKYPP--VRPLQKAFPGVNPVGVDLLSRMLVFDPRERISADDALAHPYLSTYH 313

Query: 302 PPSD 305
            P D
Sbjct: 314 VPED 317

>KLLA0D11814g complement(1007240..1009021) similar to sp|P39073
           Saccharomyces cerevisiae YPL042c SSN3 cyclin-dependent
           CTD kinase, start by similarity
          Length = 593

 Score =  168 bits (425), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 157/289 (54%), Gaps = 28/289 (9%)

Query: 41  AVKEIKTS----EFKDGLDMSAIREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSD 96
           A+K+ KT     E   G+  SA RE+   +E+ ++++ +LV+IF+   ++ +V EF   D
Sbjct: 209 AIKKFKTEREGVEHYTGISQSACREMSLCRELDNNHLTKLVEIFLEKKSIYMVSEFAEHD 268

Query: 97  LEVIIKDRS----ILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKV 152
           L  II   S     L  P  +KS M   L GV + H+N+ILHRDLKP N++++ DG +K+
Sbjct: 269 LLQIIHFHSHPEKRLIPPRMLKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCVKI 328

Query: 153 ADFGLARAVPSPHEMLTSN---VVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRI 209
            D GLAR   +  + L +    +VT WYRAPEL+ GA+HYT AID+W+VG IFAEL+   
Sbjct: 329 GDLGLARKFNNMVQTLYTGDKVIVTIWYRAPELILGARHYTPAIDLWAVGCIFAELIGLR 388

Query: 210 PYLPGQN-----------DIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSI-D 257
           P   G+              +Q +     +G+P  K WP + S+  Y  LQ+   P   D
Sbjct: 389 PIFKGEEAKMESKKSVLFQANQFQKILEVMGSPDHKIWPNIDSYPEY--LQLAKMPKYRD 446

Query: 258 ELRKRFIAAS---ENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPP 303
            L   +  A    + AL+ +  +L  +P KR +AI+ L+  YF    PP
Sbjct: 447 NLTAWYQTAGGKDKTALDILYRLLQYDPIKRIDAIDALDHVYFTNGDPP 495

>Scas_710.28
          Length = 352

 Score =  162 bits (411), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 160/301 (53%), Gaps = 18/301 (5%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELVDI 79
           +GEG Y VV     + TG  +A+K+I+  + K    +  +RE+K L+  QH+N+I + DI
Sbjct: 19  LGEGAYGVVCSAVHKPTGEIVAIKKIEPFD-KPLFALRTLREIKILKHFQHENIISIFDI 77

Query: 80  -----FMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILH 134
                F  ++ + ++ E + +DL  +I  +++  T   I+ ++  TLR V   H + ++H
Sbjct: 78  QRPESFENFNEVYIIQELMQTDLHRVISTQNL--TDDHIQYFIYQTLRAVKVLHGSNVIH 135

Query: 135 RDLKPNNLLLSPDGVIKVADFGLARAVPS------PHEML----TSNVVTRWYRAPELLF 184
           RDLKP+NLL++ +  +K+ DFGLAR +        P+  L    T  V TRWYRAPE++ 
Sbjct: 136 RDLKPSNLLINSNCDLKICDFGLARIIEEDTGDDEPNAQLQNGMTEYVATRWYRAPEVML 195

Query: 185 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGS 244
            A  Y+ A+DIWS G I AEL ++ P  PG++   Q+ + F  +GTP+ ++   + S  +
Sbjct: 196 TAARYSKAMDIWSCGCILAELFMKRPIFPGKDYRHQLMLIFGLIGTPSGRDLLCIESRRA 255

Query: 245 YNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPS 304
              +   P        K F   +   ++ +  ML  +P+ R  A E L   Y K    P+
Sbjct: 256 REYITTLPKYEPVPWEKVFPNVNPLGIDLLQRMLIFDPRSRITAEEALAHPYLKTYHDPN 315

Query: 305 D 305
           D
Sbjct: 316 D 316

>Kwal_27.11830
          Length = 575

 Score =  167 bits (423), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 158/290 (54%), Gaps = 28/290 (9%)

Query: 40  IAVKEIKTSE------FKDGLDMSAIREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFL 93
            A+K+ KT           G+  SA RE+   +E+++ ++  LV+IF+ + ++ +V EF 
Sbjct: 189 FAIKKFKTEREGVEQLHYTGISQSACREMSLCRELRNKHLTHLVEIFLEHKSIYMVSEFA 248

Query: 94  PSDLEVIIKDRS----ILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGV 149
             DL  II   S     L  P  +KS +   L GV + H+N+ILHRDLKP N++++ DG 
Sbjct: 249 EHDLLQIIHFHSHPEKRLIPPRMLKSIIWQILDGVSYLHQNWILHRDLKPANIMVTVDGC 308

Query: 150 IKVADFGLARAVPSPHEMLTSN---VVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELM 206
           +K+ D GLAR   +  + L +    VVT WYRAPELL GA+HYT AID+W+VG IFAEL+
Sbjct: 309 VKIGDLGLARKFHNMVQTLYAGDKVVVTIWYRAPELLLGARHYTPAIDLWAVGCIFAELI 368

Query: 207 LRIPYLPGQN-----------DIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPS 255
              P   G+              +Q++     LG+PT+K WP +  +  Y ++  +P   
Sbjct: 369 GLRPIFKGEEAKMDSKKSVPFQANQLQRILEVLGSPTEKSWPNIFKYPEYEQITKFPRYR 428

Query: 256 IDELRKRFIAA---SENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPP 302
            D L   + +A   ++ AL+ +  +L  +P  R +A++ LE  YF    P
Sbjct: 429 -DNLPVWYHSAGGRNKEALDLLYQLLRYDPITRIDAVDALEHPYFTNEEP 477

>Scas_623.11
          Length = 378

 Score =  161 bits (408), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 102/306 (33%), Positives = 173/306 (56%), Gaps = 27/306 (8%)

Query: 8   PITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQ 66
           PIT T +   + +G+G++ +V+  T + T   +A+K++ +   FK+       RE++ ++
Sbjct: 42  PITIT-FPTTEIIGKGSFGLVFCTTIRETDEVVAIKKVLQDRRFKN-------RELEIMK 93

Query: 67  EIQHDNVIELVDIFMAYD-----NLNLVLEFLPSDL----EVIIKDRSILFTPADIKSWM 117
            IQH NVI L   F   D      LNL+L+++P  L       +  R  + +  +IK +M
Sbjct: 94  LIQHPNVINLKYYFYEKDVDDEVYLNLILDYMPQSLYQRLRHFVHQRQSM-SRLEIKFYM 152

Query: 118 LMTLRGVHHCHR-NFILHRDLKPNNLLLSPDG-VIKVADFGLARAVPSPHEMLTSNVVTR 175
               + +++ H    + HRD+KP N+L+ P+   +K+ DFG A+ +  P E   S + +R
Sbjct: 153 FQLFKSLNYLHNAKNVCHRDIKPQNILVDPNSWNLKLCDFGSAKQL-KPTEPNVSYICSR 211

Query: 176 WYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKE 235
           +YRAPEL+FGA +Y++ IDIWS G + AEL+L  P  PG++ IDQ+    + LGTP+ +E
Sbjct: 212 YYRAPELIFGATNYSNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPSKQE 271

Query: 236 WPEVS-SFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLES 294
              ++ ++  +   QI P P    L K F    E  ++F+   L  +P +R+N+++CL S
Sbjct: 272 ICAMNPNYMEHKFPQIKPIP----LAKVFKKEDELTVDFLINTLKYDPMERFNSLQCLCS 327

Query: 295 EYFKEM 300
            YF E+
Sbjct: 328 TYFDEL 333

>KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA61157.1
           Kluyveromyces lactis protein kinase, start by similarity
          Length = 415

 Score =  161 bits (408), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 169/293 (57%), Gaps = 24/293 (8%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDNVIELVD 78
           VG G++ VV+    + TG  + +K++ +   FK+       RE++ ++ I H N+I+L  
Sbjct: 93  VGNGSFGVVFRTKVKETGEDVVIKKVLQDRRFKN-------RELEIMKLISHPNLIDLKY 145

Query: 79  IFMAYDN----LNLVLEFLPSDLEVIIKDRSILFTPAD---IKSWMLMTLRGVHHCHRNF 131
            F+   +    LNL+++++P  L   +K+   L  P D   IK +M    + +++ H+  
Sbjct: 146 YFLEQSDQELYLNLIVDYMPMSLYQRLKEFISLHQPMDRYEIKIYMFQLFKSLNYLHQVV 205

Query: 132 -ILHRDLKPNNLLLSPDGVI-KVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHY 189
            + HRD+KP N+L+ PD ++ K+ D G A+ +  P+E   S + +R+YRAPEL+FGA +Y
Sbjct: 206 NVCHRDIKPQNILVDPDTLLLKICDLGSAKQL-KPNEPNVSYICSRYYRAPELIFGATNY 264

Query: 190 TSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKL- 248
           T+ IDIWS G + AEL+L  P  PG++ IDQ+    + LGTPT +E   ++   S +K  
Sbjct: 265 TTKIDIWSAGCVMAELLLGQPIFPGESKIDQLVEIIKVLGTPTREEICSMNENYSEHKFP 324

Query: 249 QIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECL-ESEYFKEM 300
           QI P P    L + F   ++  ++ +  ++  +P  R++A++C+  S YF ++
Sbjct: 325 QIRPIP----LNRIFKKETQETIDLLYHIMKYDPNIRYSALQCMFNSTYFTDI 373

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score =  159 bits (402), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 98/303 (32%), Positives = 163/303 (53%), Gaps = 23/303 (7%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ-HDNVIELVD 78
           VGEG Y  V     + T  ++A+K+I+    +       +RE+K L+    H+N+I ++D
Sbjct: 19  VGEGAYGTVCSAIHKPTNTKVAIKKIQPFS-RSMFVTRTLRELKLLKFFHSHENIISVLD 77

Query: 79  I-----FMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFIL 133
           I     +  ++ + LV E + +DL+ II  +++  +   I+ ++   LR +   H   ++
Sbjct: 78  IVRPTSWHKFEAVYLVQELMETDLQKIINQQNL--SEDHIQYFVYQILRALKSLHSAQVI 135

Query: 134 HRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE-------MLTSNVVTRWYRAPELLFGA 186
           HRDLKP+NLLL+ +  +KV DFGLAR + S  +        +T  V TRWYRAPE++   
Sbjct: 136 HRDLKPSNLLLNSNCDLKVCDFGLARCLASSDQSRENMVGFMTEYVATRWYRAPEIMLSF 195

Query: 187 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYN 246
           + YT+A+DIWS G I AE+++  P  PG++   Q+ +    LG+PT +++ ++ S  +  
Sbjct: 196 QEYTTAMDIWSCGCILAEMIMGKPLFPGKDYHHQLWIILEVLGSPTLEDFEQIKSKRAKE 255

Query: 247 KLQIYPP----PSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPP 302
            +   P     P  + L K     +  A++ +  MLT NP KR +A+E LE  Y      
Sbjct: 256 YISQLPMKKGIPWANVLNKE---VNPLAIDLLSKMLTFNPDKRISAVEALEHPYLATYHD 312

Query: 303 PSD 305
           P D
Sbjct: 313 PDD 315

>ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C
           (MRK1) - SH] complement(1141943..1143085) [1143 bp, 380
           aa]
          Length = 380

 Score =  158 bits (400), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 106/310 (34%), Positives = 169/310 (54%), Gaps = 32/310 (10%)

Query: 4   EITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREV 62
           EIT P T+        VG G++ VV+    + TG ++A+K++ +   FK+       RE+
Sbjct: 29  EITYPATEV-------VGHGSFGVVFTTVIEQTGEKVAIKKVLQDRRFKN-------REL 74

Query: 63  KYLQEIQHDNVIELVDIFMAYD------NLNLVLEFLPSDLEVIIKD--RSILFTPAD-I 113
           + ++ +QH NV++L   F   +       LNL+LE++P  L   ++      L  P D I
Sbjct: 75  EIMKLLQHPNVVDLRYHFYESEPQTNEVYLNLILEYMPQSLYQRLRHFVTGRLLMPRDEI 134

Query: 114 KSWMLMTLRGVHHCHR-NFILHRDLKPNNLLLSPDGV-IKVADFGLARAVPSPHEMLTSN 171
           K +M    + +++ HR   + HRD+KP NLL+    + +K+ DFG A+ +  P E   S 
Sbjct: 135 KVYMFQLFKSLNYLHRVARVCHRDIKPQNLLVDAGTLQLKLCDFGSAKQL-RPTEPNVSY 193

Query: 172 VVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTP 231
           + +R+YRAPEL+FGA +YT+ IDIWS G + AEL+L  P  PG+  I Q+    + LGTP
Sbjct: 194 ICSRYYRAPELIFGATNYTTQIDIWSTGCVMAELLLGQPMFPGEFVIVQLAEIIKILGTP 253

Query: 232 TDKEWPEVSSFGSYNKL-QIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIE 290
           T +E   ++   S +K  QI P P    L K F     + +  +  +L  +P +R+NA+ 
Sbjct: 254 TRQEICAMNENYSDHKFPQIKPIP----LSKVFKREDAHTVQLLSDVLQYDPTRRFNALM 309

Query: 291 CLESEYFKEM 300
            + S YF E+
Sbjct: 310 AMCSSYFDEI 319

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score =  158 bits (399), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 156/308 (50%), Gaps = 14/308 (4%)

Query: 18  KKVGEGTYAVVYLG--TKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ-HDNVI 74
           K++G G Y +V     T+ S    +A+K++     K  L   ++RE+K L+  + H N+ 
Sbjct: 25  KEIGHGAYGIVCSARFTEASEETTVAIKKVTNIFSKTLLCKRSLRELKLLRHFRGHKNIT 84

Query: 75  ELVDIFMAY------DNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCH 128
            L D+ + +      + L L  E +  D+  IIK    L T A  +S+    L G+ + H
Sbjct: 85  CLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQAL-TDAHYQSFTYQILCGLKYIH 143

Query: 129 RNFILHRDLKPNNLLLSPDGVIKVADFGLARAVP-SPHE---MLTSNVVTRWYRAPELLF 184
              +LHRDLKP NLL++ D  +K+ DFGLAR    +P E    LT  V TRWYRAPE++ 
Sbjct: 144 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPEENNQFLTEYVATRWYRAPEIML 203

Query: 185 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGS 244
             + YT AIDIWS G I AE +   P   G++ +DQ+    + LGTP D+    V S   
Sbjct: 204 SYQGYTKAIDIWSTGCILAEFLGGKPLFKGKDYVDQLNRILQVLGTPPDETLRRVGSKNV 263

Query: 245 YNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPS 304
            + +            + F  A+E+AL+ + GML  +P+KR    + LE  Y      P+
Sbjct: 264 QDYIHQLGYIQKIPFSELFPNANEDALDLLEGMLAFDPQKRITVDKALEHPYLTIWHDPA 323

Query: 305 DPSEIKIK 312
           D  E   K
Sbjct: 324 DEPECNEK 331

>AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH]
           (234347..236092) [1746 bp, 581 aa]
          Length = 581

 Score =  158 bits (400), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 155/290 (53%), Gaps = 28/290 (9%)

Query: 41  AVKEIKTSE------FKDGLDMSAIREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLP 94
           A+K+ KT           G+  SA RE+   +E+ + ++ +LV+IF+   ++ +V EF  
Sbjct: 193 AIKKFKTEREGVEQLHYTGISQSACREMSLCRELDNKHLTKLVEIFLERKSIYMVSEFAE 252

Query: 95  SDLEVIIKDRS----ILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVI 150
            DL  II   S     L  P  +KS M   L GV + H+N+ILHRDLKP N++++ DG +
Sbjct: 253 HDLLQIIHFHSHPEKRLIAPRMLKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCV 312

Query: 151 KVADFGLARAVPSPHEMLTSN---VVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELML 207
           K+ D GLAR   +  + L +    VVT WYRAPELL GA+HY+ AID+W+VG IF+EL+ 
Sbjct: 313 KIGDLGLARKFYNLVQTLYTGDKVVVTIWYRAPELLLGARHYSPAIDLWAVGCIFSELIG 372

Query: 208 RIPYLPGQN-----------DIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSI 256
             P   G+              +Q++     LGTPT   WP +  +  Y +L  +     
Sbjct: 373 LRPIFKGEEAKMDSKKSVPFQGNQLQRILEVLGTPTHHTWPNIHKYPEYEQLSKFSKYR- 431

Query: 257 DELRKRFIAAS---ENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPP 303
           D L   + ++    + AL+ +  +L  +P  R +AI+ LE EYF    PP
Sbjct: 432 DNLSVWYHSSGGRDKAALSLLYSLLKYDPITRIDAIDALEHEYFTNNDPP 481

>CAGL0D01694g complement(176981..178279) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, hypothetical start
          Length = 432

 Score =  154 bits (388), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/310 (30%), Positives = 160/310 (51%), Gaps = 26/310 (8%)

Query: 20  VGEGTYAVVY-----LGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ-HDNV 73
           +G+G+Y VV      L  +      +A+K+I    ++  L   AIRE+K++   + H ++
Sbjct: 75  LGKGSYGVVCSAKHKLDNEDQEQFTVAIKKITNIFYRKILLKRAIREIKFMNYFKGHKHI 134

Query: 74  IELVDIFMA----YDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHR 129
           + L+DI +     YD L    E +  DL  +I   S+  +   I+ ++   L GV + H 
Sbjct: 135 VNLIDIEIVQDKPYDGLYCYQELIDYDLARVIHS-SVQLSEFHIQHFIYQILCGVKYIHS 193

Query: 130 NFILHRDLKPNNLLLSPDGVIKVADFGLARAVPS--------PHEMLTSNVVTRWYRAPE 181
             ++HRDLKP N+L + +G +K+ DFGLAR V          P+E +T+ V TRWYRAPE
Sbjct: 194 ADVIHRDLKPGNILCTVNGCLKICDFGLARGVAKQFVNKNSKPNE-ITNYVATRWYRAPE 252

Query: 182 LLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSS 241
           L+     YT ++D+WSVG I AE   R P   G++ I Q+    + LGTP+     +  +
Sbjct: 253 LILSNNEYTKSVDMWSVGCILAEFYGRRPIFMGKDSIHQVYEIKKILGTPSRSLLVKYGT 312

Query: 242 FGSYNKLQIYPPPSIDELRKR------FIAASENALNFMCGMLTMNPKKRWNAIECLESE 295
             ++N        ++D L+        +  AS  AL+ +  +L   P+ R N ++ LE +
Sbjct: 313 LKAWNLFGHNSNHNLDNLKSGMPWSTVYPMASATALDLIDKLLQWEPESRLNVLQSLEHQ 372

Query: 296 YFKEMPPPSD 305
           + + +  P+D
Sbjct: 373 FVQSVRKPND 382

>Kwal_14.1416
          Length = 365

 Score =  152 bits (383), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 99/306 (32%), Positives = 158/306 (51%), Gaps = 20/306 (6%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ-HDNVIELVD 78
           VGEG Y  V     + +G ++A+K+I+    K+      +RE+K L+    H+N+I ++D
Sbjct: 19  VGEGAYGTVCSAVHKPSGTKVAIKKIQPFS-KEMFVTRTLRELKLLKLFHSHENIISVLD 77

Query: 79  IFM-----AYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFIL 133
           +        +  + LV E + +DL  +I       +   I+ +    LR +   H   ++
Sbjct: 78  VVRPTSMDKFQAVYLVQELMETDLHKVISSGGASLSDDHIQYFTYQILRALKAIHSAQVI 137

Query: 134 HRDLKPNNLLLSPDGVIKVADFGLARA-VPSPHE------MLTSNVVTRWYRAPELLFGA 186
           HRD+KP+NLLL+ +  +KV DFGLAR  + S H        +T  V TRWYRAPE++   
Sbjct: 138 HRDIKPSNLLLNSNCDLKVCDFGLARCLISSTHSRQNLVGFMTEYVATRWYRAPEIMLTF 197

Query: 187 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYN 246
           + YT A+DIWS G I AE++   P  PG++   Q+ +   ALGTP+ +++  ++S  +  
Sbjct: 198 QQYTVAMDIWSCGCILAEMITGKPLFPGRDYHHQLWLILEALGTPSYEDFENINSKRAKE 257

Query: 247 KLQIYP----PPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPP 302
            +   P     P    L+K+ I  +  A++ +  MLT NP KR +A E L   Y      
Sbjct: 258 YIANLPLRQKLPWQVVLQKQDI--NPQAVDLLDKMLTFNPDKRISAAEALAHPYLSVYHD 315

Query: 303 PSDPSE 308
           P D  E
Sbjct: 316 PEDEPE 321

>Scas_713.38
          Length = 432

 Score =  152 bits (385), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 153/293 (52%), Gaps = 6/293 (2%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           YT    VG G + +V   T   T + +A+K+I        L     RE+K L+ ++H+N+
Sbjct: 23  YTDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENL 82

Query: 74  IELVDIFMA-YDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFI 132
           I L DIF++  +++  V E   +DL  +++ R +      ++ ++   LRG+ + H   +
Sbjct: 83  ICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLYQILRGLKYVHSVGV 140

Query: 133 LHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192
           +HRDLKP+N+L++ +  +K+ DFGLAR +  P   +T  V TR+YRAPE++   + Y   
Sbjct: 141 IHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTWQKYDVE 197

Query: 193 IDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYP 252
           +DIWS G IFAE++   P  PG++ + Q  +    LG+P +     + S  +   +   P
Sbjct: 198 VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSENTLKFVTSLP 257

Query: 253 PPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSD 305
                   +RF     +A++ +  ML  +PKKR  A E L   Y      P+D
Sbjct: 258 HRDPIPFSERFKTVEPDAVDLLGKMLVFDPKKRVTAAEALAHPYLAPYHDPTD 310

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score =  151 bits (381), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 93/300 (31%), Positives = 159/300 (53%), Gaps = 28/300 (9%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ-HDNVIELVD 78
           +GEG Y +V     + TG ++A+K+I+    +       +RE+K L+    H+N+I ++D
Sbjct: 19  IGEGAYGIVCSAIHKPTGTKVAIKKIQPFT-RPMFVTRTLRELKLLKFFHSHENIISVLD 77

Query: 79  I-----FMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFIL 133
           I     +  ++ + LV E + +DL+ II   +   +   I+ +    LR +   H   ++
Sbjct: 78  IVRPTSYQDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRALKSLHSAQVI 137

Query: 134 HRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE-------MLTSNVVTRWYRAPELLFGA 186
           HRDLKP+NLLL+    +K+ DFGL+R + S           +T  V TRWYRAPE++   
Sbjct: 138 HRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENMVGFMTEYVATRWYRAPEIMLSF 197

Query: 187 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYN 246
           + YT+A+DIWS G I AE++   P  PG++   Q+ +    LGTP+ +++ ++ S  +  
Sbjct: 198 QEYTTAMDIWSCGCILAEMISGKPLFPGRDYHHQLWIILEILGTPSFEDFEQIKSKRAKA 257

Query: 247 KLQIYPPPSIDELRKRF---IAASEN-----ALNFMCGMLTMNPKKRWNAIECLESEYFK 298
            +   P      +R +    +A S N     A++ +  MLT NP KR +A + L+  Y +
Sbjct: 258 YIANLP------MRPKIPWNVALSTNDINPLAMDLLDKMLTFNPDKRISAADALKHPYLE 311

>YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine
           protein kinase involved in the filamentous and invasive
           growth pathway, member of the MAP kinase family [1107
           bp, 368 aa]
          Length = 368

 Score =  150 bits (380), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 104/327 (31%), Positives = 173/327 (52%), Gaps = 22/327 (6%)

Query: 1   MSTEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMS-AI 59
           M+  IT  I  ++Y     +GEG Y  V     + +G ++A+K+I+   F   L ++  I
Sbjct: 1   MARTITFDIP-SQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQP--FSKKLFVTRTI 57

Query: 60  REVKYLQEI-QHDNVIELVDIF--MAYDNLN---LVLEFLPSDLEVIIKDRSILFTPAD- 112
           RE+K L+   +H+N+I ++D    ++ D LN   LV E + +DL+ +I +++  F+    
Sbjct: 58  REIKLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSD 117

Query: 113 --IKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE---- 166
             ++ +    LR +   H   ++HRD+KP+NLLL+ +  +KV DFGLAR + S  +    
Sbjct: 118 DHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRET 177

Query: 167 ---MLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEV 223
               +T  V TRWYRAPE++   + YT+A+DIWS G I AE++   P  PG++   Q+ +
Sbjct: 178 LVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWL 237

Query: 224 TFRALGTPTDKEWPEVSSFGSYNKLQIYP--PPSIDELRKRFIAASENALNFMCGMLTMN 281
               LGTP+ +++ ++ S  +   +   P  PP   E        + + ++ +  ML  N
Sbjct: 238 ILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFN 297

Query: 282 PKKRWNAIECLESEYFKEMPPPSDPSE 308
           P KR +A E L   Y      PSD  E
Sbjct: 298 PDKRISAAEALRHPYLAMYHDPSDEPE 324

>Scas_683.6
          Length = 377

 Score =  150 bits (379), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/314 (30%), Positives = 165/314 (52%), Gaps = 20/314 (6%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMS-AIREVKYLQEIQ-H 70
           +Y     +GEG Y  V     + +G ++A+K+I+   F   + ++  +RE+K L     H
Sbjct: 12  QYQLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQP--FSKAMFVTRTLREIKLLTYFNNH 69

Query: 71  DNVIELVD----IFM-AYDNLNLVLEFLPSDLEVIIKDRSI--LFTPADIKSWMLMTLRG 123
           +N+I ++D    I M  +  + LV E + +DL+ +I + +     T   I+ +    LR 
Sbjct: 70  ENIISILDKIKPISMDKFQAVYLVQELMETDLQRVISNNNTNKSLTDDHIQYFTYQILRA 129

Query: 124 VHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE-------MLTSNVVTRW 176
           +   H   ++HRDLKP+NLLL+ +  +K+ DFGL+R + S ++        +T  V TRW
Sbjct: 130 LKSIHSAKVIHRDLKPSNLLLNSNCDLKICDFGLSRCLTSSNDSKKTLVGFMTEYVATRW 189

Query: 177 YRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEW 236
           YRAPE++   + YT+A+DIWSVG I AE++   P  PG++   Q+ +    LGTP+ +++
Sbjct: 190 YRAPEIMLTFQEYTTAMDIWSVGCILAEMVTGRPLFPGRDYHHQLWLILEVLGTPSLEDF 249

Query: 237 PEVSSFGSYNKLQIYP--PPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLES 294
            ++ S  +   +   P  PP   ++       + + ++ +  ML  NP KR +A E L+ 
Sbjct: 250 EQIKSKRAREYIANLPLKPPMAWDIVLSNTNLNPDLIDLLTKMLMFNPNKRISAAEALQH 309

Query: 295 EYFKEMPPPSDPSE 308
            Y      P D  E
Sbjct: 310 PYLSTYHDPQDEPE 323

>Scas_667.18
          Length = 437

 Score =  151 bits (382), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/317 (31%), Positives = 160/317 (50%), Gaps = 34/317 (10%)

Query: 18  KKVGEGTYAVVYLGTKQ---STGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ-HDNV 73
           K +G+G+Y VV         +    +A+K++     K+ L   AIRE+K++   Q H N+
Sbjct: 82  KVLGKGSYGVVCSAMDNKNPANAYPVAIKKVTNIFQKEILLKRAIRELKFMNFFQGHKNI 141

Query: 74  IELVDIFMA-----YDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCH 128
           + L+D+ +      YD L    E +  DL  +I   SI  T   I+ +M   L G+ + H
Sbjct: 142 VNLIDLEIINENSPYDGLYCYQELIDYDLAKVIHS-SIKLTEFHIQYFMYQILSGLKYIH 200

Query: 129 RNFILHRDLKPNNLLLSPDGVIKVADFGLARAV-------------PSPHEMLTSNVVTR 175
              ++HRDLKP N+L + +G +K+ DFGLAR +             P  H+ +T+ V TR
Sbjct: 201 SADVIHRDLKPGNILCTLNGNLKICDFGLARGINPKFYNDNGNLASPKLHD-ITNYVATR 259

Query: 176 WYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKE 235
           WYRAPEL+   K YT AID+WSVG I AE   R P   G + + Q+    + LG P+ + 
Sbjct: 260 WYRAPELILSHKMYTKAIDLWSVGCILAEFYGRRPIFMGHDTLHQVYEIVKILGPPSQRL 319

Query: 236 WPEVSSFGSYN-------KLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNA 288
             + +S  +YN       KL    P     L   +  AS ++++ +  +L  NP++R++ 
Sbjct: 320 LSQFASVKAYNIFNNNLAKLHWNSPIDWKTL---YPEASNSSIHLLQNLLKWNPRERFDV 376

Query: 289 IECLESEYFKEMPPPSD 305
            + +   +  E+  P D
Sbjct: 377 EQAITHPFLNEVRTPMD 393

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score =  150 bits (380), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 90/293 (30%), Positives = 151/293 (51%), Gaps = 6/293 (2%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           YT    VG G + +V   T   T + +A+K+I        L     RE+K L+ ++H+N+
Sbjct: 22  YTNLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTSVLAKRTYRELKLLKHLRHENL 81

Query: 74  IELVDIFMA-YDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFI 132
           I L DIF++  +++  V E   +DL  +++ R +      ++ ++   LRG+ + H   +
Sbjct: 82  ICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLYQILRGLKYVHSAGV 139

Query: 133 LHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192
           +HRDLKP+N+L++ +  +K+ DFGLAR +  P   +T  V TR+YRAPE++   + Y   
Sbjct: 140 IHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTWQKYNVE 196

Query: 193 IDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYP 252
           +DIWS G IFAE++   P  PG++ + Q  +    LG+P       + S  +   +   P
Sbjct: 197 VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFVTSLP 256

Query: 253 PPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSD 305
                    RF     +A++ +  ML  +PKKR  A + L   Y      P+D
Sbjct: 257 HRDPVPFSSRFQNLEPDAIDLLEKMLVFDPKKRITAADALAHPYLSPYHDPTD 309

>CAGL0M11748g 1167306..1168649 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1, start by
           similarity
          Length = 447

 Score =  150 bits (379), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 90/293 (30%), Positives = 152/293 (51%), Gaps = 6/293 (2%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           Y+    VG G + +V   T   T +Q+A+K+I        L     RE+K L+ ++H+N+
Sbjct: 23  YSDLNPVGMGAFGLVCSATDTLTNQQVAIKKIMKPFATAVLAKRTYRELKLLKHLRHENL 82

Query: 74  IELVDIFMA-YDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFI 132
           I L DIF++  +++  V E   +DL  +++ R +      ++ +    LRG+ + H   +
Sbjct: 83  ICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFHYQILRGLKYVHSAGV 140

Query: 133 LHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192
           +HRDLKP+N+L++ +  +K+ DFGLAR +  P   +T  V TR+YRAPE++   + Y   
Sbjct: 141 VHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTWQKYDVE 197

Query: 193 IDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYP 252
           +DIWS G IFAE++   P  PG++ + Q  +    LG+P       + S  +   +   P
Sbjct: 198 VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSDVIDTICSENTLKFVTSLP 257

Query: 253 PPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSD 305
                   +RF     +A++ +  ML  +PKKR  A + L   Y      P+D
Sbjct: 258 HRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHPYLAPYHDPTD 310

>Kwal_56.23841
          Length = 432

 Score =  149 bits (375), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/293 (30%), Positives = 151/293 (51%), Gaps = 6/293 (2%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           YT    VG G + +V       T + +A+K+I        L     RE+K L+ ++H+N+
Sbjct: 23  YTDLNPVGMGAFGLVCSANDTYTNQSVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENL 82

Query: 74  IELVDIFMA-YDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFI 132
           I L DIF++  +++  V E   +DL  +++ R +      ++ ++   LRG+ + H   +
Sbjct: 83  ICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLYQILRGLKYVHSAGV 140

Query: 133 LHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192
           +HRDLKP+N+L++ +  +K+ DFGLAR +  P   +T  V TR+YRAPE++   + Y   
Sbjct: 141 IHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTWQKYNVE 197

Query: 193 IDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYP 252
           +DIWS G IFAE++   P  PG++ + Q  +    LG+P +     + S  +   +   P
Sbjct: 198 VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSVNTLKFVTSLP 257

Query: 253 PPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSD 305
                   +RF     +A++ +  ML  +P KR  A + L   Y      P+D
Sbjct: 258 HRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKRITAADALSHPYLAPYHDPTD 310

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score =  150 bits (378), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 158/302 (52%), Gaps = 16/302 (5%)

Query: 18  KKVGEGTYAVVYLG--TKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ-HDNVI 74
           K++G G+Y +V     T+ +    +A+K++     K  L   ++RE+K L+  + H N+ 
Sbjct: 29  KEIGHGSYGIVCSARFTEAADETTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNIT 88

Query: 75  ELVDIFMAY------DNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCH 128
            L D+ + +      + L L  E +  D+  I+K    L T A  +S++   L G+ + H
Sbjct: 89  CLYDMDIVFQPDGMFNGLYLYEELMECDMHQIVKSGQPL-TDAHYQSFIYQILCGLKYIH 147

Query: 129 RNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSP----HEMLTSNVVTRWYRAPELLF 184
              +LHRDLKP NLL++ D  +K+ DFGLAR         ++ LT  V TRWYRAPE++ 
Sbjct: 148 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQFLTEYVATRWYRAPEIML 207

Query: 185 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGS 244
             + YT AID+WS G I AEL+   P   G++ +DQ+    + LGTP ++    + S   
Sbjct: 208 SYQGYTKAIDVWSCGCILAELLGGKPIFKGKDYVDQLNRILQVLGTPPEETLKRIGSKNV 267

Query: 245 YNKL-QIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPP 303
            + + Q+   P I      +  A+ +ALN + GML+ +P+ R    + L+  Y      P
Sbjct: 268 QDYIHQLGYIPKI-PFSTLYPNANPDALNLLEGMLSFDPQLRITVDDALQHPYLSIWHDP 326

Query: 304 SD 305
           +D
Sbjct: 327 AD 328

>Kwal_27.12559
          Length = 414

 Score =  147 bits (371), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 157/306 (51%), Gaps = 26/306 (8%)

Query: 20  VGEGTYAVVYLGTKQSTG---RQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ-HDNVIE 75
           +G+G+Y VV     +      R++A+K++     ++ L   AIRE+K+L   + H N++ 
Sbjct: 72  LGKGSYGVVVSAIDKGEDGKPRRLAIKKVTNIFNREILLKRAIRELKFLNFFKGHKNIVS 131

Query: 76  LVDIFMA----YDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNF 131
           LVD+ +     YD L    E +  DL  +I   ++ F+   IK ++   L G+ + H   
Sbjct: 132 LVDLEIVSEKPYDGLYCYQELVDYDLARVIHS-TVQFSEFHIKHFLYQILCGLKYIHSAD 190

Query: 132 ILHRDLKPNNLLLSPDGVIKVADFGLARAVP-------SPHEMLTSNVVTRWYRAPELLF 184
           ++HRDLKP N+L S  G +K+ DFGLAR +        S    +TS V TRWYRAPEL+ 
Sbjct: 191 VIHRDLKPGNILCSIGGNLKICDFGLARGIAPQYFEQKSDEIHITSYVATRWYRAPELIL 250

Query: 185 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGS 244
             + YT AIDIW+VG I AE   R P   G + + Q+    + LG+P  +    V+ + S
Sbjct: 251 SHRRYTKAIDIWAVGCILAEFYGRKPIFMGHDSLHQVSEILKVLGSPCRE---TVAKYCS 307

Query: 245 YNKLQIYPPPSIDELRKR-----FIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
               +I+   S  E++K      +  +  +A   +  +LT +P KR      L   +F++
Sbjct: 308 ARSWEIFSGRS--EVKKMPWSSVYPKSCSDAQALLDMLLTWDPDKRPGVEVALCHPFFED 365

Query: 300 MPPPSD 305
           +  P D
Sbjct: 366 VSNPYD 371

>Scas_688.14
          Length = 479

 Score =  147 bits (372), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 99/302 (32%), Positives = 152/302 (50%), Gaps = 16/302 (5%)

Query: 18  KKVGEGTYAVVYLG--TKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ-HDNVI 74
           K++G G Y +V      +      +A+K++     K  L   ++RE+K L+  + H N+ 
Sbjct: 27  KEIGHGAYGIVCSARFAEAVEDTTVAIKKVTNVFSKSLLCKRSLRELKLLRHFRGHKNIT 86

Query: 75  ELVDIFM------AYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCH 128
            L D+ +       ++ L L  E +  D+  IIK    L T A  +S++   L G+ + H
Sbjct: 87  CLYDMDIVFYPDGTFNGLYLYEELMECDMHQIIKSSQPL-TDAHYQSFIYQILCGLKYIH 145

Query: 129 RNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSP----HEMLTSNVVTRWYRAPELLF 184
              +LHRDLKP NLL++ D  +K+ DFGLAR         ++ LT  V TRWYRAPE++ 
Sbjct: 146 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQFLTEYVATRWYRAPEIML 205

Query: 185 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGS 244
             + YT AIDIWS G I AE +   P   G++ +DQ+    + LGTP D+    + S   
Sbjct: 206 SYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVDQLTRILQVLGTPPDETLRRIGSKNV 265

Query: 245 YNKL-QIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPP 303
            + + Q+   P +      +  A+  AL+ +  ML  +P+KR    E LE  Y      P
Sbjct: 266 QDYIHQLGYIPKV-PFVNLYPDANPQALDLLEKMLAFDPQKRITTDEALEHPYLSIWHDP 324

Query: 304 SD 305
           SD
Sbjct: 325 SD 326

>Kwal_23.5576
          Length = 504

 Score =  147 bits (370), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 100/304 (32%), Positives = 156/304 (51%), Gaps = 20/304 (6%)

Query: 18  KKVGEGTYAVV----YLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ-HDN 72
           K++G G Y +V    ++   + T   +A+K++     K  L   ++RE+K L+  + H N
Sbjct: 27  KEIGHGAYGIVCSARFIEAAEETN--VAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKN 84

Query: 73  VIELVDIFM------AYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHH 126
           +  L D+ +       ++ L L  E +  D+  IIK    L T A  +S++   L  + +
Sbjct: 85  ITCLYDMDIVFSPNNTFNGLYLYEELMECDIHQIIKSGQPL-TDAHYQSFIYQLLCALKY 143

Query: 127 CHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSP----HEMLTSNVVTRWYRAPEL 182
            H   +LHRDLKP NLL++ D  +KV DFGLAR         ++ LT  V TRWYRAPE+
Sbjct: 144 IHSADVLHRDLKPGNLLVNADCQLKVCDFGLARGYSENPVENNQFLTEYVATRWYRAPEI 203

Query: 183 LFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF 242
           +   + YT AIDIWS G I AEL+   P   G++ +DQ+    + LGTP ++    + S 
Sbjct: 204 MLSYQGYTKAIDIWSCGCILAELLGGKPIFKGKDYVDQLNRILQVLGTPPEETLERIGSK 263

Query: 243 GSYNKL-QIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMP 301
              + + Q+   P +      +  A+  AL+ +  MLT +P+KR    E LE  Y     
Sbjct: 264 NVQDYIHQLGYIPKV-PFVTLYPQANVQALDLLEKMLTFDPQKRITVEEALEHPYLSIWH 322

Query: 302 PPSD 305
            P+D
Sbjct: 323 DPTD 326

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score =  145 bits (366), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 93/300 (31%), Positives = 152/300 (50%), Gaps = 24/300 (8%)

Query: 20  VGEGTYAVVYLGTKQSTGR---QIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ-HDNVIE 75
           +G+G+Y  V             +IA+K+I     ++ L   AIRE+K++   + H N++ 
Sbjct: 79  LGKGSYGTVVSAIDNLNANYPIRIAIKKITNIFQREVLLKRAIRELKFMHYFKGHKNIVS 138

Query: 76  LVDIFMA----YDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNF 131
           L+++ +     YD L    E +  DL  +I   ++ F+   IK +    L GV + H   
Sbjct: 139 LINLEIVNEKPYDGLYCYQELIDYDLARVIHS-NVQFSEFHIKHFTYQILCGVKYIHSAD 197

Query: 132 ILHRDLKPNNLLLSPDGVIKVADFGLARAVPSP-------HEMLTSNVVTRWYRAPELLF 184
           ++HRDLKP N+L S  G +K+ DFGLAR + SP          +T+ V TRWYRAPEL+ 
Sbjct: 198 VIHRDLKPGNILCSISGQLKICDFGLARGI-SPLFTNTKTSNHITNYVATRWYRAPELIL 256

Query: 185 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGS 244
             K Y  +ID+W++G I AE   R P   GQ+ + Q+    + LGTP+      +  +GS
Sbjct: 257 SHKRYNKSIDMWAIGCILAEFYGRKPIFMGQDSMHQISEIVKVLGTPSRD---TIIKYGS 313

Query: 245 YNKLQIYPPPSIDELR----KRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEM 300
                I+ PP     +    + +  A  +AL+ +  +L  +P +R    E +E ++ K +
Sbjct: 314 SRAYDIFCPPKPQYAKIPWAEIYPFAGPDALDLIERLLDWDPDRRLTVEEAIEHDFVKSV 373

>AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH]
           (807470..808831) [1362 bp, 453 aa]
          Length = 453

 Score =  144 bits (362), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/293 (30%), Positives = 150/293 (51%), Gaps = 6/293 (2%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           Y     VG G + +V       T + +A+K+I        L     RE+K L+ ++H+N+
Sbjct: 29  YADLNPVGMGAFGLVCSAVDTYTQQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENL 88

Query: 74  IELVDIFMA-YDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFI 132
           I L DIF++  +++  V E   +DL  +++ R +      ++ ++   LRG+ + H   +
Sbjct: 89  ICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFLQYFLYQILRGLKYVHSAGV 146

Query: 133 LHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192
           +HRDLKP+N+L++ +  +K+ DFGLAR +  P   +T  V TR+YRAPE++   + Y   
Sbjct: 147 IHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTWQKYNVE 203

Query: 193 IDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYP 252
           +DIWS G IFAE++   P  PG++ + Q  +    LG+P       + S  +   +   P
Sbjct: 204 VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFVTSLP 263

Query: 253 PPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSD 305
                   +RF     +A++ +  ML  +PKKR  A + L   Y      P+D
Sbjct: 264 HRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRITAGDALTHPYLAPYHDPTD 316

>AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -
           SH] (1066272..1067981) [1710 bp, 569 aa]
          Length = 569

 Score =  145 bits (366), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 97/304 (31%), Positives = 159/304 (52%), Gaps = 20/304 (6%)

Query: 18  KKVGEGTYAVV----YLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ-HDN 72
           K++G G Y +V    ++ + + T   +A+K++     K  L   ++RE+K L+  + H N
Sbjct: 27  KEIGYGAYGIVCSARFMESVEDT--TVAIKKVTNVFSKALLCKRSLRELKLLRHFRGHKN 84

Query: 73  VIELVDIFM------AYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHH 126
           +  L D+ +      +++ L+L  E +  D+  IIK    L T A  +S++   L G+ +
Sbjct: 85  ITCLYDMDIVLLPDGSFNGLDLYEELMEWDMHQIIKSGQPL-TDAHYQSFVYQILCGLKY 143

Query: 127 CHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSP----HEMLTSNVVTRWYRAPEL 182
            H   +LHRDLKP NLL++ D  +K+ DFGLAR          + LT  V TRWYRAPE+
Sbjct: 144 IHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPIENDQFLTEYVATRWYRAPEI 203

Query: 183 LFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF 242
           +   + YT AID+WS G + AEL+   P   G++ +DQ+    + LGTP ++    + S 
Sbjct: 204 MLSYQGYTRAIDVWSCGCVLAELLGGRPIFKGKDYVDQLNRILQVLGTPPEETLKRIGSK 263

Query: 243 GSYNKL-QIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMP 301
              + + Q+   P +    + +  A+ +A + +  ML ++PK R    E LE  Y     
Sbjct: 264 NVQDYIHQLGYIPKV-PFERLYPNANPDAADLLERMLALDPKTRITVDEALEHPYLSIWH 322

Query: 302 PPSD 305
            PSD
Sbjct: 323 DPSD 326

>YHR030C (SLT2) [2317] chr8 complement(168882..170336)
           Serine/threonine protein kinase of MAP kinase family
           involved in the cell wall integrity (low-osmolarity)
           pathway and in G2 phase cell-cycle checkpoint control
           [1455 bp, 484 aa]
          Length = 484

 Score =  144 bits (363), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 96/302 (31%), Positives = 151/302 (50%), Gaps = 16/302 (5%)

Query: 18  KKVGEGTYAVVYLG--TKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ-HDNVI 74
           K++G G Y +V      + +    +A+K++     K  L   ++RE+K L+  + H N+ 
Sbjct: 27  KEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNIT 86

Query: 75  ELVDIFMAY------DNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCH 128
            L D+ + +      + L L  E +  D+  IIK    L T A  +S+    L G+ + H
Sbjct: 87  CLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQPL-TDAHYQSFTYQILCGLKYIH 145

Query: 129 RNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSP----HEMLTSNVVTRWYRAPELLF 184
              +LHRDLKP NLL++ D  +K+ DFGLAR          + LT  V TRWYRAPE++ 
Sbjct: 146 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQFLTEYVATRWYRAPEIML 205

Query: 185 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGS 244
             + YT AID+WS G I AE +   P   G++ ++Q+    + LGTP D+    + S   
Sbjct: 206 SYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNV 265

Query: 245 YNKL-QIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPP 303
            + + Q+   P +      +  A+  AL+ +  ML  +P+KR    E LE  Y      P
Sbjct: 266 QDYIHQLGFIPKV-PFVNLYPNANSQALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDP 324

Query: 304 SD 305
           +D
Sbjct: 325 AD 326

>CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces
           cerevisiae YGR040w KSS1, start by similarity
          Length = 398

 Score =  140 bits (353), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 94/330 (28%), Positives = 155/330 (46%), Gaps = 38/330 (11%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLD----------------- 55
           EY     VGEG+Y +V   T   TG ++A+K I+  +     D                 
Sbjct: 12  EYKLVDLVGEGSYGIVCSATHLPTGNKVAIKRIRFPDSPPSDDGQGVPRLEEDDEHDNIA 71

Query: 56  ----MSAIREVKYLQEIQ-HDNVIELVDIFMAYDNLN-----LVLEFLPSDLEVIIKDRS 105
               +  IRE+K L     H+N+I + +      ++N     LV E + +DL  I+   +
Sbjct: 72  KVALIRTIREIKILSHFNNHENIITIFEKIKPMQSINFKEIYLVQELMETDLSRILASSN 131

Query: 106 ILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPH 165
            L T   I+ ++   LR +   H   ++HRDLKP+N+LL+ +  +K+ DFGLAR      
Sbjct: 132 TL-TVDHIQYFLYQILRALKAIHSAKVIHRDLKPSNILLNSNCDLKICDFGLARTYDPDD 190

Query: 166 E----------MLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQ 215
           +           LT  V TRWYRAPE++   + Y++AIDIWS G + AE++ R P  PG+
Sbjct: 191 DASTMNGNNVGFLTEYVATRWYRAPEIMLNFQDYSTAIDIWSCGCVLAEMLFRKPIFPGK 250

Query: 216 NDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMC 275
           +   Q+ +    LGTP+ ++   ++   +   +   P     +  +     +E  L+ + 
Sbjct: 251 DYHHQLLLILDTLGTPSPEDIEAINYGRAKEYILSLPHFPKKDWSQLLGTDNEMLLDILD 310

Query: 276 GMLTMNPKKRWNAIECLESEYFKEMPPPSD 305
            ++  NPK+R  A + LE  +      P D
Sbjct: 311 KLMIFNPKRRITAEQALEHPFLATYHDPKD 340

>Scas_680.20
          Length = 482

 Score =  141 bits (355), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 94/296 (31%), Positives = 158/296 (53%), Gaps = 28/296 (9%)

Query: 21  GEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDNVIELVDI 79
           G G++ +V        G  +A+K+I +  +FK+       RE+  L+ + H N+I L   
Sbjct: 174 GSGSFGLVLKAKTLHNGEIVALKKIIQNKKFKN-------RELHMLRLLDHPNIISLKYF 226

Query: 80  FMA-YDN----LNLVLEFLPSDLEVIIKDRSILFTPADI--------KSWMLMTLRGVHH 126
           F+   DN    LNL+ EF+P  L +  + R +  T + +        K +M    + + +
Sbjct: 227 FVEPIDNDESYLNLIFEFVP--LSLYQRIRQVATTTSSVQPSHKLEFKCYMWQIFKALDY 284

Query: 127 CHRNF-ILHRDLKPNNLLLSP-DGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLF 184
            H    I HRD+KP N+L+ P D  +K+ DFG A+ + +PH+   S + +R+YRAPEL+ 
Sbjct: 285 LHNEVNICHRDIKPQNILIDPMDWSLKICDFGSAKRL-NPHDKNVSFICSRFYRAPELIL 343

Query: 185 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGS 244
           GA  YT++ID+WS G +FAEL+L  P+  G++D DQ+    R LGTPT K+   +S   +
Sbjct: 344 GAIQYTNSIDLWSTGCVFAELLLLKPFFAGKSDTDQIVEIIRILGTPTLKDI--ISMNEN 401

Query: 245 YNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEM 300
           Y   +      I   R       ++A++ +  +L  +P +R ++ +CL   YF ++
Sbjct: 402 YKDYRFPRIHGISWSRLFSDKVEKSAIDLLDKILRYDPTERIDSSKCLIHPYFDDL 457

>KLLA0B11946g complement(1048033..1049352) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, start by similarity
          Length = 439

 Score =  140 bits (353), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 94/305 (30%), Positives = 156/305 (51%), Gaps = 27/305 (8%)

Query: 20  VGEGTYAVVYLGTKQSTGR---QIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ-HDNVIE 75
           +G+G+Y  V     +       Q+A+K++ +   ++ L   AIRE+K++   + H N++ 
Sbjct: 79  LGKGSYGTVVSAVDKGNPTHEVQLAIKKVTSIFTREILLKRAIRELKFMSYFKGHRNIVS 138

Query: 76  LVDIFMA----YDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNF 131
           L+D+ +     Y  L    E +  DL  +I   ++LF+   IK ++   L G+ + H   
Sbjct: 139 LIDLEIVNEEPYSGLYCYQELVDYDLARVIHS-NVLFSEFHIKHFLYQILCGMKYIHSAD 197

Query: 132 ILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPH--------EMLTSNVVTRWYRAPELL 183
           ++HRDLKP N+L S  G IK+ DFGLAR + SP           +T+ V TRWYRAPEL+
Sbjct: 198 VIHRDLKPGNILCSITGEIKICDFGLARGI-SPSFTVAGGISNHITNYVATRWYRAPELI 256

Query: 184 FGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFG 243
              K Y+ ++D+W+VG I AE   R P   G + + Q+    + LGTP       + ++G
Sbjct: 257 LSHKRYSKSVDMWAVGCILAEFYGRKPVFMGNDSLHQVMEIQKILGTPKQI---VIRTYG 313

Query: 244 SYNKLQIYPPPSIDELRKR-----FIAASENALNFMCGMLTMNPKKRWNAIECLESEYFK 298
           S     I+   S  + +K      F  AS  A++ M  ++  NP+ R    E L+  + +
Sbjct: 314 SSRCYDIF-STSKPQYKKTPWCEIFPYASSEAVDLMERLIDWNPEARLTVEEALDHPFLQ 372

Query: 299 EMPPP 303
           ++  P
Sbjct: 373 QVRNP 377

>Scas_22.1
          Length = 248

 Score =  128 bits (321), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 84/230 (36%), Positives = 127/230 (55%), Gaps = 30/230 (13%)

Query: 86  LNLVLEFLPSDL----EVIIKDRSILFTPA-DIKSWM---LMTLRGVHHCHRNFILHRDL 137
           LNLVLE++PS L       +  RS +  PA ++K +M     +L  +H C R  + HRD+
Sbjct: 26  LNLVLEYMPSSLYQRLRHFVTHRSNM--PAIEVKLYMYQLFKSLNYLHTCAR--VCHRDI 81

Query: 138 KPNNLLLSPDGV-IKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIW 196
           KP NLL+ P    +K+ DFG A+ +  P E   S + +R+YRAPEL+FGA +YT+ ID+W
Sbjct: 82  KPQNLLVDPTTFSLKLCDFGSAKQL-KPTEPNVSYICSRYYRAPELIFGATNYTTQIDVW 140

Query: 197 SVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVS-SFGSYNKLQIYPPPS 255
           S G + AEL+L  P  PG++ IDQ+    + LGTP  +E   ++ ++  +   QI P P 
Sbjct: 141 SSGCVMAELILGQPMFPGESGIDQLVEIIKILGTPNKREICAMNPNYMDHKFPQIVPIP- 199

Query: 256 IDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSD 305
              L K F    E  +           + ++ A++CL + YF E+  PS 
Sbjct: 200 ---LNKVFKREQEETV-----------QSKFTALQCLCASYFDELRQPSS 235

>YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..314748)
           Member of the GSK-3 subfamily of protein kinases [1506
           bp, 501 aa]
          Length = 501

 Score =  130 bits (327), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 88/309 (28%), Positives = 156/309 (50%), Gaps = 29/309 (9%)

Query: 2   STEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIR 60
           + +I+ P T+        VG G++ VV       T +++A+K++ +   +K+       R
Sbjct: 159 TIDISYPTTEV-------VGHGSFGVVVTTVIIETNQKVAIKKVLQDRRYKN-------R 204

Query: 61  EVKYLQEIQHDNVIELVDIFMAYDN-----LNLVLEFLPSDLEVIIK---DRSILFTPAD 112
           E++ ++ + H N + L   F   D      LNLVL+++P  L   ++   +  +     +
Sbjct: 205 ELETMKMLCHPNTVGLQYYFYEKDEEDEVYLNLVLDYMPQSLYQRLRHFVNLKMQMPRVE 264

Query: 113 IKSWMLMTLRGVHHCHR-NFILHRDLKPNNLLLSPDGV-IKVADFGLARAVPSPHEMLTS 170
           IK +     + +++ H    I HRD+KP NLL+ P     K+ DFG A+ +  P +   S
Sbjct: 265 IKFYAYQLFKALNYLHNVPRICHRDIKPQNLLVDPTTFSFKICDFGSAKCL-KPDQPNVS 323

Query: 171 NVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGT 230
            + +R+YRAPEL+FGA +Y++ +D+WS   + AEL+L  P   G++ IDQ+    + +G 
Sbjct: 324 YICSRYYRAPELMFGATNYSNQVDVWSSACVIAELLLGKPLFSGESGIDQLVEIIKIMGI 383

Query: 231 PTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIE 290
           PT     E+S      +  ++P      L + F A   + L+ +   L  +P +R   ++
Sbjct: 384 PTKD---EISGMNPNYEDHVFPNIKPITLAEIFKAEDPDTLDLLTKTLKYHPCERLVPLQ 440

Query: 291 CLESEYFKE 299
           CL S YF E
Sbjct: 441 CLLSSYFDE 449

>Scas_711.15
          Length = 727

 Score =  121 bits (303), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 84/284 (29%), Positives = 146/284 (51%), Gaps = 43/284 (15%)

Query: 55  DMSAIREVKYLQEI-QHDNVIELVDIFMAYDN--LNLVLEFLPSDL-EVIIKDRSILFTP 110
           D + +REVK++  +  + ++I++ +IF    N  L++V+E +  +L ++++  +  +F+ 
Sbjct: 108 DYTRVREVKFILALPTNKHLIQIFEIFADTSNYQLHIVMECMEQNLYQMMLHRKKRVFSI 167

Query: 111 ADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDG-----------------VIKVA 153
             +KS +   L G+ H H +   HRD+KP N+L+SP+                  V+K+A
Sbjct: 168 PSLKSILAQILAGIKHIHDHNFFHRDIKPENILVSPNKRYFDKERLELGFYPDNYVVKLA 227

Query: 154 DFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLP 213
           DFGLAR V + +   T+ V TRWYR+PE+L    +Y++ +DIW+ G +  E  +  P  P
Sbjct: 228 DFGLARHVENKN-TYTAYVSTRWYRSPEILLRNGYYSTPLDIWAFGCVAVEATIFKPLFP 286

Query: 214 GQNDIDQMEVTFRALGTPTDKE---------------WPEVSSFGSYNKLQIYPPPSIDE 258
           G N++DQ+      LGTP + +               W  V+   S   L+    P ++ 
Sbjct: 287 GSNELDQIWRILEVLGTPYNNKNDSTVPNNFKPYGGTWNHVAELASKLNLEF---PFVEG 343

Query: 259 LR-KRFIAASE--NALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
           +   RFI   E  + L+ +   L  NP +R +A +    EYFK+
Sbjct: 344 ISLDRFIPLPELYDLLDVIKKCLRWNPLERASANDLCLMEYFKD 387

>YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine
           protein kinase and positive regulator of early, middle,
           and late meiotic genes, may act as a meiosis-specific
           regulator of the anaphase promoting complex [1938 bp,
           645 aa]
          Length = 645

 Score =  120 bits (302), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 123/220 (55%), Gaps = 27/220 (12%)

Query: 55  DMSAIREVKYLQEI-QHDNVIELVDIFMAYDN--LNLVLEFLPSDLEVIIKDRSI-LFTP 110
           D + +RE+K++  I  +D++I++ ++F+  +N  L++V+E +  +L  ++K R   +F+ 
Sbjct: 108 DYTRVREIKFILAIPANDHLIQIFEVFIDSENYQLHIVMECMEQNLYQMMKHRRRRVFSI 167

Query: 111 ADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSP-----------------DGVIKVA 153
             +KS +   L G+ H H +   HRDLKP N+L++P                 + VIK+A
Sbjct: 168 PSLKSILSQILAGLKHIHEHNFFHRDLKPENILITPSTQYFEKEYMNQIGYQDNYVIKLA 227

Query: 154 DFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLP 213
           DFGLAR V + +   T+ V TRWYR+PE+L  + +Y+  +DIW+ G +  E+ +     P
Sbjct: 228 DFGLARHVENKNPY-TAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCVAVEVTVFRALFP 286

Query: 214 GQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPP 253
           G N+IDQ+      LGTP  +     S F + N +   PP
Sbjct: 287 GANEIDQIWKILEVLGTPIKR-----SDFVNTNHITAPPP 321

>Kwal_26.7276
          Length = 646

 Score =  120 bits (301), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 142/282 (50%), Gaps = 41/282 (14%)

Query: 55  DMSAIREVKYLQEI-QHDNVIELVDIFMAYDN--LNLVLEFLPSDLEVIIK-DRSILFTP 110
           D + +REVK++  +  H N++++ ++F+   N  L++V+E +  +L  +++  R  +F+ 
Sbjct: 123 DYTRVREVKFILSMPAHRNLVQIWELFIDDVNYQLHIVMECMEQNLYQLMRARRKRVFSL 182

Query: 111 ADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDG-----------------VIKVA 153
             +KS +   + G+ H H +   HRDLKP N+L+SP                   V+K+A
Sbjct: 183 PSLKSILTQLITGIRHIHSHNFFHRDLKPENILISPSNHYFSKDWILNGNYSDNYVVKIA 242

Query: 154 DFGLARAV--PSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPY 211
           D+GLAR V   SP+   T+ V TRWYR+PE+L     Y+  +DIW+ G +  E+    P 
Sbjct: 243 DYGLARHVTNKSPY---TAYVSTRWYRSPEILLRKGSYSRPLDIWAFGCVVVEVATFRPL 299

Query: 212 LPGQNDIDQMEVTFRALGTPTDKEWPEVSSF----GSYNKLQIYPP------PSIDELRK 261
            PG +++DQ+      LGTP       +S +    GS+ K ++         P ++    
Sbjct: 300 FPGSDEMDQIWKILEVLGTPHTMSESAISGYQPHGGSWEKAEVLASRLNLKFPYVEGTSI 359

Query: 262 RFIAASENALNFMCGM----LTMNPKKRWNAIECLESEYFKE 299
             I A+ + L  +C +    LT +PKKR    E     YF E
Sbjct: 360 ESIVANPH-LQELCEVVKECLTWDPKKRATVDEICAMPYFAE 400

>CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces
           cerevisiae YJL106w IME2 ser/thr protein kinase,
           hypothetical start
          Length = 751

 Score =  118 bits (296), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 119/215 (55%), Gaps = 22/215 (10%)

Query: 55  DMSAIREVKY-LQEIQHDNVIELVDIFMAYD--NLNLVLEFLPSDLEVIIKDRSI-LFTP 110
           D + +REVK+ L    + ++I++ +IF+  +   L++ +E++  +L  +++ R   +F+ 
Sbjct: 122 DYTRVREVKFILSMTANKHLIQVYEIFVDSEKYQLHIAMEYMEQNLYQMMRRRKKRVFSI 181

Query: 111 ADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSP-----------------DGVIKVA 153
             +KS +   L G+ H H     HRDLKP N+L++P                 + V+K+A
Sbjct: 182 PSLKSILAQVLAGLRHIHDQNFFHRDLKPENILITPSTRYFDSSWLEKGNYPDNYVVKLA 241

Query: 154 DFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLP 213
           DFGLAR V + +   T+ V TRWYR+PE+L  + +Y+  +DIW+ G +  E+ +  P  P
Sbjct: 242 DFGLARHVENKNP-YTAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCVAMEVTVFKPLFP 300

Query: 214 GQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKL 248
           G N+IDQ+      LGTP   E  + S++  +  L
Sbjct: 301 GSNEIDQIWKILEVLGTPHTLEESKNSNYTPHGGL 335

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score =  115 bits (289), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 87/297 (29%), Positives = 149/297 (50%), Gaps = 38/297 (12%)

Query: 6   TTPITQT--EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREV 62
           + PI Q   +Y   K +GEG++  V L    STG+++A+K I K    K  +     RE+
Sbjct: 29  SIPIGQRIGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREI 88

Query: 63  KYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLR 122
            YL+ ++H ++I+L D+  + D + +V+E+  ++L   I  R  + +  + + +    + 
Sbjct: 89  SYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKM-SENEARRFFQQIIS 147

Query: 123 GVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPEL 182
            V +CHR+ I+HRDLKP NLLL     +K+ADFGL+  + +    L ++  +  Y APE+
Sbjct: 148 AVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSN-IMTDGNFLKTSCGSPNYAAPEV 206

Query: 183 LFGAKHYTSAIDIWSVGVI-FAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSS 241
           + G  +    +D+WS GVI +  L  R+P+     D + + V F+ +             
Sbjct: 207 ISGKLYAGPEVDVWSSGVILYVMLCRRLPF-----DDESIPVLFKNISNG---------- 251

Query: 242 FGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFK 298
                   +Y  P       +F+  S+ A N +  ML +NP  R    E +E E+FK
Sbjct: 252 --------VYSIP-------KFL--SQGAANLIKRMLIVNPLNRITIHEIMEDEWFK 291

>CAGL0E01683g complement(166584..167711) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 or sp|Q12222
           Saccharomyces cerevisiae YOL128c, start by similarity
          Length = 375

 Score =  113 bits (282), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 152/301 (50%), Gaps = 27/301 (8%)

Query: 18  KKVGEGTYAVV---YLGTKQSTGRQ-IAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDN 72
           +K+G G +  V   YL   + T     A+K++   +E+K        RE++ L+   H N
Sbjct: 39  RKIGRGAFGTVVQAYLTQDEQTWYGPFAIKKVPAQTEYKS-------RELQILRLTDHPN 91

Query: 73  VIELVDIFM---AYDN---LNLVLEFLPSDLEVIIK---DRSILFTPADIKSWMLMTLRG 123
           +++L   F      DN    +L +E LP  L++ I      ++      +K +     RG
Sbjct: 92  IVKLEYFFTHTSPKDNKVYQHLAMECLPETLQIEINRYTSNNLQLAIKHVKLYSYQIARG 151

Query: 124 VHHCHRNFILHRDLKPNNLLLSPD-GVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPEL 182
           + + H   I HRD+KP+N+L+ P  GV+K+ DFG A+ +  P++   S + +R+YRAPEL
Sbjct: 152 MLYLHALGICHRDIKPSNILVDPKTGVLKICDFGSAKRL-EPNQPSISYICSRFYRAPEL 210

Query: 183 LFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSS- 241
           + G+  YT+ +DIW +G +  E+++      GQ+ + Q+    + LG P DK++   S+ 
Sbjct: 211 ILGSTQYTTQVDIWGLGCVIGEMLIGRAIFQGQDPLLQLREIAKLLG-PPDKKFIFFSNP 269

Query: 242 --FGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
              G      ++   S++  +K F  A  + ++ +  +L   P+ R++    +   +F +
Sbjct: 270 RYTGPLYSTPLFNGTSLERFQKYFGHAGPDGIDLLMKVLKYEPELRFSPRRIMAHPFFDD 329

Query: 300 M 300
           +
Sbjct: 330 L 330

>KLLA0F02838g 264329..266596 some similarities with sp|P32581
           Saccharomyces cerevisiae YJL106w IME2 ser/thr protein
           kinase, hypothetical start
          Length = 755

 Score =  115 bits (287), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 83/279 (29%), Positives = 140/279 (50%), Gaps = 39/279 (13%)

Query: 55  DMSAIREVKYLQEI-QHDNVIELVDIFM--AYDNLNLVLEFLPSDLEVIIKDRSI-LFTP 110
           D + +RE+K++ +I  H N++ + ++F+  +  +L++V+E +  ++  ++K R   +F+ 
Sbjct: 107 DYTRVREIKFILQIPAHKNLVTIYEMFIDDSLYHLHIVMECMEQNIYQLMKHRKRRVFSL 166

Query: 111 ADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSP-----------------DGVIKVA 153
             ++S +   L G+ H H +   HRD+KP N+L+SP                 + V+K+A
Sbjct: 167 PTLRSILFQILAGIKHIHDHDFFHRDIKPENILISPSHRYFSKKWLEDDNYSDNYVVKLA 226

Query: 154 DFGLARAVP--SPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPY 211
           D+GLAR V   SP+   T+ V TRWYR+PE+L    +Y+  +DIW+ G +  EL    P 
Sbjct: 227 DYGLARHVNNRSPY---TTYVSTRWYRSPEILLRKGYYSKPLDIWAYGCVVVELATFSPL 283

Query: 212 LPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGS--------YNKLQIYPPPSIDELRKRF 263
            PG ++ DQ+      LG+P D        FG         Y  L  Y  P ++    R 
Sbjct: 284 FPGSDETDQIWRILDLLGSP-DHSINGKEHFGGSWLDSKPLYQALN-YEFPYVEGKTIRD 341

Query: 264 IAAS---ENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
           +  +   E+  + +   L  NP +R  A E     YFKE
Sbjct: 342 VLPNPQLEDLYDVVTSCLKWNPSERATANEICALPYFKE 380

>Scas_678.13
          Length = 462

 Score =  113 bits (282), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 140/295 (47%), Gaps = 20/295 (6%)

Query: 19  KVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMS--AIREVKYLQEIQ-HDNVIE 75
           ++  G+Y +V   +   +   I +   K S        S  A+RE+K LQ    H N+I 
Sbjct: 28  EISRGSYGIVLSASYSHSSENIVIAIKKISNIFGSTQSSKRALRELKLLQAFNGHKNIIS 87

Query: 76  LVDIFMAY------DNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHR 129
           L D+ + +      + + +  E +  D+E IIK R  L T    + ++   L G+ + H 
Sbjct: 88  LYDMDIVFYPTGILNGIYIYEELMECDMEQIIKSRQPL-TEYHYQFFIYQILCGLRYIHS 146

Query: 130 NFILHRDLKPNNLLLSPDGVIKVADFGLAR----AVPSPHEMLTSNVVTRWYRAPELLFG 185
             I+ R+++P+NLL++ D  +K+  F LA+     V + ++     + TRWY APELL  
Sbjct: 147 ADIIMRNVRPSNLLINSDCKLKICGFSLAQKASNGVANNNQFSPEYLTTRWYHAPELLLN 206

Query: 186 AKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSY 245
              YT++ID+WS G +  EL+ + P     + ++Q+   F+ LGT + +    + S    
Sbjct: 207 HHIYTTSIDVWSTGCVLGELITKEPIFHENDFVNQLNKIFQILGTHSKEALDNIGSKTIK 266

Query: 246 N---KLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYF 297
           N   +L   P P ++ +   F  A+    + +  ML  + ++R      L   YF
Sbjct: 267 NHVSQLPYIPKPPMENI---FPGATTECQDLLNKMLKFDSEQRITVDMALRHPYF 318

>Scas_660.28
          Length = 623

 Score =  112 bits (280), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 144/287 (50%), Gaps = 36/287 (12%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDNVIEL 76
           K +GEG++  V L    +TG+++A+K I K    K  +     RE+ YL+ ++H ++I+L
Sbjct: 50  KTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL 109

Query: 77  VDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRD 136
            D+  + D + +V+E+  ++L   I  R  + +  + + +    +  V +CHR+ I+HRD
Sbjct: 110 YDVIKSKDEIIMVMEYAGNELFDYIVQRDKM-SEDEARRFFQQIISAVEYCHRHKIVHRD 168

Query: 137 LKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIW 196
           LKP NLLL     +K+ADFGL+  + +    L ++  +  Y APE++ G  +    +D+W
Sbjct: 169 LKPENLLLDEHLNVKIADFGLSN-IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVW 227

Query: 197 SVGVI-FAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPS 255
           S GVI +  L  R+P+     D + + V F+ +                     +Y  P 
Sbjct: 228 SCGVILYVMLCRRLPF-----DDESIPVLFKNINN------------------GVYTIP- 263

Query: 256 IDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPP 302
                 +F+  S+ A   +  ML +NP  R +  E ++ E+FK   P
Sbjct: 264 ------KFL--SQGASTLIKKMLIVNPLNRISIQEIMQDEWFKAGLP 302

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  112 bits (279), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/283 (29%), Positives = 144/283 (50%), Gaps = 36/283 (12%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDNVIEL 76
           K +GEG++  V L    +TG+++A+K I K    K  +     RE+ YL+ ++H ++I+L
Sbjct: 43  KTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL 102

Query: 77  VDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRD 136
            D+  + D + +V+E+  ++L   I  R+ + +  + + +    +  V +CHR+ I+HRD
Sbjct: 103 YDVIKSKDEIIMVIEYAGNELFDYIVQRNKM-SEQEARRFFQQIISAVEYCHRHKIVHRD 161

Query: 137 LKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIW 196
           LKP NLLL     +K+ADFGL+  + +    L ++  +  Y APE++ G  +    +D+W
Sbjct: 162 LKPENLLLDEHLNVKIADFGLSN-IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVW 220

Query: 197 SVGVI-FAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPS 255
           S GVI +  L  R+P+     D + + V F+ +            S G Y  L  +  P 
Sbjct: 221 SCGVILYVMLCRRLPF-----DDESIPVLFKNI------------SNGVYT-LPKFLSPG 262

Query: 256 IDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFK 298
             +L KR              ML +NP  R +  E ++ E+FK
Sbjct: 263 ASDLIKR--------------MLIVNPLNRISIHEIMQDEWFK 291

>Kwal_47.18233
          Length = 598

 Score =  111 bits (277), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 82/283 (28%), Positives = 142/283 (50%), Gaps = 36/283 (12%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDNVIEL 76
           K +GEG++  V L    +TG+++A+K I K    K  +     RE+ YL+ ++H ++I+L
Sbjct: 35  KTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL 94

Query: 77  VDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRD 136
            D+  + D + +V+E+  ++L   I  R  + +  + + +    +  V +CHR+ I+HRD
Sbjct: 95  YDVVKSKDEIVMVIEYAGNELFDYIVQRDKM-SENEARRFFQQIISAVEYCHRHKIVHRD 153

Query: 137 LKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIW 196
           LKP NLLL     +K+ADFGL+  + +    L ++  +  Y APE++ G  +    +D+W
Sbjct: 154 LKPENLLLDEHLNVKIADFGLSN-IMTDGNFLRTSCGSPNYAAPEVISGKLYAGPEVDVW 212

Query: 197 SVGVI-FAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPS 255
           S GVI +  L  R+P+     D + + V F+ +                     IY  P 
Sbjct: 213 SSGVILYVMLCRRLPF-----DDESIPVLFKNISNG------------------IYTLP- 248

Query: 256 IDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFK 298
                 +F+  S  A N +  ML +NP  R    E ++ E+FK
Sbjct: 249 ------KFL--SPGAANLIKRMLIVNPLNRITIHEIMQDEWFK 283

>Kwal_55.22001
          Length = 363

 Score =  108 bits (269), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 91/314 (28%), Positives = 153/314 (48%), Gaps = 32/314 (10%)

Query: 6   TTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQ----IAVKEI-KTSEFKDGLDMSAIR 60
           T P+   EY   KK+G G +  V          +     A+K++   +E+K        R
Sbjct: 21  TRPMLVKEY---KKIGHGAFGTVVQAFLTPDNNKWYGPFAIKKVPAQTEYKS-------R 70

Query: 61  EVKYLQEIQHDNVIELVDIFM---AYDN---LNLVLEFLPSDLEVIIKDRSILFTPADIK 114
           E++ L+   H NV++L   F      DN    +L +E LP  L++ I   +       +K
Sbjct: 71  ELEILRIADHPNVVKLEYFFTHTSPQDNKLYQHLAMECLPETLQLEIHRYASNKLELPLK 130

Query: 115 SWMLMTL---RGVHHCHRNFILHRDLKPNNLLLSPD-GVIKVADFGLARAVPSPHEMLTS 170
              L T    RG+ + H   I HRD+KP+N+L+ P+ GV+K+ DFG A+ +   ++   S
Sbjct: 131 HTKLYTYQIARGMLYLHALGICHRDIKPSNVLVDPNTGVLKICDFGSAKKLEQ-NQPSIS 189

Query: 171 NVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGT 230
            + +R+YRAPEL+ G   YT+ IDIW +G +  E+++      GQ  + Q+    + LG 
Sbjct: 190 YICSRFYRAPELIVGCTQYTTQIDIWGLGCVMGEMLIGKAVFQGQEPLLQLREISKLLG- 248

Query: 231 PTDKEWPEVSSFGSYNKLQIYPP---PSIDE-LRKRFIAASENALNFMCGMLTMNPKKRW 286
           P DK++   S+  SY+      P    S+ E   K F  A    ++ +  +LT  P++R 
Sbjct: 249 PPDKKFLFFSN-PSYDGPLFSKPLFTGSVQERFEKHFGQAGPEGIDLLMKILTYEPERRL 307

Query: 287 NAIECLESEYFKEM 300
           +    L   +F+++
Sbjct: 308 SPRRILAHPFFEDL 321

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score =  110 bits (275), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 83/294 (28%), Positives = 146/294 (49%), Gaps = 37/294 (12%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDNVIEL 76
           K +GEG++  V L    STG+++A+K I K    K  +     RE+ YL+ ++H ++I+L
Sbjct: 39  KTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL 98

Query: 77  VDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRD 136
            D+  + D + +V+E+  ++L   I  R  +    + + +    +  V +CHR+ I+HRD
Sbjct: 99  YDVIKSKDEIIMVIEYAGNELFDYIVQRDKM-PEQEARRFFQQIISAVDYCHRHKIVHRD 157

Query: 137 LKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIW 196
           LKP NLLL     +K+ADFGL+  + +    L ++  +  Y APE++ G  +    +D+W
Sbjct: 158 LKPENLLLDEHLNVKIADFGLSN-IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVW 216

Query: 197 SVGVI-FAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPS 255
           S GVI +  L  R+P+     D + + V F+ +                     +Y  P+
Sbjct: 217 SSGVILYVMLCRRLPF-----DDESIPVLFKNISNG------------------VYTIPN 253

Query: 256 IDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFK-EMPPPSDPSE 308
                      S+ A + +  ML +NP  R    E ++ E+FK ++P    P+E
Sbjct: 254 F---------LSQGAASLIKKMLIVNPVNRITVHEIMQDEWFKVDLPDYLVPAE 298

>AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH]
           complement(564252..566714) [2463 bp, 820 aa]
          Length = 820

 Score =  109 bits (273), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 117/211 (55%), Gaps = 26/211 (12%)

Query: 55  DMSAIREVKYLQEI-QHDNVIELVDIFM--AYDNLNLVLEFLPSDLEVIIKDRSI-LFTP 110
           D + +RE+K++ +I  H +++++ ++F+  +   L++V+E +  ++  ++K R   +F+ 
Sbjct: 107 DYTRVREIKFILQIPAHAHLVQIYELFIDDSLYQLHIVMECMEQNIYQLMKCRKRRVFSL 166

Query: 111 ADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSP-----------------DGVIKVA 153
             ++S +   L G+ H H +   HRD+KP N+L+SP                 + V+K+A
Sbjct: 167 PTLRSILSQILSGIRHIHAHNFYHRDIKPENILISPANRYYSKEWISAGHYPDNYVVKIA 226

Query: 154 DFGLARAV--PSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPY 211
           D+GLAR V   SP+   T+ V TRWYR+PE+L     Y+  +DIW+ G +  E+    P 
Sbjct: 227 DYGLARHVTNKSPY---TAYVSTRWYRSPEILLRQGSYSRPLDIWAFGCVAVEVATFKPL 283

Query: 212 LPGQNDIDQMEVTFRALGTPTDKEWPEVSSF 242
            PG +++DQ+      LGTP      ++S +
Sbjct: 284 FPGADEMDQIWKILELLGTPHPCHESKISGY 314

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score =  109 bits (272), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 142/283 (50%), Gaps = 36/283 (12%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDNVIEL 76
           K +GEG++  V L    +TG+++A+K I K    K  +     RE+ YL+ ++H ++I+L
Sbjct: 59  KTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL 118

Query: 77  VDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRD 136
            D+  + D + +V+E+  ++L   I  R  + +  + + +    +  V +CHR+ I+HRD
Sbjct: 119 YDVIKSKDEIIMVIEYAGNELFDYIVQRDKM-SEQEARRFFQQIISAVEYCHRHKIVHRD 177

Query: 137 LKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIW 196
           LKP NLLL     +K+ADFGL+  + +    L ++  +  Y APE++ G  +    +D+W
Sbjct: 178 LKPENLLLDEHLNVKIADFGLSN-IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVW 236

Query: 197 SVGVI-FAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPS 255
           S GVI +  L  R+P+     D + + V F+ +                     +Y  P 
Sbjct: 237 SCGVILYVMLCRRLPF-----DDESIPVLFKNISN------------------GVYTLP- 272

Query: 256 IDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFK 298
                 +F+  S  A   +  ML +NP  R +  E ++ ++FK
Sbjct: 273 ------KFL--SPGAAGLIKRMLIVNPLNRISIHEIMQDDWFK 307

>Scas_635.1
          Length = 378

 Score =  103 bits (258), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 141/301 (46%), Gaps = 27/301 (8%)

Query: 18  KKVGEGTYAVVYLG----TKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDN 72
           +K+G G +  V        K+      A+K++   +E+K        RE++ L+   H N
Sbjct: 43  RKIGRGAFGTVVQAYITPNKEDWYGPFAIKKVPAQTEYKS-------RELEILRITNHPN 95

Query: 73  VIELVDIFMAYD------NLNLVLEFLPSDLEVIIK---DRSILFTPADIKSWMLMTLRG 123
           +++L   F            +L +E LP  L++ I       +      +K +     RG
Sbjct: 96  IVKLEYFFTHVSPQDHKVYQHLAMECLPETLQIEISRYAHNKMELALKHVKLYSYQIARG 155

Query: 124 VHHCHRNFILHRDLKPNNLLLSPD-GVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPEL 182
           + + H   I HRD+KP+N+L+ P+ GV+K+ DFG A+ +   ++   S + +R+YRAPEL
Sbjct: 156 MLYLHALGICHRDIKPSNILVDPNTGVLKICDFGSAKRL-EINQPSISYICSRFYRAPEL 214

Query: 183 LFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF 242
           + G   YT+ +DIW +G +  E++L      GQ  + Q+    + LG P DK++   S+ 
Sbjct: 215 ILGCTQYTTQVDIWGLGCVIGEMLLGKAIFQGQEPLLQLREIAKLLG-PPDKKFIFFSNP 273

Query: 243 GSYNKLQ---IYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
           G    L    ++   S     K F  A    ++ +  +L   P+ R +    L   +F +
Sbjct: 274 GYDGPLYSKPLFSGTSQSRFEKYFGHAGVEGIDLLMKVLVYEPEIRLSPRRILAHPFFDD 333

Query: 300 M 300
           +
Sbjct: 334 L 334

>KLLA0E07414g complement(672690..673787) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 365

 Score =  103 bits (256), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 148/303 (48%), Gaps = 31/303 (10%)

Query: 18  KKVGEGTYAVV---YLG-TKQSTGRQIAVKEIKT-SEFKDGLDMSAIREVKYLQEIQHDN 72
           K++G+G +  V   YL    Q      A+K++   +E+K        RE++ L+   H N
Sbjct: 31  KRIGQGAFGTVVQAYLTPDNQKWLGPFAIKKVPAQTEYKS-------RELEILRIADHPN 83

Query: 73  VIELVDIFMAYDNLN------LVLEFLPSDL--EVIIKDRSILFTP-ADIKSWMLMTLRG 123
           V++L   +      +      L +E LP  L  E++   ++ L  P   +K +     RG
Sbjct: 84  VVKLEYFYTHISPTDHKLYQHLAMECLPEMLQNEILRYKKNNLELPLKHVKLYAYQIARG 143

Query: 124 VHHCHRNFILHRDLKPNNLLLSPD-GVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPEL 182
           + + H   I HRD+KP+N+L+ P  G++K+ DFG A+ + S ++   S + +R+YRAPEL
Sbjct: 144 MLYLHALGICHRDIKPSNVLVDPQTGILKICDFGSAKKLES-NQPSISYICSRYYRAPEL 202

Query: 183 LFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF 242
           + G   YT+ IDIW +G +  E++L      G   + Q+    + LG P DK +   S+ 
Sbjct: 203 IVGCTQYTTKIDIWGLGCVLGEMLLGKAVFQGHQPLLQLHEITKLLG-PPDKRFIFFSN- 260

Query: 243 GSYNKLQIYPPPSID-----ELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYF 297
            SYN   ++  P  +        K F  A  + ++ +  +L   P++R +    L   +F
Sbjct: 261 PSYNG-PLFSKPLFEGAPKARFEKYFGYAGPDGVDLLMSVLVYEPERRASPRRILAHPFF 319

Query: 298 KEM 300
            ++
Sbjct: 320 DDL 322

>ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -
           SH] (398519..399607) [1089 bp, 362 aa]
          Length = 362

 Score =  102 bits (254), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 86/318 (27%), Positives = 149/318 (46%), Gaps = 32/318 (10%)

Query: 2   STEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQ----IAVKEI-KTSEFKDGLDM 56
            + +T  +   EY   K++G G +  V          +     A+K++   +E+K     
Sbjct: 16  QSNVTRQMLVKEY---KRIGHGAFGTVVQAYLTPDNEKWYGPFAIKKVPAQTEYKS---- 68

Query: 57  SAIREVKYLQEIQHDNVIELVDIFMAYD------NLNLVLEFLPSDL--EVIIKDRSILF 108
              RE+  L+   H NV++L   F            +L +E LP  L  E++   ++ L 
Sbjct: 69  ---RELAILRIADHPNVVKLEYFFTHVSPSDGKVYQHLAMECLPETLQHEILRYTQNKLE 125

Query: 109 TP-ADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSP-DGVIKVADFGLARAVPSPHE 166
            P   IK +     RG+ + H   I HRD+KP+N+L+ P  GV+K+ DFG A+ +   ++
Sbjct: 126 LPLKHIKMYTYQIARGMLYLHALGICHRDIKPSNILVDPKSGVLKICDFGSAKKLEQ-NQ 184

Query: 167 MLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFR 226
              S + +R+YRAPEL+ G   YT+ IDIW +G +  E+++      GQ  + Q+    +
Sbjct: 185 PSISYICSRFYRAPELIVGCTQYTTQIDIWGLGCVIGEMLIGKAVFQGQEPLLQLHEIAK 244

Query: 227 ALGTPTDKEWPEVS--SFGS--YNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNP 282
            LG P DK++   S  S+G   ++K      P      K F  A    ++ +  +L  +P
Sbjct: 245 LLG-PPDKKFIFFSNPSYGGPLFSKPLFNGTPQ-QRFEKYFGHAGPEGIDLLMKVLCYSP 302

Query: 283 KKRWNAIECLESEYFKEM 300
           ++R +    L   +  E+
Sbjct: 303 ERRLSPRRVLCHAFLDEL 320

>Kwal_26.7355
          Length = 1446

 Score =  103 bits (258), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 83/296 (28%), Positives = 150/296 (50%), Gaps = 52/296 (17%)

Query: 14   YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEF--KDGLDMS---AIR-EVKYLQE 67
            + KG+ +G+G++  V+LG   +TG  IAVK+++   +  +D   +S   A+R EV  L++
Sbjct: 1146 WIKGEMIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKD 1205

Query: 68   IQHDNVIELVDIFMAYDNLN----LVLEFLPS-DLEVIIKDRSILFTPAD---IKSWMLM 119
            + H N+++    ++ ++N N    L LE++    +  +I+    L+   D   I+   + 
Sbjct: 1206 LDHTNIVQ----YLGFENKNYVYSLFLEYVAGGSVGSLIR----LYGKFDENLIRFLAVQ 1257

Query: 120  TLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARA---VPSPHEMLTSNVVTRW 176
             LRG+ + H   ILHRD+K +NLLL  DG+ K++DFG+++    + S  +M     V  +
Sbjct: 1258 VLRGLSYLHSKKILHRDMKADNLLLDVDGICKISDFGISKKSNNIYSNSDMTMRGTV--F 1315

Query: 177  YRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEW 236
            + APE++   + Y++ +DIWS+G +  E+        G+     +EV             
Sbjct: 1316 WMAPEMVDTKQGYSAKVDIWSLGCVVLEM------FAGKRPWSNLEV------------- 1356

Query: 237  PEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECL 292
              V++     K +  PP  I E  ++ I+A      F+     +NP+KR  A E L
Sbjct: 1357 --VAAMFKIGKFKSAPP--IPEDTQKIISA--EGKEFLDACFEINPEKRPTADELL 1406

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score =  103 bits (257), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 91/311 (29%), Positives = 147/311 (47%), Gaps = 47/311 (15%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFK---------------DGLDMSAIRE 61
           G+ +G G+   V L    STG++ AVK I  + F                D L     RE
Sbjct: 22  GETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIERE 81

Query: 62  VKYLQEIQHDNVIELVDIFMAYDNLNLVLEFL-PSDLEVIIKDRSILFTPADIKSWMLMT 120
           +  ++ + H NV+ L D++    +L LVLE+    +L  ++ +R  L     I+ +  + 
Sbjct: 82  IIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQII 141

Query: 121 LRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAP 180
           + GV +CH   I+HRDLKP NLLL     IK+ADFG+A A+ +  ++L ++  +  Y AP
Sbjct: 142 I-GVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKLLETSCGSPHYAAP 199

Query: 181 ELLFGAKHYTSAIDIWSVGVI-FAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEV 239
           E++ G  +   A D+WS GVI FA L  R+P+       D+ +   R L     K   E+
Sbjct: 200 EIVSGIPYQGFASDVWSCGVILFALLTGRLPF-------DEEDGNIRTLLLKVQKGEFEM 252

Query: 240 SSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
                         PS DE+       S  A + +  +LT++P++R    + L+    ++
Sbjct: 253 --------------PSDDEI-------SREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291

Query: 300 MPPPSDPSEIK 310
            P   D   I+
Sbjct: 292 YPSIRDSKSIR 302

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score =  103 bits (257), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 86/291 (29%), Positives = 141/291 (48%), Gaps = 43/291 (14%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELVDI 79
           VG+G +A V    ++STG+  AVK I   +  D  D    RE+  LQ++ H  +++L D 
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFD-GVKRELDVLQKLNHPRIVKLKDF 256

Query: 80  FMAYDNLNLVLEFLP-SDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLK 138
           F   DN  +++EF+   DL   +     +   A  +      L  V + H   I HRDLK
Sbjct: 257 FEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAG-REITRQVLEAVKYMHDQGISHRDLK 315

Query: 139 PNNLLLSPDG--VIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKH-------- 188
           P+N+++  D   +IK+ DFGLA+ V + +  L +   T  Y APE++ G           
Sbjct: 316 PDNIMIEQDDPVLIKITDFGLAK-VQNQNTFLNTFCGTLAYVAPEVIDGKNAEDKTNRDL 374

Query: 189 YTSAIDIWSVG-VIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNK 247
           Y+S +D+WS+G +++  L   +P+  GQ+   Q E+ F+ +   +  E P          
Sbjct: 375 YSSLVDMWSIGCLVYVILTGHLPF-SGQS---QNEL-FKQIKRGSYHEGP---------- 419

Query: 248 LQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFK 298
           L+ Y               SE A NF+  +L ++PK+R NA + L+  + K
Sbjct: 420 LKDY-------------RISEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score =  103 bits (256), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 151/308 (49%), Gaps = 44/308 (14%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFK-------DGLDMSAI-----REVKY 64
           G+ +G G+   V L + ++T +Q AVK I  + F+       +G   +A+     +E+  
Sbjct: 23  GETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIII 82

Query: 65  LQEIQHDNVIELVDIFMAYDNLNLVLEFL-PSDLEVIIKDRSILFTPADIKSWMLMTLRG 123
           ++ + H NV+ L D++    +L LVLE+    +L  ++ +R  L     ++++  + + G
Sbjct: 83  MKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIII-G 141

Query: 124 VHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELL 183
           + +CH   ++HRDLKP NLLL     IK+ADFG+A A+ S  ++L ++  +  Y APE++
Sbjct: 142 ISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMA-ALESEDKLLETSCGSPHYAAPEII 200

Query: 184 FGAKHYTSAIDIWSVGVI-FAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF 242
            G  +   + D+WS GVI FA L  R+P+       D+ +   R L     K   E+   
Sbjct: 201 SGLPYEGFSSDVWSCGVILFALLTGRLPF-------DEEDGNIRNLLLKVQKGEFEM--- 250

Query: 243 GSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPP 302
                      P  DE+ K        A + +  +LT++P KR    E L+    ++ P 
Sbjct: 251 -----------PDDDEITK-------EAQDLLARLLTVDPSKRITIREILKHPLLQKYPS 292

Query: 303 PSDPSEIK 310
             D   I+
Sbjct: 293 IKDSRSIR 300

>Scas_673.20*
          Length = 758

 Score =  102 bits (254), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 112/202 (55%), Gaps = 9/202 (4%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           Y K K++GEG   +VY   +  T   +A+K+I   + +  L M    E+  L+E QH N+
Sbjct: 481 YRKLKRIGEGASGIVYTAYEIGTDISVAIKQIDL-KIQPRLQM-IWTEMLVLKEYQHPNI 538

Query: 74  IELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPAD--IKSWMLMTLRGVHHCHRNF 131
           I  ++ ++ +D L +V+E++       + D    FTP +  + +    TL G++  H   
Sbjct: 539 INFINSYLLHDTLWIVMEYMDGG---SLADIVSFFTPTEEQMATICRETLFGLNFLHSRG 595

Query: 132 ILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTS 191
           I+HRD+K +N+LLS +G IK+ DFG    +   +   T+ V T ++ APE++  +K Y  
Sbjct: 596 IVHRDIKSDNILLSMNGDIKITDFGFCGQLTESNTKRTTMVGTPYWMAPEVI-ASKEYGP 654

Query: 192 AIDIWSVGVIFAELML-RIPYL 212
            +D+WS+G++  E++    PYL
Sbjct: 655 KVDVWSLGIMIIEMIEGEPPYL 676

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score =  101 bits (252), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 93/324 (28%), Positives = 143/324 (44%), Gaps = 61/324 (18%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR-EVKYLQEIQHD 71
           +Y  GK++G G YA+V     + TG+Q+AVK     +  D       R E   L  +QH 
Sbjct: 199 KYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHP 258

Query: 72  NVIELVDIFM-----AYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIKSWMLMTLRGV 124
           N++ L+D F+     +     LVLE +      E I+  R       + K+     L G+
Sbjct: 259 NIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIV--RKTCLRQDESKALFKQLLTGL 316

Query: 125 HHCHRNFILHRDLKPNNLLL------SPDGV-------------IKVADFGLARAVPSPH 165
            + H   I+HRD+KP N+LL      +P  V             +K+ADFGLA+      
Sbjct: 317 KYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTG--- 373

Query: 166 EMLTSNVV--TRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEV 223
           EM  +N +  T  Y APE+L   K YTS +D+WS GVI    +   P    Q        
Sbjct: 374 EMQFTNTLCGTPSYVAPEVL-TKKGYTSKVDLWSAGVILYVCLCGFPPFSDQ-------- 424

Query: 224 TFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPK 283
               LG P+ KE    + +  Y+       P  D++        ++ L+ +  +L +NP 
Sbjct: 425 ----LGPPSLKEQILQAKYAFYS-------PYWDKI-------DDSVLHLISNLLVLNPD 466

Query: 284 KRWNAIECLESEYFKEMPPPSDPS 307
           +R+N  E L   +F ++   S  S
Sbjct: 467 ERYNIDEALNHPWFNDIQQQSSVS 490

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score =  101 bits (251), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 110/206 (53%), Gaps = 19/206 (9%)

Query: 14   YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSA------IREVKYLQE 67
            + KG+ +G+G++  VYLG   +TG  +AVK+++  +F    + +       I EV  L++
Sbjct: 1124 WIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKD 1183

Query: 68   IQHDNVIELVDIFMAYDNLN----LVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRG 123
            + H N+++    ++ ++N N    L LE++       +      F    I+      L G
Sbjct: 1184 LDHLNIVQ----YLGFENKNCIYSLFLEYVAGGSVGSLIRLYGHFDEQLIRFLTTQVLEG 1239

Query: 124  VHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARA---VPSPHEMLTSNVVTRWYRAP 180
            + + H   ILHRD+K +NLLL  DGV K++DFG++R    + S  EM     V  ++ AP
Sbjct: 1240 LAYLHLRGILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSEMTMRGTV--FWMAP 1297

Query: 181  ELLFGAKHYTSAIDIWSVGVIFAELM 206
            E++   + Y++ +DIWS+G +  E+ 
Sbjct: 1298 EMVDTTQGYSAKVDIWSLGCVVLEMF 1323

>Scas_493.2
          Length = 1117

 Score =  100 bits (250), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 86/311 (27%), Positives = 146/311 (46%), Gaps = 47/311 (15%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFK---------------DGLDMSAIRE 61
           G+ +G G+   V L   ++T +Q A+K I  S F                D L     RE
Sbjct: 25  GETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIERE 84

Query: 62  VKYLQEIQHDNVIELVDIFMAYDNLNLVLEFL-PSDLEVIIKDRSILFTPADIKSWMLMT 120
           +  ++ ++H NV+ L D++    NL ++LE+    +L  ++ ++  L     ++ +  + 
Sbjct: 85  IIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQII 144

Query: 121 LRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAP 180
           + G+ +CH   I+HRDLKP NLLL     IK+ADFG+A A+ +  ++L ++  +  Y AP
Sbjct: 145 I-GISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLLETSCGSPHYAAP 202

Query: 181 ELLFGAKHYTSAIDIWSVGVI-FAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEV 239
           E++ G  ++    D+WS GVI FA L  R+P+       D+ +   R L         E+
Sbjct: 203 EIVSGIPYHGFESDVWSCGVILFALLTGRLPF-------DEEDGNIRNLLLKVQSGQFEM 255

Query: 240 SSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
                         P  DE+       S +A + +  +LT++P KR    E L+    ++
Sbjct: 256 --------------PDDDEM-------SRDAQDLISRILTVDPTKRIKTREILKHPLLQK 294

Query: 300 MPPPSDPSEIK 310
            P   D   IK
Sbjct: 295 YPSIKDSKSIK 305

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score =  100 bits (249), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 146/299 (48%), Gaps = 47/299 (15%)

Query: 16   KGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLD-----MSAIR-EVKYLQEIQ 69
            KG+ +G+G++  VYL    +TG  +AVK+++  ++    +     + A+R EV  L+++ 
Sbjct: 1177 KGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLD 1236

Query: 70   HDNVIELVDIFMAYDNLN----LVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGV 124
            H N+++    ++ ++N N    L LE++    +  +I+       P  IK      L+G+
Sbjct: 1237 HLNIVQ----YLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPL-IKHLTTQVLKGL 1291

Query: 125  HHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARA---VPSPHEMLTSNVVTRWYRAPE 181
             + H   ILHRD+K +NLLL  DG+ K++DFG++R    + S  +M     V  ++ APE
Sbjct: 1292 AYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKDIYSNSDMTMRGTV--FWMAPE 1349

Query: 182  LLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSS 241
            ++   + Y++ +DIWS+G I  E+        G+     +EV               V++
Sbjct: 1350 MVDTKQGYSAKVDIWSLGCIVLEMFA------GKRPWSNLEV---------------VAA 1388

Query: 242  FGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEM 300
                 K +  PP   D L       S+   NF+     +NP+KR  A E L S  F E+
Sbjct: 1389 MFKIGKSKSAPPIPEDTL----PLISQIGRNFLDACFEINPEKRPTANELL-SHPFSEV 1442

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score =  100 bits (249), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 111/206 (53%), Gaps = 13/206 (6%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAI---------REVKYLQE 67
           G+ +G G+   V L   + TG + AVK I  S F +  + S           RE+  ++ 
Sbjct: 24  GETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKL 83

Query: 68  IQHDNVIELVDIFMAYDNLNLVLEFL-PSDLEVIIKDRSILFTPADIKSWMLMTLRGVHH 126
           + H NV+ L D++   +NL L+LE+    +L  ++ D   L     I  +  + + G+ +
Sbjct: 84  LSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIII-GISY 142

Query: 127 CHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGA 186
           CH   I+HRDLKP NLLL     IK+ADFG+A A+ +  ++L ++  +  Y APE++ G 
Sbjct: 143 CHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLETSCGSPHYAAPEIVSGL 201

Query: 187 KHYTSAIDIWSVGVI-FAELMLRIPY 211
            +   A D+WS GVI FA L  R+P+
Sbjct: 202 PYEGFASDVWSCGVILFALLTGRLPF 227

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score =  100 bits (248), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 105/203 (51%), Gaps = 13/203 (6%)

Query: 14   YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR-------EVKYLQ 66
            + KG+ +G+G++  VYL    +TG  +AVK++   EF    D SAI        EV  L+
Sbjct: 1038 WIKGEIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEF-SSQDESAISMVEALKSEVSTLK 1096

Query: 67   EIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHH 126
            ++ H N+++ +         +L LE++       +      F    I+      L G+ +
Sbjct: 1097 DLNHVNIVQYLGFEEKNGIYSLFLEYVAGGSVGSLIRMYGRFDDQLIRHLTKQVLEGLAY 1156

Query: 127  CHRNFILHRDLKPNNLLLSPDGVIKVADFGLARA---VPSPHEMLTSNVVTRWYRAPELL 183
             H   ILHRD+K +NLLL  DGV K++DFG++R    + S  +M     V  ++ APE++
Sbjct: 1157 LHSKGILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSDMTMRGTV--FWMAPEMV 1214

Query: 184  FGAKHYTSAIDIWSVGVIFAELM 206
              A  Y++ +DIWS+G +  E+ 
Sbjct: 1215 DTAHGYSAKVDIWSLGCVVLEMF 1237

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 99.8 bits (247), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 132/256 (51%), Gaps = 14/256 (5%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHD 71
           +Y +G+ +GEG +A  +   K  +G+  A K + K S   +      + E++  + + H 
Sbjct: 80  DYHRGQFLGEGGFARCF-QIKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHT 138

Query: 72  NVIELVDIFMAYDNLNLVLEFLP--SDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHR 129
           N+++ +D F    N+ ++LE  P  S +E+I K ++I  T  +++ +M     G+ + H 
Sbjct: 139 NIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTI--TEPEVRFFMTQICGGIQYMHS 196

Query: 130 NFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKH- 188
           N ++HRDLK  N+       +K+ DFGLA  + +  E   +   T  Y APE+L G KH 
Sbjct: 197 NRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPEVLMG-KHS 255

Query: 189 -YTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQM--EVTFRALGTPTDKEWPEVSSFGSY 245
            ++  +DIWS+GV+   L++  P    + D++ +   +  R    P DK+  + + +   
Sbjct: 256 GHSYEVDIWSIGVMLYALLIGKPPFQAK-DVNTIYERIKQRNFAYPKDKKISQDAKYLID 314

Query: 246 NKLQIYP--PPSIDEL 259
           + L + P   PSI E+
Sbjct: 315 DILSLNPMERPSIQEI 330

>Scas_711.25
          Length = 1515

 Score = 99.0 bits (245), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 114/202 (56%), Gaps = 15/202 (7%)

Query: 16   KGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLD-----MSAIR-EVKYLQEIQ 69
            KG+ +G+G++  VYL    +TG  +AVK+++  ++    +     + A+R EV  L+++ 
Sbjct: 1216 KGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDLD 1275

Query: 70   HDNVIELVDIFMAYDNL-NLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHC 127
            H N+++ +  F   DN+ +L LE++    +  +I+       P  I+      LRG+ + 
Sbjct: 1276 HLNIVQYLG-FENKDNIYSLFLEYVAGGSVGSLIRMYGRFDEPL-IRHLNTQVLRGLAYL 1333

Query: 128  HRNFILHRDLKPNNLLLSPDGVIKVADFGLARA---VPSPHEMLTSNVVTRWYRAPELLF 184
            H   ILHRD+K +NLLL  DGV K++DFG++R    + S  +M     V  ++ APE++ 
Sbjct: 1334 HSRGILHRDMKADNLLLDQDGVCKISDFGISRKSKDIYSNSDMTMRGTV--FWMAPEMVD 1391

Query: 185  GAKHYTSAIDIWSVGVIFAELM 206
              + Y++ +DIWS+G I  E+ 
Sbjct: 1392 TKQGYSAKVDIWSLGCIVLEMF 1413

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 98.6 bits (244), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 111/207 (53%), Gaps = 8/207 (3%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDN 72
           +Y   + +G G+Y VVY  T + T +++A+KE+   +  + +D+  + E+  L+ + H N
Sbjct: 21  QYQLRQIIGRGSYGVVYKATNKKTAQEVAIKEVNYQDDDELVDI--MSEIDLLKNLNHIN 78

Query: 73  VIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFI 132
           +++         NL ++LE+        +  R+   +  + K ++  TL G+++ H   +
Sbjct: 79  IVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPMSEHEAKPYVRQTLNGLNYLHEQGV 138

Query: 133 LHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192
           +HRD+K  N+LL  + V+K+ADFG++  V +    L  ++   W  APE++ G +  ++ 
Sbjct: 139 IHRDIKAANILLDSENVVKLADFGVSTKVNNTAMTLAGSL--NWM-APEII-GNRGASTL 194

Query: 193 IDIWSVGVIFAELMLRIPYLPGQNDID 219
            DIWS+G    EL+   P  P  N ID
Sbjct: 195 SDIWSLGATVVELLTGNP--PFHNLID 219

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 98.2 bits (243), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 82/308 (26%), Positives = 147/308 (47%), Gaps = 44/308 (14%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFK------------DGLDMSAIREVKY 64
           G  +G G+   V +   ++ G+Q AVK I  S F             D L     RE+  
Sbjct: 20  GSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLPYGIEREIII 79

Query: 65  LQEIQHDNVIELVDIFMAYDNLNLVLEFL-PSDLEVIIKDRSILFTPADIKSWMLMTLRG 123
           ++ + H NV+ L D++    +L +VLE++   +L  ++ +R  L     ++ +  + + G
Sbjct: 80  MKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIII-G 138

Query: 124 VHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELL 183
           + +CH   I+HRDLKP NLLL     +K+ADFG+A A+ S  ++L ++  +  Y APE++
Sbjct: 139 ISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMA-ALESKDKLLETSCGSPHYAAPEIV 197

Query: 184 FGAKHYTSAIDIWSVGVI-FAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF 242
            G  ++    D+WS GVI +A L  R+P+     +I  + +  ++               
Sbjct: 198 SGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQS--------------- 242

Query: 243 GSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPP 302
               K ++   P  DE+       S  A + +  +LT++P++R    E L+    ++ P 
Sbjct: 243 ---GKFEM---PGDDEI-------SSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPS 289

Query: 303 PSDPSEIK 310
             D   I+
Sbjct: 290 IKDSKSIR 297

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 97.8 bits (242), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 85/308 (27%), Positives = 143/308 (46%), Gaps = 44/308 (14%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFK------------DGLDMSAIREVKY 64
           G+ +G G+   V L     TG+  AVK I  S F             D L     RE+  
Sbjct: 22  GETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIII 81

Query: 65  LQEIQHDNVIELVDIFMAYDNLNLVLEFL-PSDLEVIIKDRSILFTPADIKSWMLMTLRG 123
           ++ + H NV+ L D++    +L +VLE++   +L  ++  R  L     ++ +  + + G
Sbjct: 82  MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIII-G 140

Query: 124 VHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELL 183
           + +CH   I+HRDLKP NLLL     IK+ADFG+A A+ S  ++L ++  +  Y APE++
Sbjct: 141 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCGSPHYAAPEIV 199

Query: 184 FGAKHYTSAIDIWSVGVI-FAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF 242
            G  ++    D+WS GVI +A L  R+P+     +I  + +  ++               
Sbjct: 200 SGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQS--------------- 244

Query: 243 GSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPP 302
           G Y        P  DE+       S  A + +  +LT+ P++R    E L+    ++ P 
Sbjct: 245 GKYE------IPGEDEI-------SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPS 291

Query: 303 PSDPSEIK 310
             D   I+
Sbjct: 292 IKDSKSIR 299

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 97.4 bits (241), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 124/268 (46%), Gaps = 35/268 (13%)

Query: 6   TTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIK------------------- 46
           T  +T   + KG ++G G++  VYLG    TG  +AVK+++                   
Sbjct: 407 TKVVTPKSWLKGARIGSGSFGSVYLGMNAHTGELMAVKQVELEPTTVMASSDDKKSHPSS 466

Query: 47  -------TSEFKDGLDMSAIREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEV 99
                  T   +DG   S+ + +  L+E+ H+N++          NLN+ LE++P     
Sbjct: 467 NAVVKKLTDPPQDGGRASSTK-MNLLKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVS 525

Query: 100 IIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLAR 159
            + +    F    +K++   TL G+ + HR  I+HRD+K  NLL+   G +K+ DFG+++
Sbjct: 526 SMLNSYGPFEEPLVKNFTRQTLVGLTYLHRKNIIHRDIKGANLLIDIKGSVKITDFGISK 585

Query: 160 AVPSPHEMLTSNVVTR---WYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQN 216
            +   ++        +   ++ APE++      T   DIWSVG +  E+       P   
Sbjct: 586 KLSPLNKKQNKRASLQGSVYWMAPEVVKQVV-TTEKADIWSVGCVVVEMFTGKHPFP--- 641

Query: 217 DIDQMEVTFRALGTPTDKEWPEVSSFGS 244
           D  QM+  F+ +GT T  E P  +S G+
Sbjct: 642 DFSQMQAIFK-IGTNTIPELPSWASDGA 668

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 96.7 bits (239), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 113/214 (52%), Gaps = 13/214 (6%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSA-IREVKYLQE 67
           I    Y   + +G G Y VVY   K+ T +  A+K+I   EF+D  +++  + E+  L+ 
Sbjct: 5   IAHGTYALKQVIGRGAYGVVYRAVKRGTNKPCAIKQI---EFEDESELNEHMLEIDLLKN 61

Query: 68  IQHDNVIELVDIFMAYDNLNLVLEFLP-SDLEVIIKDRSILFTPADIKSWMLMTLRGVHH 126
           ++H N++E          L ++LE+     L  I+K   +L    D  +++  TL G+ +
Sbjct: 62  LRHQNIVEYRGFIQKAHELYIILEYCARGSLRDILKHGPLL--EDDTVNYVTQTLYGLQY 119

Query: 127 CHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGA 186
            H   ++HRD+K  NLLL+ +G++K+ADFG++  +   + M  +   +  + APE++ G 
Sbjct: 120 LHEQGVIHRDIKAANLLLTEEGIVKLADFGVSTRI---NRMAMTYAGSPNWMAPEVMTGQ 176

Query: 187 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQ 220
              T + DIWS+G    EL+   P  P  N +++
Sbjct: 177 GASTVS-DIWSLGATVVELLTGNP--PFHNLVNE 207

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 96.7 bits (239), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 114/229 (49%), Gaps = 19/229 (8%)

Query: 19  KVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELVD 78
           K+G+G    VY   +  T   +A+K++     K       I E+  ++  +H+N++  +D
Sbjct: 688 KIGQGASGGVYTAYEIGTNASVAIKQMNLE--KQPKKELIINEILVMKGSRHNNIVNFID 745

Query: 79  IFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLK 138
            ++   +L +++E++       +    IL T   I +    TLRG+H  H   ++HRD+K
Sbjct: 746 SYLLKGDLWVIMEYMEGGSLTDVVTHCIL-TEGQIAAVSRETLRGLHFLHSKGVIHRDIK 804

Query: 139 PNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSV 198
            +N+LLS DG IK+ DFG    +   +   T+ V T ++ APE++   K Y   +DIWS+
Sbjct: 805 SDNILLSMDGNIKLTDFGFCAQINETNLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIWSL 863

Query: 199 GVIFAELM-LRIPYLPGQNDIDQMEVTFRAL------GTPTDKEWPEVS 240
           G++  E++    PYL         E   RAL      GTP  K+   +S
Sbjct: 864 GIMIIEMIEGEPPYL--------NETPLRALYLIATNGTPKLKDADSLS 904

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 95.9 bits (237), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 83/308 (26%), Positives = 142/308 (46%), Gaps = 51/308 (16%)

Query: 3   TEITTPIT-QTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIRE 61
           TEI +P   +++Y    K+G+G    VY+     +   +A+K++     K       + E
Sbjct: 608 TEICSPGDPKSKYRDLIKIGQGASGGVYIAHDTESEDSVAIKQMNLE--KQPKKELILNE 665

Query: 62  VKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLP--SDLEVIIKDRSILFTPADIKSWMLM 119
           +  ++E +H N++  +D ++A  +L +V+E++   S  +V+      L +   I +    
Sbjct: 666 ILVMRESKHSNIVNFIDSYLAKGDLWIVMEYMEGGSLTDVVTH---CLLSEGQIGAVCRE 722

Query: 120 TLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRA 179
           TL+G+   H   +LHRD+K +N+LLS  G IK+ DFG    +   +   T+ V T ++ A
Sbjct: 723 TLKGLQFLHSKGVLHRDIKSDNILLSLKGNIKLTDFGFCAQINENNLKRTTMVGTPYWMA 782

Query: 180 PELLFGAKHYTSAIDIWSVGVIFAELML-RIPYLPGQNDIDQMEVTFRAL------GTPT 232
           PE++   K Y   +DIWS+G++  E++    PYL         E   RAL      GTP 
Sbjct: 783 PEVV-SRKEYGPKVDIWSLGIMIIEMIEGEPPYL--------NETPLRALYLIATNGTPK 833

Query: 233 DKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECL 292
            KE PE                          A S+    F+   L ++P +R  A E L
Sbjct: 834 LKE-PE--------------------------ALSDTLTKFLDWCLKVDPSERATATELL 866

Query: 293 ESEYFKEM 300
           +  +  E+
Sbjct: 867 DDPFITEI 874

>Kwal_55.20326
          Length = 750

 Score = 95.5 bits (236), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 125/274 (45%), Gaps = 43/274 (15%)

Query: 3   TEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIK---------------- 46
           T+I TP     + KG ++G G++  VYLG    TG  +AVK+++                
Sbjct: 450 TKIATP---KNWLKGARIGSGSFGSVYLGMNAQTGELMAVKQVELQPTAVAAGVVSVPDE 506

Query: 47  -TSEFKDGLDMSAIR---------------EVKYLQEIQHDNVIELVDIFMAYDNLNLVL 90
              ++    + SA++               E+  L+E+QH+N++          NLN+ L
Sbjct: 507 VKKQYNQNANGSAVKNSSQVHRKMVDALQHEMGLLKELQHENIVTYYGSSQEGGNLNIFL 566

Query: 91  EFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVI 150
           E++P      + +    F    I+++    L G+ + HR  I+HRD+K  N+L+   G +
Sbjct: 567 EYVPGGSVSSMLNSYGPFEEPLIRNFTRQILIGLSYLHRKDIIHRDIKGANILIDIKGCV 626

Query: 151 KVADFGLARAVPSPHEMLTSNVVTR---WYRAPELLFGAKHYTSAIDIWSVGVIFAELML 207
           K+ DFG+++ +   ++        +   ++ APE++      T   DIWSVG +  E+  
Sbjct: 627 KITDFGISKKLSPLNQQQNKRASLQGSVYWMAPEVVKQVV-TTKKADIWSVGCVIIEMFT 685

Query: 208 RIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSS 241
                P   D  QM+  F+ +GT T  + P  SS
Sbjct: 686 GKHPFP---DFSQMQAIFK-IGTNTFPDSPSWSS 715

>ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH]
           (797020..798951) [1932 bp, 643 aa]
          Length = 643

 Score = 95.1 bits (235), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 116/219 (52%), Gaps = 11/219 (5%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKT-SEFKDGLDMSA-IREV--KYLQEIQHDNVIE 75
           +G+GT+  V       T   +AVK +K+ +E+ +   M A I E+  K +  +   + + 
Sbjct: 279 LGQGTFGQVVKCQNMQTKEIVAVKVVKSKTEYLNQSIMEAKILELLNKRIDPLNQHHFLR 338

Query: 76  LVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPAD-IKSWMLMTLRGVHHCHRNFILH 134
           L D F+  ++L LV E L ++L  ++K         + IK++    L  +     + ++H
Sbjct: 339 LHDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSMNLIKNFCKQLLDSLCVLKESKLIH 398

Query: 135 RDLKPNNLLL-SPDG-VIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192
            DLKP N+LL SPD   +KV DFG A         + + + +R+YRAPE+L G   Y+++
Sbjct: 399 CDLKPENVLLVSPDRPELKVIDFGSA---CEEARTVYTYIQSRFYRAPEVLMGIP-YSTS 454

Query: 193 IDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTP 231
           ID+WS G I AEL L IP  PG ++ +QM      LG P
Sbjct: 455 IDMWSFGCIVAELFLGIPVFPGASEFNQMTRIVEMLGVP 493

>Scas_618.8
          Length = 427

 Score = 94.4 bits (233), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 138/298 (46%), Gaps = 43/298 (14%)

Query: 7   TPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR------ 60
           + +T+++Y  GK +G G++ VV   TK+S   ++A+K +     K  L+ + ++      
Sbjct: 20  SKVTKSDYEFGKTLGAGSFGVVREATKKSNNEEVAIKIL----LKKALEGNQVQLQMLYD 75

Query: 61  EVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIKSWML 118
           E+  L+++ H N++E  + F   D + +V +        + IIK     F+  D    ++
Sbjct: 76  ELTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGR--FSEDDAVKILI 133

Query: 119 MTLRGVHHCHRNFILHRDLKPNNLLL---SPDGVIKVADFGLARAVPSPHEMLTSNVVTR 175
             L  V + H   I+HRDLKP NLL      D  + +ADFG+A+ +    +++     + 
Sbjct: 134 QILSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSL 193

Query: 176 WYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKE 235
            Y APE+L    H     DIWS+GVI   L      L G          + A    T + 
Sbjct: 194 GYVAPEVLTVDGH-GKPCDIWSIGVITYTL------LSG----------YAAFVAETVEG 236

Query: 236 WPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLE 293
           + +  + G Y     +  P  D +       S++A NF+   L +NP+KR  A E L+
Sbjct: 237 FLDECTSGDYP--VKFHKPYWDNI-------SDDAKNFILKALDLNPQKRPTATELLD 285

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 94.4 bits (233), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/292 (29%), Positives = 126/292 (43%), Gaps = 35/292 (11%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVK-EIKTSEFKDGLDMSAI-REVKYLQ 66
           + + +Y  GK +G GT+ VV       TG  +AVK  IK +   + + + A+  E+  LQ
Sbjct: 32  VNKKKYVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQ 91

Query: 67  EIQHDNVIELVDIFMAYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIKSWMLMTLRGV 124
            + H N++   D F + D   ++ +        + I+K     FT  D    ++  L  V
Sbjct: 92  RLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGK--FTEEDAVRILVEILSAV 149

Query: 125 HHCHRNFILHRDLKPNNLLL---SPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPE 181
            + H   I+HRDLKP NLL    S +  + VADFG+A+ + S  E+L     +  Y APE
Sbjct: 150 KYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPE 209

Query: 182 LLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSS 241
           +L    H     DIWS+GVI   L+                  FRA           V  
Sbjct: 210 VLTQDGH-GKPCDIWSIGVITYTLLCGYS-------------AFRA---------ERVQD 246

Query: 242 FGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLE 293
           F        YP   +   R  + + S  A  F+   L ++P KR  A E LE
Sbjct: 247 FLDECTTGEYP---VKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLE 295

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 94.7 bits (234), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 111/201 (55%), Gaps = 9/201 (4%)

Query: 11  QTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQH 70
           +  Y   + +G+G Y VVY    ++T + IA+K I+    +       + E+  L+ ++H
Sbjct: 16  RKHYALKQVIGKGAYGVVYKAVNRATDQVIAIKAIEYENEE--ELHEHMLEIDLLKNLKH 73

Query: 71  DNVIELVDIFMAYDNLNLVLEF-LPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHR 129
           +N+++      +   L ++LE+ +   L  +IK  ++  + A  K+++  TLRG+ + H 
Sbjct: 74  ENIVKYHGFIQSSHELYILLEYCIRGSLRDLIKKEAL--SEAKAKTYVRQTLRGLQYLHD 131

Query: 130 NFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHY 189
             ++HRD+K  NLLL+ +GV+K+ADFG++  V   + M  +   +  + APE++ G K  
Sbjct: 132 QGVIHRDIKAANLLLTENGVVKLADFGVSTRV---NNMAMTYAGSPNWMAPEVMLG-KGA 187

Query: 190 TSAIDIWSVGVIFAELMLRIP 210
           ++  DIWS+G    EL+   P
Sbjct: 188 STVSDIWSLGATVVELLTGNP 208

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 94.4 bits (233), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 110/210 (52%), Gaps = 12/210 (5%)

Query: 7   TPITQT-----EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIRE 61
           TPI +      +Y   + +G G+Y VVY    + T + +A+KE+     ++  D+ A  E
Sbjct: 13  TPIQRASEKSVQYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMA--E 70

Query: 62  VKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMT 120
           +  L+ + H+N+++          L ++LE+  +  L  +I   S   +  + K+++  T
Sbjct: 71  ISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQT 130

Query: 121 LRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAP 180
           L G+ + H   ++HRD+K  N+LLS D  +K+ADFG++  V S    L     T  + AP
Sbjct: 131 LLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAG---TLNWMAP 187

Query: 181 ELLFGAKHYTSAIDIWSVGVIFAELMLRIP 210
           E+L G +  ++  DIWS+G    E++ + P
Sbjct: 188 EIL-GNRGASTLSDIWSLGATVVEMLTKNP 216

>Kwal_23.3590
          Length = 499

 Score = 93.6 bits (231), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 90/320 (28%), Positives = 136/320 (42%), Gaps = 59/320 (18%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIRE-VKYLQEIQHDN 72
           Y  GK++G G YA+V     + +G  +AVK        D       RE  K L  IQH N
Sbjct: 186 YIAGKELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTKQFREETKILMSIQHKN 245

Query: 73  VIELVDIFM-----AYDNLNLVLEFLPSDLEVIIK-DRSILFTPADIKSWMLMTLRGVHH 126
           +++L+D F+     A     LVLE + SD E+  +  R       +  +     L G+ +
Sbjct: 246 IVKLIDRFVEPVSKAQIQTFLVLEKV-SDGELFDRIVRKTRLREDETNAIFKQILNGLRY 304

Query: 127 CHRNFILHRDLKPNNLLLS-------------------PDGVIKVADFGLARAVPSPHEM 167
            H   I+HRD+KP N+LLS                    D  IK+ADFGLA+ +    EM
Sbjct: 305 LHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADFGLAKFIG---EM 361

Query: 168 LTSNVV--TRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTF 225
             +N +  T  Y APE+L     YTS +D+WS GV+    +   P    Q          
Sbjct: 362 QFTNTLCGTPSYVAPEVL-TKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQ---------- 410

Query: 226 RALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKR 285
             L  P+ KE      F  Y+       P  D++        ++ L+ +  +L +NP  R
Sbjct: 411 --LAPPSMKEQILNGKFAFYS-------PYWDDI-------DDSCLHLISNLLVVNPAYR 454

Query: 286 WNAIECLESEYFKEMPPPSD 305
           ++  + +   +F    P  D
Sbjct: 455 FDVQKTINHPWFSNTIPEPD 474

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 93.6 bits (231), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 104/219 (47%), Gaps = 7/219 (3%)

Query: 10  TQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKT----SEFKDGLDMSAIREVKYL 65
           T  +++  +++G G+Y+ VY    +STG+  A+K        SE K          +  L
Sbjct: 6   TPQDFSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLL 65

Query: 66  QEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVH 125
               H  +I+L   F   +NL  VL+F P    + +      F  A  K +M   +  + 
Sbjct: 66  AHGNHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLIDALE 125

Query: 126 HCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEM--LTSNVVTRWYRAPELL 183
           + H   ++HRDLKP NLLLS +G + + DFG+A  + +   +   +S V T  Y +PELL
Sbjct: 126 YIHGCKVVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFVGTAEYVSPELL 185

Query: 184 FGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQME 222
              K    + DIW+VG +  +     P   G+N++   E
Sbjct: 186 LQNKSNFCS-DIWAVGCMLYQFTQGTPPFRGENELAAFE 223

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 93.2 bits (230), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 82/296 (27%), Positives = 132/296 (44%), Gaps = 59/296 (19%)

Query: 3   TEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSA---- 58
           T+I TP     + KG ++G G++  VYLG    TG  +AVK++   E K  +  +A    
Sbjct: 381 TKIVTP---KNWLKGARIGSGSFGTVYLGMNAQTGELMAVKQV---EIKPAIAATADANV 434

Query: 59  -------------------------IREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFL 93
                                      E+  L+E+QH+N++          NLN+ LE++
Sbjct: 435 EDKNAEKNVAKAPSTNLHRKMIDALQHEMSLLKELQHENIVTYYGSSQEGGNLNIFLEYV 494

Query: 94  PSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVA 153
           P      +      F    I ++    L GV + HR  I+HRD+K  N+L+   G +K+ 
Sbjct: 495 PGGSVSSMLSNYGPFEEPLIVNFTRQILIGVAYLHRKNIIHRDIKGANILIDIKGCVKIT 554

Query: 154 DFGLARAVPSP-----HEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELML- 207
           DFG+++ + SP      +  TS   + ++ +PE++      TS  DIWS G +  E+   
Sbjct: 555 DFGISKKL-SPLNQENQDKRTSLQGSVYWMSPEVV-KQTATTSKADIWSTGCVVIEMFTG 612

Query: 208 RIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRF 263
           + PY     D  QM+  F+ +GT      PE+ S+ S        P   D +RK F
Sbjct: 613 KHPY----PDFSQMQALFK-IGTNV---TPEIPSWAS--------PQGRDFIRKTF 652

>Scas_613.5
          Length = 517

 Score = 93.2 bits (230), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 86/316 (27%), Positives = 134/316 (42%), Gaps = 61/316 (19%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIRE-VKYLQEIQHD 71
           +Y  GK +G G YA V  G  + TG+ +AVK     +  D       RE    L  I H 
Sbjct: 203 KYVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFREETNILMRIHHP 262

Query: 72  NVIELVDIFMAYDNLNLVLEFLPSD-------LEVIIKDRSILFTPADIKSWMLMTLRGV 124
           N++ L+D F+   + + + ++L  D        E I+K         + K+     L G+
Sbjct: 263 NIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVK--KTCLRQDETKAIFNQILMGL 320

Query: 125 HHCHRNFILHRDLKPNNLLLS-------------------PDGVIKVADFGLARAVPSPH 165
            H H+  I+HRD+KP N+LL+                    D  +K+ADFGLA+      
Sbjct: 321 KHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFGLAKFTG--- 377

Query: 166 EMLTSNVV--TRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEV 223
           EM  +N +  T  Y APE+L   K YTS +D+WS GVI    +   P    Q        
Sbjct: 378 EMQFTNTLCGTPSYVAPEVL-TKKGYTSKVDMWSAGVILYVCLCGFPPFSEQ-------- 428

Query: 224 TFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPK 283
               LG P+ KE    + F  Y        P  D +        +N L+ +  +L ++  
Sbjct: 429 ----LGPPSLKEQILQAKFAFYT-------PYWDNI-------DDNVLHLISHLLVLDAD 470

Query: 284 KRWNAIECLESEYFKE 299
            R++  + +   +F +
Sbjct: 471 ARYSVEDTINHPWFND 486

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 92.8 bits (229), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 113/222 (50%), Gaps = 31/222 (13%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMS-------AIREVKYLQEIQHDN 72
           +G G Y  V L     TG  +A+K +   E + G  +          +E++ ++   H+N
Sbjct: 56  LGNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKVENPRVNQEIEVMKRCHHEN 115

Query: 73  VIELVDIFMAYDNLN--LVLEFLP---------SDLEVIIKDRSILFTPADIKSWMLMTL 121
           V+EL +I    ++    LVLE+           + +E+     SIL T    +  +L  +
Sbjct: 116 VVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVGPSIL-TFQQSRKVVLDVV 174

Query: 122 RGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARA-------VPSPHEML--TSNV 172
            G+ + H   I HRD+KP+NLL+S +G +K++DFG+A +       + S HE L  +  +
Sbjct: 175 SGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTATGSTNIQSSHEQLLKSRAL 234

Query: 173 VTRWYRAPELLFGAKHY--TSAIDIWSVGV-IFAELMLRIPY 211
            T  + APEL    K Y  +SAIDIWS+GV I+  L  ++P+
Sbjct: 235 GTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPF 276

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 92.8 bits (229), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 133/296 (44%), Gaps = 46/296 (15%)

Query: 12  TEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHD 71
           T+Y    K+G+G    VY   +  T   +A+K++     K       I E+  ++  +H 
Sbjct: 618 TKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLE--KQPKKELIINEILVMKGSKHP 675

Query: 72  NVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNF 131
           N++  +D ++   +L +++E++       +    IL T   I +    TL G+   H   
Sbjct: 676 NIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCIL-TEGQIGAVCRETLSGLEFLHSKG 734

Query: 132 ILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTS 191
           +LHRD+K +N+LLS +G IK+ DFG    +   +   T+ V T ++ APE++   K Y  
Sbjct: 735 VLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVV-SRKEYGP 793

Query: 192 AIDIWSVGVIFAELML-RIPYLPGQNDIDQMEVTFRAL------GTPTDKEWPEVSSFGS 244
            +DIWS+G++  E++    PYL         E   RAL      GTP  KE   +SS   
Sbjct: 794 KVDIWSLGIMIIEMIEGEPPYL--------NETPLRALYLIATNGTPKLKEPENLSS--- 842

Query: 245 YNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEM 300
                         L+K           F+   L + P+ R +A E L  EY  E+
Sbjct: 843 -------------SLKK-----------FLDWCLCVEPEDRASATELLHDEYITEI 874

>Kwal_23.6325
          Length = 1542

 Score = 92.8 bits (229), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 134/294 (45%), Gaps = 42/294 (14%)

Query: 14   YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDM-SAIRE-VKYLQEIQHD 71
            + K + VG G +  V+      TG  +AVKEIK  + K    +  AI+E +  L+ + H 
Sbjct: 1249 WQKRQFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLNHP 1308

Query: 72   NVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNF 131
            NV++   + +  D +NL +E+        + +   +      + + L  L G+ + H++ 
Sbjct: 1309 NVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSS 1368

Query: 132  ILHRDLKPNNLLLSPDGVIKVADFGLARAVPS------------PHEMLTSNVVTRWYRA 179
            ++HRD+KP N+LL  +GVIK  DFG AR++ +              + + S + T  Y +
Sbjct: 1369 VVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMS 1428

Query: 180  PELLFGAKHYT-SAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPE 238
            PE + GAK     + DIWS+G +  E+                 VT R      D EW  
Sbjct: 1429 PESITGAKKGKFGSGDIWSLGCVILEM-----------------VTGRRPWFNLDNEWAI 1471

Query: 239  VSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECL 292
            +    + +  Q+   P+ +EL       S   ++F+   L  +P KR  A+E L
Sbjct: 1472 MYHVAAGHVPQL---PTKEEL-------SPQGIDFLLRCLKQDPNKRSTAMELL 1515

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 92.8 bits (229), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 141/297 (47%), Gaps = 36/297 (12%)

Query: 14   YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDM-----SAIR-EVKYLQE 67
            + KG+ +G+G++  VYL    +TG  +AVK+++  ++    ++      A++ EV  L++
Sbjct: 1151 WMKGEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKD 1210

Query: 68   IQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHC 127
            + H N+++ +   +  +  +L LE++       +      F    I+      L G+ + 
Sbjct: 1211 LDHLNIVQYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGRFDEKLIRHLNTQVLSGLKYL 1270

Query: 128  HRNFILHRDLKPNNLLLSPDGVIKVADFGLARA---VPSPHEMLTSNVVTRWYRAPELLF 184
            H   ILHRD+K +NLLL  DG+ K++DFG+++    + S  +M     V  ++ APE++ 
Sbjct: 1271 HSKGILHRDMKADNLLLDEDGICKISDFGISKKSKNIYSNSDMTMRGTV--FWMAPEMVD 1328

Query: 185  GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGS 244
              + Y++ +DIWS+G +  E+        G+     +EV               V++   
Sbjct: 1329 TKQGYSAKVDIWSLGCVVLEM------FAGKRPWSNLEV---------------VAAMFQ 1367

Query: 245  YNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMP 301
              K +  PP   D ++      S    +F+     ++P+KR  A + LE  + K  P
Sbjct: 1368 IGKSKSAPPIPDDTIQ----LISSKGKDFLSKCFEIDPEKRPTADDLLEHSFSKVDP 1420

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 92.8 bits (229), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 107/204 (52%), Gaps = 11/204 (5%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKD------GLDMSAIREVKYLQEIQH 70
           GK +G+G+   V L     +G+  A+K +     +        L     RE+  ++ I H
Sbjct: 64  GKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGIEREIIIMKLITH 123

Query: 71  DNVIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHR 129
            N++ L +++     L LVLE++   +L   +  R  L     I  +    ++GV +CH 
Sbjct: 124 PNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIH-YFKQIVQGVSYCHN 182

Query: 130 NFILHRDLKPNNLLLS-PDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKH 188
             I HRDLKP NLLL   +  +K+ADFG+A A+ + + +L ++  +  Y +PE++ G K+
Sbjct: 183 FNICHRDLKPENLLLDKKNKTVKIADFGMA-ALETTNRLLETSCGSPHYASPEIVMGQKY 241

Query: 189 YTSAIDIWSVGVI-FAELMLRIPY 211
           + S  D+WS G+I FA L   +P+
Sbjct: 242 HGSPSDVWSCGIILFALLTGHLPF 265

>Scas_651.3
          Length = 793

 Score = 92.4 bits (228), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 120/235 (51%), Gaps = 39/235 (16%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKT-SEFKDGLDMSAIREVKYLQEIQHD------- 71
           +G+GT+  V      +T   +AVK IK+ SE+ +     +I E K L+ I +        
Sbjct: 386 LGQGTFGQVVKCQNLTTKEILAVKVIKSRSEYLN----QSITEAKILELINNKIDPENKH 441

Query: 72  NVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSI---------LFTPADIKSWMLMTLR 122
           + + + D F+  ++L LV E L ++L  ++K             +FT   ++S  ++   
Sbjct: 442 HFLRMYDSFIHKNHLCLVFELLSNNLYELLKQNQFHGLSIQLIRIFTKQMLESLCVLKDS 501

Query: 123 GVHHCHRNFILHRDLKPNNLLL-SPDG-VIKVADFGLARAVPSPHEMLT--SNVVTRWYR 178
            + HC        DLKP N+LL SPD   +K+ DFG      S  E  T  + + +R+YR
Sbjct: 502 KLIHC--------DLKPENILLCSPDKPALKIIDFG-----SSCEETRTVYTYIQSRFYR 548

Query: 179 APELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTD 233
           APE++ G   Y+++ID+WS+G I AEL L IP  PG ++ +Q+      LG P +
Sbjct: 549 APEIILGIP-YSTSIDMWSLGCIVAELFLGIPIFPGSSEYNQLTRIVDTLGYPPN 602

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 92.4 bits (228), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 107/215 (49%), Gaps = 11/215 (5%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEF--KDGLDMSAIRE--VKYLQEIQHDNV 73
           +++G G+Y+ VY   ++S+  Q A+K         ++ +    I +  +  L +  H  +
Sbjct: 14  EELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTLNLLGQANHPGI 73

Query: 74  IELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFIL 133
           I+L   F   +NL  V++  P    + +  R  +F+ A  + +M   +  V + H   ++
Sbjct: 74  IKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLVDTVEYIHSMGVI 133

Query: 134 HRDLKPNNLLLSPDGVIKVADFGLARAVPSP------HEMLTSNVVTRWYRAPELLFGAK 187
           HRDLKP N+LL  +G + +ADFG A  V          +  TS V T  Y +PELL   K
Sbjct: 134 HRDLKPENVLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFVGTAEYVSPELLLENK 193

Query: 188 HYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQME 222
            Y S+ D+W++G +  + +   P   GQN+++  E
Sbjct: 194 SYYSS-DVWALGCMLYQFLQGTPPFRGQNEMETFE 227

>CAGL0I05896g 560169..562505 some similarities with sp|P14680
           Saccharomyces cerevisiae YJL141c YAK1 ser/thr protein
           kinase, hypothetical start
          Length = 778

 Score = 92.4 bits (228), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/225 (32%), Positives = 123/225 (54%), Gaps = 23/225 (10%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKT-SEFKDGLDMSAIREVKYLQ----EIQHDN-- 72
           +G+GT+  V       T   IAVK +K+ SE+ +     +I E K L+    +I  +N  
Sbjct: 367 LGQGTFGQVVKCQNLQTKEIIAVKVVKSRSEYLN----QSISEAKILELLNEKIDPNNKH 422

Query: 73  -VIELVDIFMAYDNLNLVLEFLPSDL-EVIIKDRSILFTPADIKSWMLMTLRGVHHCHRN 130
             + + D F+  ++L LV E L ++L E++ +++    +   I+++ +  L  +     +
Sbjct: 423 HFLRMHDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTIQILDSLCVLKDS 482

Query: 131 FILHRDLKPNNLLL-SPDGV-IKVADFGLARAVPSPHEMLT--SNVVTRWYRAPELLFGA 186
            ++H DLKP N+LL SPD   +KV DFG      S  E  T  + + +R+YRAPE++ G 
Sbjct: 483 KLIHCDLKPENILLCSPDKPDLKVIDFG-----SSCEETRTVYTYIQSRFYRAPEIILGI 537

Query: 187 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTP 231
             Y+++ID+WS+G I AEL L IP  PG ++ +Q+      LG P
Sbjct: 538 P-YSTSIDMWSLGCIVAELFLGIPIFPGSSEFNQLTRIITTLGYP 581

>Scas_700.54
          Length = 698

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 133/290 (45%), Gaps = 42/290 (14%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELVDI 79
           VG+G +A V    ++STG+  AVK I   +    ++    RE++ LQ++ H  ++ L   
Sbjct: 229 VGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNME-GVSRELEVLQQLDHPRIVRLKGF 287

Query: 80  FMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLK 138
           +   D+  +V+EF+   DL   +     +   A  K      L  V + H   I HRDLK
Sbjct: 288 YEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAG-KEISRQILEAVKYIHSKGISHRDLK 346

Query: 139 PNNLLLSPDG--VIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGA-------KHY 189
           P+N+L+  D   ++K+ DFGLA+ V      + +   T  Y APE++ G          Y
Sbjct: 347 PDNILIEQDDPVLVKITDFGLAK-VQGNGSFMKTFCGTLAYVAPEVIGGKGETNEERNEY 405

Query: 190 TSAIDIWSVG-VIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKL 248
           +S +D+WS+G +++  L   +P+                 G+  ++ + ++S  GSY   
Sbjct: 406 SSLVDMWSMGCLVYVILTGHLPF----------------SGSTQEQLYKQISR-GSY--- 445

Query: 249 QIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFK 298
             +  P  D         S+ A +F+  +L +NP  R  A   LE  + K
Sbjct: 446 --HEGPLKD------FRISDEARSFIDSLLQVNPGNRLTAARALEHPWIK 487

>Scas_477.5
          Length = 703

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/328 (24%), Positives = 138/328 (42%), Gaps = 71/328 (21%)

Query: 6   TTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKE--------------------- 44
           T  +T   + KG ++G G++  VYLG    TG  +AVK+                     
Sbjct: 398 TKMVTPKSWLKGARIGSGSFGTVYLGMNAQTGELMAVKQVGITAPPTPSAVVDKSKNSNS 457

Query: 45  -----------IKTSEFKDGLDM------SAIREVKYLQEIQHDNVIELVDIFMAYDNLN 87
                      I   + K+  +M      +   E+  L+E+ H+N++          NLN
Sbjct: 458 NGSGKNNSNGKIANDQAKNSPNMHKKMVDALQHEMNLLKELHHENIVTYYGSSQEGPNLN 517

Query: 88  LVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPD 147
           + LE++P      + +    F  + I +++   L GV + H   I+HRD+K  N+L+   
Sbjct: 518 IFLEYVPGGSVSSMLNNYGPFEESLIVNFIRQVLIGVAYLHNKNIIHRDIKGANILIDTK 577

Query: 148 GVIKVADFGLARAVP--SPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAEL 205
           G +K+ DFG+++ +   S  +   S   + ++ APE++      T   DIWS G +  E+
Sbjct: 578 GCVKITDFGISKKLSPLSKQDKRASLQGSVYWMAPEVV-KQTATTEKADIWSTGCVVIEM 636

Query: 206 MLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIA 265
                  P   D  QM+  F+ +GT T    PEV S+                       
Sbjct: 637 FTGKHPFP---DFSQMQTIFK-IGTNTT---PEVPSW----------------------- 666

Query: 266 ASENALNFMCGMLTMNPKKRWNAIECLE 293
           AS+   +F+     +N KKR +A+E L+
Sbjct: 667 ASDLGKDFLSKTFEVNYKKRLSALEILQ 694

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 117/221 (52%), Gaps = 29/221 (13%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSE-----------------FKDGLDMSAI 59
            K +  GT A + +  K++  R++  +++KT+                   K+G D SA+
Sbjct: 110 AKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSGTDSKDSSNREDPIKNGTD-SAL 168

Query: 60  ------REVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPAD 112
                 RE+  ++ I H NV+ L++++     L LVLE++   +L   +  +  L  P  
Sbjct: 169 NPYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEA 228

Query: 113 IKSWMLMTLRGVHHCHRNFILHRDLKPNNLLL-SPDGVIKVADFGLARAVPSPHEMLTSN 171
           +  +    ++GV +CH   I HRDLKP NLLL   + VIK+ADFG+A A+  P+++L ++
Sbjct: 229 VH-YFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMA-ALELPNKLLETS 286

Query: 172 VVTRWYRAPELLFGAKHYTSAIDIWSVGVI-FAELMLRIPY 211
             +  Y +PE++ G  ++    D+WS G+I FA L   +P+
Sbjct: 287 CGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPF 327

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 91.7 bits (226), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 88/304 (28%), Positives = 134/304 (44%), Gaps = 61/304 (20%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIRE-VKYLQEIQHD 71
           +Y  GK +G G YA+V     ++TG  +AVK     +  D       RE    L +I H 
Sbjct: 192 KYLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHHP 251

Query: 72  NVIELVDIFM-----AYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIKSWMLMTLRGV 124
           N++ L+D F+           LVLE +      + I+K  S+     + K+     L G+
Sbjct: 252 NIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSL--PQEESKAIFKQILTGL 309

Query: 125 HHCHRNFILHRDLKPNNLLL------SPDG-------------VIKVADFGLARAVPSPH 165
            + H   I+HRD+KP N+LL      SPD               +K+ADFGLA+      
Sbjct: 310 KYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFTG--- 366

Query: 166 EMLTSNVV--TRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEV 223
           EM  +N +  T  Y APE+L   K YTS +D+WS GVI    +   P    Q        
Sbjct: 367 EMQFTNTLCGTPSYVAPEVLV-KKGYTSKVDLWSAGVILYVCLCGFPPFSDQ-------- 417

Query: 224 TFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPK 283
               LG P+ KE    + +  Y+       P  DE+        + AL+ +  +L ++P+
Sbjct: 418 ----LGPPSLKEQIMSAKYAFYS-------PYWDEI-------DDAALHLISNLLVLDPE 459

Query: 284 KRWN 287
            R++
Sbjct: 460 NRYD 463

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score = 91.7 bits (226), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 136/301 (45%), Gaps = 36/301 (11%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHD 71
           +Y +G  +GEG +A  +   K   G+  A K + K S   +      + E++  + ++H 
Sbjct: 89  DYHRGHFLGEGGFARCF-QMKDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKHP 147

Query: 72  NVIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRN 130
           N+++  D F    N+ ++LE  P+  +  +++ R  L  P +++  M+  +  + + H  
Sbjct: 148 NIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEP-EVRFCMIQIIGAIRYMHSR 206

Query: 131 FILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKH-- 188
            ++HRDLK  N+    +  +K+ DFGLA  + +  E   +   T  Y APE+L G KH  
Sbjct: 207 RVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTG-KHTG 265

Query: 189 YTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKL 248
           ++  +DIWS+GV+   L+   P              F+A    T  E  +   F      
Sbjct: 266 HSYEVDIWSIGVMLYALLFGKP-------------PFQAKEVETIYERIKCRDF------ 306

Query: 249 QIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSDPSE 308
            I+P              S +A N +  +L +NP  R +  E  ++ +F+   P   PS 
Sbjct: 307 -IFPADK---------PVSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRLPST 356

Query: 309 I 309
           I
Sbjct: 357 I 357

>CAGL0K01661g complement(146952..148400) some similarities with
           tr|Q12100 Saccharomyces cerevisiae YDL025c, hypothetical
           start
          Length = 482

 Score = 90.9 bits (224), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 105/206 (50%), Gaps = 15/206 (7%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTS-----EFKDGLDMSAIREVKYLQEIQHD 71
           GKK+GEG    V +  K+S G+Q AVK  +TS     E  +        E      + H 
Sbjct: 182 GKKIGEGASGSVSI-VKKSNGQQYAVKMFRTSPNSTQEQIEKYCKKITAEFCMGSTLHHA 240

Query: 72  NVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNF 131
           NVIE  DI    ++L +V+E+ P D   ++   ++  +P +I  +      GV++ H   
Sbjct: 241 NVIETFDIIREGNSLLMVMEYAPYDFFDLVMTNTM--SPDEISCYFKQLCHGVNYLHAMG 298

Query: 132 ILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEM----LTSNVVTRWYRAPELLFGAK 187
           I HRDLK +N +++ DG++K+ DFG A     P+E      T  V +  Y +PELL    
Sbjct: 299 IAHRDLKLDNCVVTNDGILKLIDFGSAVIFQYPYERNIVKATGIVGSDPYLSPELL-EMN 357

Query: 188 HYTSAI-DIWSVGVIFAELML-RIPY 211
           HY   + D+WS+ +I+  + L R P+
Sbjct: 358 HYDPRLADVWSLAIIYYCMTLKRFPW 383

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 90.1 bits (222), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 66/222 (29%), Positives = 110/222 (49%), Gaps = 21/222 (9%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR------EV 62
           + +++Y  GK +G GT+ VV      S+G  +AVK +     K  L   +++      E+
Sbjct: 41  VNKSDYIFGKTLGAGTFGVVRQARCISSGENVAVKIL----LKKALKGQSVQLQMLYDEL 96

Query: 63  KYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSI---LFTPADIKSWMLM 119
             LQ++ H N++   D F + +   +V + L +  E+   DR +    F   D    +  
Sbjct: 97  SILQQLNHPNIVRFKDWFESKEKFYIVTQ-LATGGELF--DRILEKGKFCEVDAVFIVKQ 153

Query: 120 TLRGVHHCHRNFILHRDLKPNNLLL---SPDGVIKVADFGLARAVPSPHEMLTSNVVTRW 176
            L+GV + H+  I+HRDLKP N+L    S D  + + DFG+A+ +   +E++     +  
Sbjct: 154 ILQGVQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMG 213

Query: 177 YRAPELLFGAKHYTSAIDIWSVGVIFAELMLRI-PYLPGQND 217
           Y APE+L  + H     DIWS+GVI   L+    P+L    D
Sbjct: 214 YVAPEVLTSSGH-GKPCDIWSIGVITYTLLCGYSPFLAESAD 254

>Scas_707.3
          Length = 1598

 Score = 90.9 bits (224), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 59/166 (35%), Positives = 93/166 (56%), Gaps = 8/166 (4%)

Query: 1   MSTEITTPITQT--EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSA 58
           ++T  T  +T T  +YT  K + +G Y  VYL  K+ TG   A+K +K S+      ++ 
Sbjct: 684 LATNQTKNLTPTIKDYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTN 743

Query: 59  IREVKYLQEIQHDN--VIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPAD-IK 114
           ++  + +  +Q D   V  L   F   +NL LV+E+LP  DL  +IK   + + P   +K
Sbjct: 744 VKSERAIMMVQSDKPYVARLFATFQNKENLFLVMEYLPGGDLATLIK--MMGYLPDQWVK 801

Query: 115 SWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARA 160
            ++   + GV   HRN+I+H DLKP+NLL+   G +K+ DFGL+RA
Sbjct: 802 QYLTEIIVGVDDMHRNWIIHHDLKPDNLLIDNLGHVKLTDFGLSRA 847

>Scas_668.22
          Length = 893

 Score = 90.5 bits (223), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 132/293 (45%), Gaps = 46/293 (15%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           YT   K+G+G    VY+  +  +   +A+K++     K       I E+  ++  +H N+
Sbjct: 611 YTNLVKIGQGASGGVYIANEIGSNESVAIKQMNLE--KQPKKELIINEILVMKGSRHPNI 668

Query: 74  IELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFIL 133
           +  +D ++   +L +++E++       +    IL T   I +    TL G+   H   +L
Sbjct: 669 VNFIDSYLLDGDLWVIMEYMEGGSLTDVVTHCIL-TEGQIGAVCRETLSGLQFLHSKGVL 727

Query: 134 HRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAI 193
           HRD+K +N+LLS  G IK+ DFG    +   +   T+ V T ++ APE++   K Y   +
Sbjct: 728 HRDIKSDNILLSISGDIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVV-SRKEYGPKV 786

Query: 194 DIWSVGVIFAELML-RIPYLPGQNDIDQMEVTFRAL------GTPTDKEWPEVSSFGSYN 246
           DIWS+G++  E++    PYL         E   RAL      GTP  KE   +S+     
Sbjct: 787 DIWSLGIMIIEMIEGEPPYL--------NETPLRALYLIATNGTPELKEPENLSAV---- 834

Query: 247 KLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
                       LR           NF+   L ++P++R +A + L   +  E
Sbjct: 835 ------------LR-----------NFLDWCLKVDPEQRASATDLLNDVFITE 864

>Kwal_0.96
          Length = 427

 Score = 89.4 bits (220), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 107/214 (50%), Gaps = 12/214 (5%)

Query: 1   MSTEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSA-- 58
           +S +  + + +++Y  GK +G G++ VV    + S+G  +A+K +     K G D+    
Sbjct: 33  LSGQPNSYVNKSDYIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALK-GKDVELQM 91

Query: 59  -IREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIKS 115
              E+  LQ++ H N+++  D F + D   +V +        + I+K     FT  D   
Sbjct: 92  LYDELSILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGK--FTEEDAVR 149

Query: 116 WMLMTLRGVHHCHRNFILHRDLKPNNLLL---SPDGVIKVADFGLARAVPSPHEMLTSNV 172
            +   L+ V + H   I+HRDLKP NLL    + D  + + DFG+A+ + +  E++    
Sbjct: 150 IVYQILKAVEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAA 209

Query: 173 VTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELM 206
            +  Y APE++  + H     DIWS+GV+   L+
Sbjct: 210 GSMGYVAPEVVTTSGH-GKPCDIWSLGVVTYTLL 242

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 90.1 bits (222), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 102/195 (52%), Gaps = 5/195 (2%)

Query: 19  KVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELVD 78
           K+G+G    VY   +  T   +A+K++     K       + E+  ++  +H+N++  +D
Sbjct: 703 KIGQGASGGVYTAYELGTNASVAIKQMNLE--KQPKKELIVNEILVMKGSKHNNIVNFID 760

Query: 79  IFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLK 138
            ++   +L +V+E++       +    IL T   I +    TL+G+   H   ++HRD+K
Sbjct: 761 SYLFRGDLWVVMEYMEGGSLTDVVTHCIL-TEGQIGAVSRETLKGLQFLHSKGVIHRDIK 819

Query: 139 PNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSV 198
            +N+LLS +G IK+ DFG    +   +   T+ V T ++ APE++   K Y   +DIWS+
Sbjct: 820 SDNILLSMNGDIKLTDFGFCAQINEVNLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIWSL 878

Query: 199 GVIFAELML-RIPYL 212
           G++  E++    PYL
Sbjct: 879 GIMIIEMIEGEPPYL 893

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 90.1 bits (222), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 109/203 (53%), Gaps = 11/203 (5%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEI-----KTSEFKDGLDMSAIREVKYLQEIQHD 71
           GK +G+G+   V L     TG+  A+K +     K+++ K  L     RE+  ++ I H 
Sbjct: 76  GKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQ-LPYGIEREIIIMKLISHP 134

Query: 72  NVIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRN 130
           NV+ L +++     L LVLE++   +L   +  +  L     I  +    ++ V +CH  
Sbjct: 135 NVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIH-YFKQIVQAVAYCHGF 193

Query: 131 FILHRDLKPNNLLLSPDG-VIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHY 189
            I HRDLKP NLLL      IK+ADFG+A A+ +  ++L ++  +  Y +PE++ G K++
Sbjct: 194 NICHRDLKPENLLLDKKKRSIKIADFGMA-ALETSDKLLETSCGSPHYASPEIVLGRKYH 252

Query: 190 TSAIDIWSVGVI-FAELMLRIPY 211
            S  D+WS G+I FA L   +P+
Sbjct: 253 GSPSDVWSCGIILFALLTGHLPF 275

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/305 (26%), Positives = 134/305 (43%), Gaps = 39/305 (12%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSA---IREVKYL 65
           ++++ Y  GK +G GT+ VV       T   +AVK +     K G D+       E+  L
Sbjct: 40  VSKSNYVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALK-GNDVQLQMLYDELSIL 98

Query: 66  QEIQHDNVIELVDIFMAYDNLNLVLEF-LPSDL--EVIIKDRSILFTPADIKSWMLMTLR 122
           Q ++H N++E  D F + D   +V +  +  +L   ++ K +   FT  D  S  +  L 
Sbjct: 99  QMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGK---FTERDAVSITMQILS 155

Query: 123 GVHHCHRNFILHRDLKPNNLLL---SPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRA 179
            V + H   ++HRDLKP N+L    S D  + +ADFG+A+ +    +++     +  Y A
Sbjct: 156 AVDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVA 215

Query: 180 PELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEV 239
           PE+L    H     DIWS+GVI   L+        +  +D        L   T  ++P  
Sbjct: 216 PEVLTNNGH-GKPCDIWSIGVIVYTLLCGYSAFVAET-VDGF------LEECTQNKYPVT 267

Query: 240 SSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
                      +  P  D +       S+ A NF+   LT++P +R  A E ++  +   
Sbjct: 268 -----------FHKPYWDNI-------SDEAKNFILRALTLDPAERPTAAELMKDPWITN 309

Query: 300 MPPPS 304
             P +
Sbjct: 310 TRPET 314

>Kwal_47.18098
          Length = 374

 Score = 88.6 bits (218), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 123/256 (48%), Gaps = 28/256 (10%)

Query: 60  REVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLM 119
           +EV  L    H N+I+L+D+   + +    L F   D  +  +     F   DI+ +M  
Sbjct: 120 QEVYELAHDGHKNIIQLLDVVKDHVSKTPALVFEHVD-NIDFRTLYPTFQDLDIRYYMFE 178

Query: 120 TLRGVHHCHRNFILHRDLKPNNLLLS-PDGVIKVADFGLARAVPSPHEMLTSNVVTRWYR 178
            L+ + +CH   I+HRD+KP+N+++      +++ D+GLA     P+      V +R+++
Sbjct: 179 LLKALDYCHSMGIMHRDVKPHNVMIDHKRKKLRLIDWGLAEFY-HPNMEYNVRVASRFFK 237

Query: 179 APELLFGAKHYTSAIDIWSVGVIFAELML-RIPYLPGQNDIDQMEVTFRALGTPTDKEWP 237
            PELL   + Y  ++D+WS G + A ++  + P+  G ++ DQ+    R LG+       
Sbjct: 238 GPELLVDYRMYDYSLDLWSFGTMLASMIFQKEPFFHGTSNTDQLVKIVRVLGS------- 290

Query: 238 EVSSFGSY-NKLQIYPPPSIDELRK-------RFI-------AASENALNFMCGMLTMNP 282
               F +Y  K QI  P    ++ +       RF+       + +E  LN +  +L  + 
Sbjct: 291 --DDFENYLRKYQITLPQEFHDIDQYIRRPWHRFVNDANSHLSGNEEILNLIDNLLRYDH 348

Query: 283 KKRWNAIECLESEYFK 298
           ++R  A E ++  +F+
Sbjct: 349 QERLTAREAMQHPWFE 364

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 88.6 bits (218), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 86/314 (27%), Positives = 135/314 (42%), Gaps = 61/314 (19%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAI-REVKYLQEIQHD 71
           +Y  GK++G G YA+V     + TG  +AVK     +  D         E K L  IQH 
Sbjct: 100 KYLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQNDDDKRTKKFTEETKILLSIQHP 159

Query: 72  NVIELVDIFM-----AYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIKSWMLMTLRGV 124
           N+++L+D F+           LVLE +      E I++  ++     + K+     L G+
Sbjct: 160 NIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNL--REDETKALFRQLLNGL 217

Query: 125 HHCHRNFILHRDLKPNNLLL------SPDGV-------------IKVADFGLARAVPSPH 165
            + H   I+HRD+KP N+LL      SP+ +             +K+ADFGLA+      
Sbjct: 218 KYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKFT---G 274

Query: 166 EMLTSNVV--TRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEV 223
           EM  +N +  T  Y APE+L     YTS +D+WS GV+    +   P    Q        
Sbjct: 275 EMKFTNTLCGTPSYVAPEVLVKT-GYTSRVDMWSAGVLLYVCLCGFPPFSEQ-------- 325

Query: 224 TFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPK 283
               L  P+ KE      F  Y+       P  D +        ++ L+ +  +L +NP 
Sbjct: 326 ----LAPPSMKEQILQGKFAFYS-------PYWDNI-------DDSVLHLISNLLVVNPA 367

Query: 284 KRWNAIECLESEYF 297
            R++  + L   +F
Sbjct: 368 SRFSVNDALTHPWF 381

>Kwal_26.8941
          Length = 661

 Score = 89.4 bits (220), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 112/244 (45%), Gaps = 19/244 (7%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKT---SEFKDGLDMSAIREVKYLQEIQHDNV 73
           GK +G G    V +  + S G   AVKE +    +E           E      + H NV
Sbjct: 134 GKILGSGAGGSVRVIVRPSDGATFAVKEFRPRRPTELAKDYAKKCTAEFCIGSTLHHPNV 193

Query: 74  IELVDIF--MAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNF 131
           IE +DIF     +    V+E+ P D   ++   ++  +  +I   +     GV + H   
Sbjct: 194 IETLDIFSDAKQNKYYEVMEYCPIDFFAVVMSGNM--SRGEINCCLRQLSEGVRYLHNMG 251

Query: 132 ILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE----MLTSNVVTRWYRAPELLFGAK 187
           + HRDLK +N +++ DG++K+ DFG A     P +    M    V +  Y APE++   K
Sbjct: 252 LAHRDLKLDNCVMTCDGILKLIDFGSAVVFKYPFDSSVTMAHGIVGSDPYLAPEVMTSTK 311

Query: 188 HYTSA-IDIWSVGVIFAELML-RIPY-LPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGS 244
            Y    +DIWS+G+I+  +ML R P+  P ++D +     FR    P D E   V S   
Sbjct: 312 RYDPQFVDIWSIGIIYCCMMLKRFPWKTPKESDDN-----FRLFCLPDDVEHDYVKSARE 366

Query: 245 YNKL 248
           + KL
Sbjct: 367 HEKL 370

>Scas_718.90
          Length = 647

 Score = 89.4 bits (220), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 136/289 (47%), Gaps = 33/289 (11%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYL--QEIQHDNVI 74
           GKK+GEG    V +  + + G+  AVK  +  +  + +  S    V++     + H N+I
Sbjct: 318 GKKLGEGATGSVSI-VQGTDGKMFAVKMFRAPKTTNVVTYSKKITVEFCIGSTLHHQNII 376

Query: 75  ELVDIFMAYDNLNLVLEFLPSDL-EVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFIL 133
           E  D+    +   +V+E+ P D   +++ D   L T  ++  +      GV++ H   I 
Sbjct: 377 ETFDMLREGETFLVVMEYAPYDFFNLVMAD---LMTTKEVSCYFKQLCNGVNYLHDMGIA 433

Query: 134 HRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE----MLTSNVVTRWYRAPELLFGAKHY 189
           HRDLK +N ++S +G++K+ DFG A     P+E         V +  Y APELL  + + 
Sbjct: 434 HRDLKLDNCVVSHNGILKLIDFGSAVIFQYPYENKIVKAQGIVGSDPYLAPELLNTSTYD 493

Query: 190 TSAIDIWSVGVIFAELML-RIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKL 248
              +D+WS+ +I+  ++L R P+   +   +    +FR      D E  +  + G Y  L
Sbjct: 494 PRPVDVWSIAIIYYCMILRRFPWKAPRKSFN----SFRLFCEDPDDE--DDVAKGPYRLL 547

Query: 249 QIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYF 297
           ++ P  S     +  IA           ML ++PKKR    E ++ E+F
Sbjct: 548 RLLPSKS-----RPLIAK----------MLLLDPKKRILMNEVVKDEWF 581

>Kwal_26.7788
          Length = 1267

 Score = 89.4 bits (220), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 106/200 (53%), Gaps = 7/200 (3%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDG-LDMSAIREVKYLQEIQHDNVI 74
           GK +G+G+   V L     TG+  A+K + KT   + G L     RE+  ++ I H NV+
Sbjct: 61  GKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMKLISHPNVM 120

Query: 75  ELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFIL 133
            L +++     L LVLE++   +L   +  R  L     I  +    + G  +CH   I 
Sbjct: 121 GLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIH-YFRQIIEGTAYCHGFNIC 179

Query: 134 HRDLKPNNLLL-SPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192
           HRDLKP NLLL   +  IK+ADFG+A A+ + +++L ++  +  Y +PE++ G  +    
Sbjct: 180 HRDLKPENLLLDKKNKRIKIADFGMA-ALQTSNKLLETSCGSPHYASPEIVMGKNYNGGP 238

Query: 193 IDIWSVGVI-FAELMLRIPY 211
            D+WS G+I FA L   +P+
Sbjct: 239 SDVWSCGIILFALLTGHLPF 258

>Scas_713.7
          Length = 983

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 102/200 (51%), Gaps = 7/200 (3%)

Query: 12  TEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHD 71
            +Y   + +G+G+Y VVY    + T + +A+KE+      D   +  + E+  L+ + H 
Sbjct: 24  VQYQLKQVIGKGSYGVVYKAVNKKTLQIVAIKEVNYDN--DDELIEIMTEIDLLKNLNHV 81

Query: 72  NVIELVDIFMAYDNLNLVLEFLP-SDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRN 130
           N+++         NL ++LEF     L+ ++          D K ++  TL G+ + H  
Sbjct: 82  NIVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELDAKVYIRQTLNGLVYLHEQ 141

Query: 131 FILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYT 190
            ++HRD+K  NLLL  + V+K+ADFG++  V +    L  ++   W  +PE++ G +  +
Sbjct: 142 GVIHRDIKAANLLLDSNDVVKLADFGVSTKVSNTAMTLAGSL--HW-MSPEII-GNRGAS 197

Query: 191 SAIDIWSVGVIFAELMLRIP 210
           +  DIWS+G    EL+   P
Sbjct: 198 TLSDIWSLGATVVELVTGNP 217

>Scas_644.15
          Length = 726

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 113/227 (49%), Gaps = 8/227 (3%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHD 71
           +Y +G  +GEG +A  +   K  +G+  A K + K S   +      + E++  + ++H 
Sbjct: 91  DYRRGHFLGEGGFARCF-QIKDESGKIFAAKTVAKISIKTEKTKKKLLSEIQIHKSMKHP 149

Query: 72  NVIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRN 130
           N++  VD F    N+ ++LE   +  L  ++K R  L  P +++ +       V + H  
Sbjct: 150 NIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEP-EVRFFTTQICGAVKYMHSR 208

Query: 131 FILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKH-- 188
            ++HRDLK  N+    D  +KV DFGLA  + +  E   +   T  Y APE+L G KH  
Sbjct: 209 RVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAPEVLMG-KHAG 267

Query: 189 YTSAIDIWSVGV-IFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDK 234
           ++  +DIWS+GV I+A L+ + P+     ++    +     G P DK
Sbjct: 268 HSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYPKDK 314

>Kwal_56.22476
          Length = 697

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 113/229 (49%), Gaps = 12/229 (5%)

Query: 13  EYTKGKKVGEGTYAVVYL----GTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEI 68
           +Y +G  +GEG +A  +     G K    + +A   IK+ + +  L    + E++  + +
Sbjct: 78  DYHRGHFLGEGGFARCFQIKDDGGKIFAAKTVAKISIKSEKTRKKL----LSEIQIHKSM 133

Query: 69  QHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCH 128
           +H N+++ VD F    N+ ++LE  P+   + +  R  + T  +++ +    +  V + H
Sbjct: 134 RHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFTTQIVGAVKYMH 193

Query: 129 RNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKH 188
              ++HRDLK  N+       +KV DFGLA  + +  E   +   T  Y APE+L G KH
Sbjct: 194 SRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLTG-KH 252

Query: 189 --YTSAIDIWSVGV-IFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDK 234
             ++  +DIWS GV I+A L+ + P+   + +I    +       P DK
Sbjct: 253 TGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDFVFPKDK 301

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 88.2 bits (217), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 84/310 (27%), Positives = 135/310 (43%), Gaps = 55/310 (17%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIRE-VKYLQEIQHDN 72
           Y  GK++G G YA+V     + TG+ +AVK     +  D       RE  K L  + H+N
Sbjct: 155 YIPGKELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHEN 214

Query: 73  VIELVDIFM-----AYDNLNLVLEFLPSDLEVIIK-DRSILFTPADIKSWMLMTLRGVHH 126
           +++L++ F+     +     LVLE +  D E+  K  R       + ++     L G+ +
Sbjct: 215 IVKLLERFVEPLSKSQVQTYLVLEKI-QDGELFDKIVRKTKLHQDETRALFKQILAGLKY 273

Query: 127 CHRNFILHRDLKPNNLLL------SPDGV-------------IKVADFGLARAVPSPHEM 167
            H   I+HRD+KP N+LL      SPD V             +K+ADFGLA+      + 
Sbjct: 274 LHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAK-FTGEMQF 332

Query: 168 LTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRA 227
            T+   T  Y A E+L     YTS +D+WS GV+    +   P    Q            
Sbjct: 333 TTTLCGTPSYVAAEVLTKT-GYTSKVDLWSAGVLLYVCLCGFPPFSDQ------------ 379

Query: 228 LGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWN 287
           L  P+ KE      F  Y+       P  DE+        ++ L+ +  +L ++P KR++
Sbjct: 380 LAPPSMKEQILQGKFAFYS-------PYWDEI-------DDSVLHLISNLLVVDPAKRYS 425

Query: 288 AIECLESEYF 297
             + +  E+ 
Sbjct: 426 VRDAIGHEWL 435

>KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces
           cerevisiae YJL141c YAK1 ser/thr protein kinase, start by
           similarity
          Length = 704

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 115/225 (51%), Gaps = 23/225 (10%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKT-SEFKDGLDMSAIREVKYLQ----EIQHDN-- 72
           +G+GT+  V       T   +AVK +K+ SE+ +     ++ E K L+    +I  +N  
Sbjct: 338 LGQGTFGQVVKCQNLITKEILAVKVVKSKSEYLN----QSVTEAKVLELLNRQIDPNNEH 393

Query: 73  -VIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSIL-FTPADIKSWMLMTLRGVHHCHRN 130
             + L D F+   +L LV E L ++L  ++K       +   IK++    L  +     +
Sbjct: 394 HFLRLHDTFVHKHHLCLVFELLSNNLYELLKLNEFHGLSMTLIKTFSKQLLDSLCVLKDS 453

Query: 131 FILHRDLKPNNLLL----SPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGA 186
            ++H DLKP N+LL     PD  +KV DFG A         + + + +R+YRAPE+L G 
Sbjct: 454 KLIHCDLKPENILLVSNDRPD--LKVIDFGSA---CEETRTIYTYIQSRFYRAPEVLLGI 508

Query: 187 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTP 231
             Y++ ID+WS G I AEL L IP  PG ++ DQ+     +LG P
Sbjct: 509 P-YSTGIDMWSFGCIVAELFLGIPIFPGNSEFDQVTRIVESLGMP 552

>Scas_648.17
          Length = 340

 Score = 86.7 bits (213), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 111/227 (48%), Gaps = 16/227 (7%)

Query: 10  TQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ 69
           T ++Y    K+G G Y+ V+ G   +      +K +K  + K        RE+K L  + 
Sbjct: 46  TISDYEIITKIGRGKYSEVFSGECVNNETPCVIKVLKPVKMK-----KIYRELKILTNLT 100

Query: 70  HD-NVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSIL---FTPADIKSWMLMTLRGVH 125
              NVIEL+DI     +    L F     EV   D   L   FT  DI+ +    L  ++
Sbjct: 101 GGPNVIELLDIVQDPGSKIPALIFE----EVKNMDFRQLYPTFTLPDIQFYFTQLLIALN 156

Query: 126 HCHRNFILHRDLKPNNLLLSP-DGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLF 184
           +CH   I+HRD+KP N+++ P +  +++ D+GLA     P       V +R+++ PELL 
Sbjct: 157 YCHSMGIMHRDVKPQNVMIDPKERKLRLIDWGLAEFY-HPGVDYNVRVASRYHKGPELLV 215

Query: 185 GAKHYTSAIDIWSVGVIFAELML-RIPYLPGQNDIDQMEVTFRALGT 230
               Y  ++D+WSVG + A ++  R P+  G ++ DQ+      LGT
Sbjct: 216 NLNQYDYSLDLWSVGCMLAAIVFKREPFFKGSSNPDQLVRIAAVLGT 262

>Kwal_26.7861
          Length = 955

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 111/229 (48%), Gaps = 19/229 (8%)

Query: 19  KVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELVD 78
           K+G+G    VY   +  T   +A+K++     K       I E+  ++  +H N++  +D
Sbjct: 672 KIGQGASGGVYTAYEVGTNASVAIKQMNLE--KQPKKELIINEILVMKASKHANIVNFID 729

Query: 79  IFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLK 138
            ++   +L +V+E++       +    IL T   I +    TL+G+   H   ++HRD+K
Sbjct: 730 SYLLRGDLWVVMEYMEGGSLTDVVTHCIL-TEGQIGAVSRETLKGLQFLHSKGVIHRDIK 788

Query: 139 PNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSV 198
            +N+LLS  G IK+ DFG    +   +   T+ V T ++ APE++   K Y   +DIWS+
Sbjct: 789 SDNVLLSMSGEIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIWSL 847

Query: 199 GVIFAELML-RIPYLPGQNDIDQMEVTFRAL------GTPTDKEWPEVS 240
           G++  E++    PYL         E   RAL      GTP  K+   +S
Sbjct: 848 GIMIIEMIEGEPPYL--------NETPLRALYLIATNGTPELKDADSLS 888

>ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH]
           (503670..504788) [1119 bp, 372 aa]
          Length = 372

 Score = 87.0 bits (214), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 126/250 (50%), Gaps = 38/250 (15%)

Query: 70  HDNVIELVDIFMAYDNLN----LVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGV 124
           H+N+I L+D+    D ++    LV E++ + D  ++       F+  DI+ +M   L+ +
Sbjct: 129 HENIIHLLDVIK--DPISRTPALVFEYVDNVDFRILYP----TFSDMDIRYYMFELLKAL 182

Query: 125 HHCHRNFILHRDLKPNNLLLS-PDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELL 183
            +CH   I+HRD+KP+N+++      +++ D+GLA  +  P E   + V +R+++ PELL
Sbjct: 183 DYCHSMGIMHRDVKPHNVMIDHKQRKLRLIDWGLA-ELYHPKEEYNARVASRFFKGPELL 241

Query: 184 FGAKHYTSAIDIWSVGVIFAELM-LRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF 242
              + Y  ++D+WS+G + A ++ ++ P+  G+++ DQ+    R LG+           F
Sbjct: 242 VDYRMYDYSLDLWSLGTMLASMVFMKEPFFHGRSNTDQLVKIVRVLGS---------EDF 292

Query: 243 GSY-NKLQIYPPPSIDELR-------KRFI-------AASENALNFMCGMLTMNPKKRWN 287
             Y  K QI  P    ++        KRFI         +E  ++ +  +L  +  +R  
Sbjct: 293 EKYLVKYQITLPREFMDMDQYIRRPWKRFINDANRHLCDNEEIIDLIDNILKYDHHERLT 352

Query: 288 AIECLESEYF 297
           A E ++  +F
Sbjct: 353 AREAMQHPWF 362

>CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces
           cerevisiae YFL029c CAK1 cdk-activating protein kinase,
           hypothetical start
          Length = 360

 Score = 86.7 bits (213), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 103/225 (45%), Gaps = 53/225 (23%)

Query: 72  NVIELVDIFMAYDNLNLVLEFLPSDLEVIIKD----------------------RSILFT 109
           +VI+L++      N+ L  +F P DLE  ++                       RS    
Sbjct: 60  HVIKLIEDQCKNSNIELWFKFYPIDLEDYLRSCFKPQNKFNPYYTLGEVLETSLRSSYVN 119

Query: 110 PADI----KSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIK----VADFGLARAV 161
             D+    K + L  ++G++  H++ I+HRD+KP N++L      K    + DFG++  +
Sbjct: 120 EFDVNEFAKDFFLQIVKGLNFIHQSGIIHRDIKPRNIVLEKLSTGKFNLVLIDFGISYDI 179

Query: 162 PS------PHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELM--------- 206
                   P   +T +V T  Y+APELLFG K+Y+SA+DIW++ VI +            
Sbjct: 180 TETNIDERPDSKIT-DVSTSIYKAPELLFGVKNYSSAVDIWAMLVILSNFFSLASDCKNY 238

Query: 207 ----LRIPYLPGQNDIDQMEV---TFRALGTPTDKEWPEVSSFGS 244
                   Y PG+ D   +++    F   G PT  EWPEV + GS
Sbjct: 239 LSSCFDDGYRPGEEDGSDIKLIFSIFEKFGVPTANEWPEVINHGS 283

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 87.8 bits (216), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 99/202 (49%), Gaps = 15/202 (7%)

Query: 20   VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDM--SAIREVKYLQEIQHDNVIELV 77
            +G G++  VY      TG  +AVKEIK  + K    +  S   E++ ++ + H N+++  
Sbjct: 1265 IGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEILNHPNIVQYY 1324

Query: 78   DIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDL 137
             + +  D +N+ +EF        + +   +      + + L  L G+   H++ ++HRD+
Sbjct: 1325 GVEVHRDKVNIFMEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLEGLACLHQSGVVHRDI 1384

Query: 138  KPNNLLLSPDGVIKVADFGLARAVP---SPHEMLTSN---------VVTRWYRAPELLFG 185
            KP N+LL  +GVIK  DFG A+ +    S    L +N         + T  Y APE + G
Sbjct: 1385 KPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGTPMYMAPETVTG 1444

Query: 186  AKHYT-SAIDIWSVGVIFAELM 206
              H    + DIWS+G +  E++
Sbjct: 1445 QGHGKFGSDDIWSLGCVVLEMV 1466

>Scas_698.37
          Length = 347

 Score = 85.1 bits (209), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/306 (24%), Positives = 147/306 (48%), Gaps = 33/306 (10%)

Query: 10  TQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ 69
           T T+Y    K+G G Y+ V+ G          +K +K  + +        RE+K L  + 
Sbjct: 54  TLTDYEIINKIGRGKYSEVFRGKHILNDVSCVIKVLKPVKLR-----KIHRELKILWNLT 108

Query: 70  HD-NVIELVDIFMAYDNLNLVLEFLPSDLE-VIIKDRSILFTPADIKSWMLMTLRGVHHC 127
              N++EL+D+   +D    V  F+  D++ V  ++    F  +D++ +    L  +++ 
Sbjct: 109 GGPNIVELLDV--VHDEKTRVPAFIFEDVKNVDFRELYPTFKLSDVQYYFKQLLIALNYA 166

Query: 128 HRNFILHRDLKPNNLLLSP-DGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGA 186
           H   I+HRD+KP N+++ P    +++ D+GLA     P       V +R+++ PELL   
Sbjct: 167 HSMGIMHRDVKPQNVMIDPVQRKLRLIDWGLAEFY-HPGVDYNVRVASRYHKGPELLTDL 225

Query: 187 KHYTSAIDIWSVGVIFAELMLRI-PYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSY 245
             Y  ++D+WSVG + A ++ +  P+  G ++ DQ+    + LGT     +  ++ +G  
Sbjct: 226 NQYDYSLDMWSVGCMIAAIIFKKEPFFKGGSNPDQLVKIAKVLGTKQLINY--LARYG-- 281

Query: 246 NKLQIYPPPSIDEL-----RK---RFIA-----ASENALNFMCGMLTMNPKKRWNAIECL 292
               ++ P   D L     RK    FI+     A+  A++ +  +L  + ++R  A E +
Sbjct: 282 ----LHLPSEHDNLIRTWARKPWSHFISIETPLATPEAVDLVDNLLRYDHQERLTAEEAM 337

Query: 293 ESEYFK 298
             ++F+
Sbjct: 338 NHQFFQ 343

>CAGL0G02035g 179911..180930 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 339

 Score = 85.1 bits (209), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 137/301 (45%), Gaps = 41/301 (13%)

Query: 19  KVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHD-NVIELV 77
           K+G G Y+ V+ G   +  +   +K +K  + K        RE+K L  +    NVI L+
Sbjct: 55  KIGRGKYSEVFSGKCITNDQPCVIKVLKPVKMK-----KIYRELKILTNLTGGPNVIGLL 109

Query: 78  DIFM--AYDNLNLVLEFLPSDLEVIIKDRSIL---FTPADIKSWMLMTLRGVHHCHRNFI 132
           DI    A     L+ E      EV   D   L   FT  D++ +    L  + +CH   I
Sbjct: 110 DIVQDQASKIPALIFE------EVKNADFRTLYPSFTLQDLQYYFTQLLIALDYCHSMGI 163

Query: 133 LHRDLKPNNLLLSP-DGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTS 191
           +HRD+KP N+++ P    +++ D+GLA     P       V +R+++ PELL     Y  
Sbjct: 164 MHRDVKPQNVMIDPAQKKLRLIDWGLAEFY-HPGVDYNVRVASRYHKGPELLVNLNQYDY 222

Query: 192 AIDIWSVGVIFAELMLRI-PYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQI 250
           ++D+WSVG + A ++ +  P+  G ++ DQ+      LGT       E+ ++ +   L++
Sbjct: 223 SLDLWSVGCMLAAIIFKKEPFFKGSSNADQLVKIADVLGT------KELMAYLAKYGLKL 276

Query: 251 YPPPSIDELRKRF-------IAASENAL------NFMCGMLTMNPKKRWNAIECLESEYF 297
             P   D + + F          S   L      + +  +L  + ++R  A E ++ E+F
Sbjct: 277 --PSEYDHIMRDFTRKPWEHFVTSSTPLAVPVLVDLVDHLLRYDHQERLTAREAMDHEFF 334

Query: 298 K 298
           K
Sbjct: 335 K 335

>YJL141C (YAK1) [2777] chr10 complement(147885..150308)
           Serine/threonine protein kinase, negative regulator of
           cell growth acting in opposition to cAMP-dependent
           protein kinase A [2424 bp, 807 aa]
          Length = 807

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/226 (30%), Positives = 118/226 (52%), Gaps = 25/226 (11%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYL----QEIQHDN--- 72
           +G+GT+  V       T   +AVK +K+   +      +I E K L    Q+I   N   
Sbjct: 375 LGQGTFGQVVKCQNLLTKEILAVKVVKS---RTEYLTQSITEAKILELLNQKIDPTNKHH 431

Query: 73  VIELVDIFMAYDNLNLVLEFLPSDL-EVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNF 131
            + + D F+  ++L LV E L ++L E++ +++    +   I+++    L  +     + 
Sbjct: 432 FLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLKESK 491

Query: 132 ILHRDLKPNNLLL-SPDG-VIKVADFGL----ARAVPSPHEMLTSNVVTRWYRAPELLFG 185
           ++H DLKP N+LL +PD   +K+ DFG     AR V        + + +R+YRAPE++ G
Sbjct: 492 LIHCDLKPENILLCAPDKPELKIIDFGSSCEEARTV-------YTYIQSRFYRAPEIILG 544

Query: 186 AKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTP 231
              Y+++ID+WS+G I AEL L IP  PG ++ +Q+      LG P
Sbjct: 545 IP-YSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYP 589

>Kwal_33.13984
          Length = 649

 Score = 86.3 bits (212), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 115/225 (51%), Gaps = 23/225 (10%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKT-SEFKDGLDMSAIREVKYLQEIQ-------HD 71
           +G+GT+  V       T   +AVK +K+ SE+ +     +I E K L+ +          
Sbjct: 284 LGQGTFGQVVKCQNLLTKEILAVKVVKSKSEYLN----QSITEAKILELLNGKIDPQGEH 339

Query: 72  NVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSIL-FTPADIKSWMLMTLRGVHHCHRN 130
           + + + + F+  ++L LV E L S+L  ++K       + + I+++    L  +     +
Sbjct: 340 HFLRMHETFVHKNHLCLVFELLSSNLYELLKQNQFHGLSISLIRTFARQLLDSLCVLKEH 399

Query: 131 FILHRDLKPNNLLL----SPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGA 186
            ++H DLKP N+LL     P+  +KV DFG A         L + + +R+YRAPE++ G 
Sbjct: 400 KLIHCDLKPENILLVSLDRPE--LKVIDFGSAC---EETRTLYTYIQSRFYRAPEVILGI 454

Query: 187 KHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTP 231
             Y++ ID+WS+G I AEL L IP  PG ++ +Q+      LG P
Sbjct: 455 P-YSTGIDMWSLGCIIAELFLGIPIFPGSSEFNQITRIVDTLGLP 498

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 86.3 bits (212), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 104/202 (51%), Gaps = 7/202 (3%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHD 71
           +Y +G  +GEG +A  +   K  +G+  A K + K S   +      + E++  + ++H 
Sbjct: 72  DYHRGMFLGEGGFARCF-QMKDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHP 130

Query: 72  NVIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRN 130
           N+++  D F    N+ ++LE  P+  L  ++K R  L  P +++ +    +  + + H  
Sbjct: 131 NIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEP-EVRFFTTQIVGAIKYMHSR 189

Query: 131 FILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKH-- 188
            I+HRDLK  N+       +K+ DFGLA  + +  E   +   T  Y APE+L G KH  
Sbjct: 190 RIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLTG-KHTG 248

Query: 189 YTSAIDIWSVGVIFAELMLRIP 210
           ++  +DIWS+GV+   L++  P
Sbjct: 249 HSFEVDIWSIGVMIYALLIGKP 270

>ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH]
           complement(1062595..1063614) [1020 bp, 339 aa]
          Length = 339

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 140/301 (46%), Gaps = 33/301 (10%)

Query: 19  KVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHD-NVIELV 77
           K+G G Y+ V+ G          +K +K  + K        RE+K L  +    N+I L+
Sbjct: 55  KIGRGKYSEVFRGKSIVNDHPCVIKVLKPVKMK-----KIYRELKILTNLTGGPNIIGLL 109

Query: 78  DIFMAYDNLNLVLEFLPSDLE-VIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRD 136
           DI    D  + +   +  +++ V  +     FT +D + +    L  + +CH   I+HRD
Sbjct: 110 DIVQ--DPGSKIPALIFEEVKNVEFRTLYPAFTLSDTQHYFKQLLIALDYCHSMGIMHRD 167

Query: 137 LKPNNLLLSP-DGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDI 195
           +KP N+++ P +  +++ D+GLA     P       V +R+++ PELL     Y  ++D+
Sbjct: 168 VKPQNVMIDPTERKLRLIDWGLAEFY-HPGVDYNVRVASRYHKGPELLVNLNQYDYSLDL 226

Query: 196 WSVGVIFAELMLRI-PYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPP 254
           WSVG + A ++ +  P+  G  + DQ+    R LGT       ++ ++  +  L +  P 
Sbjct: 227 WSVGCMLAAIVFKKEPFFKGSTNPDQLVKIARVLGT------KQLLAYLEHYGLTL--PH 278

Query: 255 SIDELRKRF-------IAASENAL------NFMCGMLTMNPKKRWNAIECLESEYFKEMP 301
             D + K F         + +N L      + +  +L  + ++R  A E ++ ++FK+  
Sbjct: 279 EYDNIMKDFERKPWSYFISDDNTLAVPEVVDLIDHLLRYDHQERLTAKEAMDHDFFKKEY 338

Query: 302 P 302
           P
Sbjct: 339 P 339

>CAGL0C02893g complement(286017..287966) similar to tr|Q08732
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 649

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 104/213 (48%), Gaps = 14/213 (6%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR---EVKYLQEIQHDNV 73
           GK +G G    V + T+ + G   AVKE +  +  + +   A +   E      + H NV
Sbjct: 218 GKLLGSGAGGSVKILTRPTDGATFAVKEFRPRKPNESVKEYAKKCTAEFCIGSSLHHPNV 277

Query: 74  IELVDIFM--AYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNF 131
           IE VD+F     +    V+++ P D   ++    +  +  +I   +     GV + H   
Sbjct: 278 IETVDVFSDSKQNKYYEVMQYCPIDFFAVVMTGKM--SRGEINCCLKQLTEGVRYLHSMG 335

Query: 132 ILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE----MLTSNVVTRWYRAPELLFGAK 187
           + HRDLK +N +++ DG+IK+ DFG A     P E    M    V +  Y APE++   K
Sbjct: 336 LAHRDLKLDNCVMTADGIIKLIDFGSAVVFRYPFEDDVTMAHGIVGSDPYLAPEVITSTK 395

Query: 188 HYT-SAIDIWSVGVIFAELML-RIPY-LPGQND 217
            Y    +DIWS+G+I+  +ML R P+  P ++D
Sbjct: 396 SYDPQCVDIWSIGIIYCCMMLKRFPWKAPRESD 428

>Scas_720.94
          Length = 1683

 Score = 85.9 bits (211), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/315 (24%), Positives = 125/315 (39%), Gaps = 70/315 (22%)

Query: 14   YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAI-----REVKYLQEI 68
            + K   +G GT+  VY       G  +AVKEIK    +D   M  I      E+  L+ +
Sbjct: 1361 WQKRNFIGGGTFGTVYSAVNLDNGEILAVKEIK---IQDSKTMKKIFPLVKEEMTVLEML 1417

Query: 69   QHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCH 128
             H N+++   + +  D +N+ +E+        + +   +      + + L  L G+ + H
Sbjct: 1418 NHPNIVQYYGVEVHRDKVNIFMEYCEGGSMASLLEHGRIEDEMVTQVYTLELLEGLAYLH 1477

Query: 129  RNFILHRDLKPNNLLLSPDGVIKVADFGLARAVP-------------------------- 162
            +  ++HRD+KP N+LL  +G+IK  DFG AR +                           
Sbjct: 1478 QAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKDTEG 1537

Query: 163  ---SPHEMLTSNVVTRWYRAPELLFGAKHYT--SAIDIWSVGVIFAELMLRIPYLPGQND 217
               S H+ML     T  Y APE + G K+ T   + DIWS G +  E+            
Sbjct: 1538 GANSVHDMLG----TPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEM------------ 1581

Query: 218  IDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGM 277
                 +T R      D EW  +    +    Q+  P  +    +RF+          C  
Sbjct: 1582 -----ITGRRPWANLDNEWAIIYHVAAGQTPQLPYPNEVSPAGRRFLQR--------C-- 1626

Query: 278  LTMNPKKRWNAIECL 292
            L  +P KR  A+E L
Sbjct: 1627 LVQDPIKRATAVELL 1641

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 85.5 bits (210), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 110/213 (51%), Gaps = 7/213 (3%)

Query: 3   TEITTPIT-QTEYTKGKKVGEGTYAVVYLGTKQSTGRQ-IAVKEIKTSEFKDGLDMSAIR 60
           ++I TP T + ++    K+G+G    VYL   +S   Q +A+K++     K       + 
Sbjct: 554 SKICTPGTPEDKFETYLKIGQGASGGVYLSHSRSDKSQCVAIKQMNLE--KQPKKELIVN 611

Query: 61  EVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMT 120
           E+  +   +H N++  +D +++  +L +V+E++       +    +L T   I +     
Sbjct: 612 EIMVMSSSKHQNIVNYIDSYLSGLDLWVVMEYMEGGCLTDVVTYCVL-TEGQIGAVCREV 670

Query: 121 LRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAP 180
           L+G+   H   +LHRD+K +N+LLS +G IK+ DFG    V       T+ V T ++ AP
Sbjct: 671 LQGLEFLHSKGVLHRDIKSDNVLLSMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMAP 730

Query: 181 ELLFGAKHYTSAIDIWSVGVIFAELML-RIPYL 212
           E++   K Y   +DIWS+G++  E++    PYL
Sbjct: 731 EIV-SRKEYGPKVDIWSLGIMIIEMIEGEPPYL 762

>ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)
           [2016 bp, 671 aa]
          Length = 671

 Score = 85.5 bits (210), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 115/243 (47%), Gaps = 17/243 (6%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGL-DMSAIREVKYL--QEIQHDNV 73
           GK +G G    V +  + S GR  AVK+ +     + + D +     +Y+    + H NV
Sbjct: 120 GKVLGSGAGGSVKVLVRPSDGRTFAVKQFRPRRPGESVKDYARKCTSEYMIGSMLHHPNV 179

Query: 74  IELVDIFM--AYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNF 131
           IE +D+F     +    V+E+ P D   ++   S   +  +I       + GV++ H   
Sbjct: 180 IETLDVFSNSKQNQYYEVMEYCPVDFFAVV--MSGQMSRGEINCCFKQLVEGVNYLHSKG 237

Query: 132 ILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE----MLTSNVVTRWYRAPELLFGAK 187
             HRDLK +N +++ DG++K+ DFG A      +E    M    V +  Y APE+L   K
Sbjct: 238 YAHRDLKLDNCVMTRDGILKLIDFGSAFVFKYTYEADEKMAHGVVGSDPYLAPEVLTSTK 297

Query: 188 HYTSA-IDIWSVGVIFAELML-RIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSY 245
            Y++  +DIWS+G+I+  ++L R P+     +    +  F+    P D+E   V S   +
Sbjct: 298 SYSAPLVDIWSIGIIYCCMILKRFPW----KEPRLTDNNFKVYCMPDDQEHDYVKSAKEH 353

Query: 246 NKL 248
             L
Sbjct: 354 EAL 356

>Scas_633.29
          Length = 789

 Score = 85.1 bits (209), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 85/314 (27%), Positives = 138/314 (43%), Gaps = 54/314 (17%)

Query: 6   TTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYL 65
           T  +  TEY K + +G G  + VY   K S  +  A+K +   EF D        E++ L
Sbjct: 292 TITVNDTEYEKIELLGRGGSSRVY-KVKNSQNKVFALKRVSFDEFDDSSVDGFKGEIELL 350

Query: 66  QEIQHDN-VIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPAD-IKSWMLMTLRG 123
           +++ +++ V++L D  M    L L++E    DL  I+  RS +    D ++      +R 
Sbjct: 351 EKLSNESRVVKLFDYQMDSGVLFLIMECGDHDLSQILSQRSDMPLDMDFVRYHAREVVRC 410

Query: 124 VHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEM---LTSNVVTRWYRAP 180
           +   H   I+H DLKP N +    G++K+ DFG+A A+P  H +     + + T  Y AP
Sbjct: 411 IKIVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAIPD-HTVNIYRENQIGTPNYMAP 468

Query: 181 ELLFGAKHYTSA------------IDIWSVGVIFAELML-RIPYLPGQNDIDQMEVTFRA 227
           E L  A +YT+              DIWS G I  +++  R PY                
Sbjct: 469 EALV-AMNYTNENDGGNKWKVGKPSDIWSCGCIIYQMIYGRPPY---------------- 511

Query: 228 LGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENA----LNFMCGMLTMNPK 283
                       + F   N+L     P +  +     A +E+     ++ M G LT +P+
Sbjct: 512 ------------AGFQGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDLMKGCLTRDPE 559

Query: 284 KRWNAIECLESEYF 297
           KRW+  + LES +F
Sbjct: 560 KRWSVDQVLESPFF 573

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 85.1 bits (209), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 114/259 (44%), Gaps = 40/259 (15%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIK--------------------------- 46
           + KG ++G G++  VYLG    TG  +AVK+++                           
Sbjct: 439 WLKGARIGSGSFGSVYLGMNAETGELMAVKQVELKPTAVTAGVVSIADESKKAHSPGGGN 498

Query: 47  -----TSEFKDGLDMSAIREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVII 101
                TS+    +  +   E+  L+E+ H+N++          NLN+ LE++P      +
Sbjct: 499 TAVKNTSQIHRKMIDALQHEMNILKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSM 558

Query: 102 KDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAV 161
            +    F    +K++    L G+ + H+  I+HRD+K  N+L+   G +K+ DFG+++ +
Sbjct: 559 LNNYGPFDEPLVKNFTRQILIGLAYLHKRNIIHRDIKGANILIDIKGGVKITDFGISKKL 618

Query: 162 PSPHEMLTSNVVTR---WYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDI 218
              ++        +   ++ APE++      T   DIWSVG +  E+       P   D 
Sbjct: 619 SPLNKQQNKRASLQGSVYWMAPEVVKQVV-TTEKADIWSVGCVIVEMFTGKHPFP---DF 674

Query: 219 DQMEVTFRALGTPTDKEWP 237
            QM+  F+ +GT    E P
Sbjct: 675 SQMQAIFK-IGTNIIPEIP 692

>Kwal_33.14434
          Length = 759

 Score = 85.1 bits (209), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 106/212 (50%), Gaps = 28/212 (13%)

Query: 14  YTK-GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEI---- 68
           YTK G+ +G G    V L  +    +  AVKE +T       D  A R+  Y+++I    
Sbjct: 403 YTKTGENLGAGAGGSVRLVRRTQDNKLFAVKEFRTK-----FDHEAKRD--YVKKITSEY 455

Query: 69  ------QHDNVIELVDIFMAYDNLNL--VLEFLPSDLEVIIKDRSILFTPADIKSWMLMT 120
                 +H N+IE V+I   YDN  +  V+EF   DL  I+    + +   +I       
Sbjct: 456 CIGTTLRHPNIIETVEIV--YDNNRILQVMEFCDYDLFAIVMSNKMSYE--EICCCFKQI 511

Query: 121 LRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE---MLTSNVV-TRW 176
           L GV + H   + HRDLK +N +++  GV+K+ DFG A     P     + +S +V +  
Sbjct: 512 LTGVQYLHSMGLAHRDLKLDNCVINKHGVVKLIDFGAAAVFSYPFSKTLVESSGIVGSDP 571

Query: 177 YRAPELLFGAKHYTSAIDIWSVGVIFAELMLR 208
           Y APE+   +K+    +D+WSV +IFA ++L+
Sbjct: 572 YLAPEVCIFSKYDPRPVDVWSVAIIFACMVLK 603

>Kwal_26.8709
          Length = 829

 Score = 85.1 bits (209), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 110/227 (48%), Gaps = 15/227 (6%)

Query: 2   STEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTG------RQIAVKEIKTSEFKDGLD 55
           ST+    +T   Y  G  +GEG +  V LG  +++       +Q+A+K I+        +
Sbjct: 28  STQKRKHVTFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSE 87

Query: 56  --MSAIREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSD--LEVIIKDRSILFTPA 111
             +   RE+  L+ + H N++ L ++      + +VLE+       + I K R +   PA
Sbjct: 88  KEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGPA 147

Query: 112 DIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSN 171
                 L++  GV++ H   ++HRDLK  NLLL  +  + + DFG        +E++ ++
Sbjct: 148 CRLFAQLIS--GVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTS 205

Query: 172 VVTRWYRAPELLFGAKHYTS-AIDIWSVGVIFAELMLRIPYLPGQND 217
             +  Y APEL+  A+ Y +   D+WS GVI   ++    YLP  +D
Sbjct: 206 CGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAG--YLPWDDD 250

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score = 84.3 bits (207), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 78/319 (24%), Positives = 139/319 (43%), Gaps = 76/319 (23%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQ-IAVKEIKTSEFKDGLDMSAIR-EVKYLQEIQHD 71
           YT  K++G+G++A VY G   S   Q +A+KE+  ++ K+   +  +  E+  L++I+H 
Sbjct: 24  YTAEKEIGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLLENLEIEIAILKKIKHP 83

Query: 72  NVIELVDIFMAYDNLNLVLEFLP-SDLEVIIKDRSIL-------------FTP------- 110
           +++ L+D      +  L++E+    DL  ++K R  L             + P       
Sbjct: 84  HIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLLRTVFEKYPPPSENHNG 143

Query: 111 ---ADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSP------DG------------- 148
              A + S++      +       ++HRD+KP NLLLS       D              
Sbjct: 144 LHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKSFHELGFVGIYN 203

Query: 149 --VIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELM 206
             ++K+ADFG AR +P+   +  +   +  Y APE+L   + Y +  D+WSVG +  E+ 
Sbjct: 204 LPILKIADFGFARFLPNT-SLAETLCGSPLYMAPEIL-NYQKYNAKADLWSVGTVVFEMC 261

Query: 207 LRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRFIAA 266
              P     N ++  +   RA          +V +F SY  ++    P + EL       
Sbjct: 262 CGTPPFRASNHLELFKKIKRA---------NDVITFPSYCNIE----PELKEL------- 301

Query: 267 SENALNFMCGMLTMNPKKR 285
                  +C +LT +P +R
Sbjct: 302 -------ICSLLTFDPAQR 313

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 84.7 bits (208), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 128/292 (43%), Gaps = 39/292 (13%)

Query: 13   EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDM-SAIR-EVKYLQEIQH 70
            ++ K   +G G++  VY      TG  +AVKEIK ++ K    +  +IR E+  L+ + H
Sbjct: 1190 KWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEMLNH 1249

Query: 71   DNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRN 130
             NV++   + +  D +N+ +E+        +     +      + + L  L G+ + H +
Sbjct: 1250 PNVVQYYGVEVHRDRVNIFMEYCEGGSLASLLAHGRIEDEMVTQVYSLQMLEGLAYLHES 1309

Query: 131  FILHRDLKPNNLLLSPDGVIKVADFGLARAVPS---------PHEMLTSNVVTRWYRAPE 181
             + HRD+KP N+LL  +G+IK  DFG A+ + S          H      + T  Y +PE
Sbjct: 1310 GVDHRDIKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYMSPE 1369

Query: 182  LLFGAKHYT-SAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVS 240
             + G  +    + DIWS+G +  E+                 VT R      D +W  + 
Sbjct: 1370 AISGTGYGKFGSDDIWSLGCVILEM-----------------VTGRRPWANLDNQWAIIY 1412

Query: 241  SFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECL 292
               +    QI   PS +E+       S+  + F+   L  +P +R  A+E L
Sbjct: 1413 QVAAG---QIPMFPSKNEM-------SQAGIKFLSRCLIQDPNQRSTAVELL 1454

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score = 84.3 bits (207), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 6/152 (3%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDN 72
           +Y   K + +G Y  VYL  K+ TG   A+K ++ S+      ++ ++  + +  +Q D 
Sbjct: 793 DYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDK 852

Query: 73  --VIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPAD-IKSWMLMTLRGVHHCH 128
             V  L   F   DNL LV+E+LP  DL  +IK   + + P    K ++   + GV+  H
Sbjct: 853 PYVARLFASFQNKDNLFLVMEYLPGGDLATLIK--MMGYLPDQWAKQYLTEIVVGVNDMH 910

Query: 129 RNFILHRDLKPNNLLLSPDGVIKVADFGLARA 160
           +N I+H DLKP NLL+   G +K+ DFGL+RA
Sbjct: 911 QNGIIHHDLKPENLLIDNAGHVKLTDFGLSRA 942

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 18/34 (52%)

Query: 177  YRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIP 210
            Y APE + G        D WSVG IF EL+L  P
Sbjct: 1153 YLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYP 1186

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score = 84.3 bits (207), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 89/166 (53%), Gaps = 8/166 (4%)

Query: 1   MSTEITTPITQT--EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSA 58
           ++T    P+T +  +Y   K + +G Y  VYL  K+ TG   A+K ++ S+      ++ 
Sbjct: 767 LATSQMKPLTPSIKDYDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTN 826

Query: 59  IREVKYLQEIQHDN--VIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPAD-IK 114
           ++  + +  +Q D   V  L   F   DNL LV+E+LP  DL  ++K    L  P + +K
Sbjct: 827 VKSERAIMMVQSDKPYVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGCL--PDEWVK 884

Query: 115 SWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARA 160
            ++   + GV   H N I+H DLKP NLL+   G +K+ DFGL+RA
Sbjct: 885 QYLSEIIIGVEDMHNNGIIHHDLKPENLLIDVSGHLKLTDFGLSRA 930

>Kwal_33.13831
          Length = 700

 Score = 84.0 bits (206), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 64/201 (31%), Positives = 95/201 (47%), Gaps = 14/201 (6%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           Y+ G K+    YAV  L  K    +      + TSEF  G  +S   E +   +  H N+
Sbjct: 418 YSNGSKM---YYAVKELKPKSDEAKDKFGTRL-TSEFIIGHSLS---ERETASQKPHPNI 470

Query: 74  IELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSI-LFTPADIKSWMLMTLRGVHHCHRNF 131
           ++++D+   +D    VLEF PS DL  ++   S     P +   +M   L GV + H + 
Sbjct: 471 LKMLDLMQTHDGFIEVLEFCPSGDLYSLLSRTSKNGLHPLEADCFMKQLLHGVKYMHDHG 530

Query: 132 ILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE----MLTSNVVTRWYRAPELLFGAK 187
           I H DLKP N+L  P GV+K+ DFG +    +  E      T  V +  Y APE     +
Sbjct: 531 IAHCDLKPENILFGPQGVLKICDFGTSCVFQTAWEKQVHFQTGAVGSEPYVAPEEFIAER 590

Query: 188 HYT-SAIDIWSVGVIFAELML 207
            Y    +D WS GVI+  ++L
Sbjct: 591 EYDPRLVDSWSCGVIYCTMVL 611

>Scas_653.25
          Length = 666

 Score = 84.0 bits (206), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 100/209 (47%), Gaps = 15/209 (7%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEIK---TSEFKDGLDMSAIREVKYLQEIQHDNVI 74
           +K+G G    V      S  ++ A+K  K     E         I+E      + H N+I
Sbjct: 273 QKLGSGANGCVVQLQNHSNDKRFAMKTFKPNPNGETTKQYQKRCIKEFILSSHLSHPNII 332

Query: 75  ELVDIFM-AYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFIL 133
           E +DIF      ++ ++E+ P D   I+  R+ L T  +   +      GV + H   I 
Sbjct: 333 ETLDIFYNPSGQISEIMEWCPHDFFNIVMSRTHLLTRRETFCYFKQLCNGVRYLHTLGIA 392

Query: 134 HRDLKPNNLLLSPDGVIKVADFG------LARAVPSPHEMLTSN--VVTRWYRAPELLFG 185
           HRDLK +N +++ +G++K+ DFG      L ++     E++ S   V +  Y APE+L  
Sbjct: 393 HRDLKLDNCVITYNGILKLIDFGSATIFQLNKSTEEKPELIPSRGIVGSDPYLAPEVLLS 452

Query: 186 AK--HYTSAIDIWSVGVIFAELML-RIPY 211
            +  +  S  D+WS+G+IF  +ML R P+
Sbjct: 453 KEIPYDASLADVWSLGIIFCAIMLKRFPW 481

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 103/223 (46%), Gaps = 15/223 (6%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAI---REVKYLQEI- 68
           Y  G+ +  G+++VV+      TG+ +A+K + K  +  + L   A     E   L+ + 
Sbjct: 7   YKVGRLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAALVHNEYAILRRLG 66

Query: 69  QHDNVIELVDIFMAYDNLNLVLEFLP-SDLEVIIKDRSILFTPA---DIKSWMLMTLRGV 124
            H N+ +L+D +   D    VLE+    DL   IK  +I   P    +  S++      +
Sbjct: 67  THRNICQLLDFYEDADTYVFVLEYCAYGDLYDFIK--AIRERPTMRINFHSFLFQLCSAI 124

Query: 125 HHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLF 184
            +CH   + HRD+KP N+L+   G +K+ DFGL++      +     + T  Y APE   
Sbjct: 125 SYCHSKDVSHRDIKPENVLMDDRGQVKLTDFGLSQIGSVSKDYC---IGTEKYLAPETFL 181

Query: 185 GAKHYTSAIDIWSVGV-IFAELMLRIPYLPGQNDIDQMEVTFR 226
              H T A D WS+G+ IF  +    P+    +D  +    F+
Sbjct: 182 REYHNTFATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQ 224

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 82.4 bits (202), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 139/307 (45%), Gaps = 37/307 (12%)

Query: 12  TEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHD 71
           + Y   KK+G G Y+ V+ G          +K +K  + K        RE+K L  +   
Sbjct: 49  SNYEVIKKIGRGKYSEVFKGKSVLNDIPCVIKVLKPVKMK-----KIYRELKVLTNLTGG 103

Query: 72  -NVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSIL---FTPADIKSWMLMTLRGVHHC 127
            N+I L+DI     +    L F     EV   D   L   FT +D + +    L  + +C
Sbjct: 104 PNIIGLLDIVQDPGSKIPALIFE----EVKNVDFRTLYPSFTLSDTQFYFTQLLTALDYC 159

Query: 128 HRNFILHRDLKPNNLLLSP-DGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGA 186
           H   I+HRD+KP N+++ P +  +++ D+GLA     P       V +R+++ PELL   
Sbjct: 160 HSMGIMHRDVKPQNVMIDPNERKLRLIDWGLAEFY-HPGVDYNIRVASRYHKGPELLVSL 218

Query: 187 KHYTSAIDIWSVGVIFAELMLRI-PYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSY 245
             Y  ++D+W+VG + A ++ +  P+  G  + DQ+    + LGT       E+  +  +
Sbjct: 219 NQYDYSLDLWAVGCMIAAIVFKKEPFFKGSTNADQLVKIAKVLGT------QELFYYLKH 272

Query: 246 NKLQIYPPPSIDELRKRFIA-------------ASENALNFMCGMLTMNPKKRWNAIECL 292
             L +  P   +++ K +               A +  ++ +  +L  + ++R  A E +
Sbjct: 273 YGLDL--PAEYNDIMKNYERKPWSYFANDKTPLAVDEIIDLIDHLLRYDHQERLTAKEAM 330

Query: 293 ESEYFKE 299
           E ++FK+
Sbjct: 331 EHKFFKK 337

>Kwal_27.9763
          Length = 868

 Score = 84.0 bits (206), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 106/209 (50%), Gaps = 11/209 (5%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDN 72
            Y   + VG+G Y +VY    + T +Q+A+K I+  E +       + E+  L+ ++H+N
Sbjct: 22  HYALKQVVGKGAYGIVYRAINRQTHKQVAIKVIEYDEEE--ELNEHMLEIDLLKNLKHEN 79

Query: 73  VIELVDIFMAYDNLNLVLEFLP-SDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNF 131
           +++          L ++LE+     L  +IK   +       K+++  TL G+ + H   
Sbjct: 80  IVKYHGFIQKSHQLFILLEYCSQGSLRDLIKRGPV--EEQQCKTYIRQTLHGLKYLHDQG 137

Query: 132 ILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTS 191
           ++HRD+K  NLLL    V+K+ADFG++  V   + +  +   +  + APE++ G    T 
Sbjct: 138 VIHRDIKAANLLLDAQNVVKLADFGVSTRV---NNLAMTYAGSPNWMAPEVMMGQGASTV 194

Query: 192 AIDIWSVGVIFAELMLRIPYLPGQNDIDQ 220
           + DIWS+G    E++   P  P  N +++
Sbjct: 195 S-DIWSLGATVVEILTGNP--PFHNLVNE 220

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 135/307 (43%), Gaps = 48/307 (15%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELVDI 79
           VG G +A V    +++TG+  AVK I   +    +D    RE++ LQ++ H  ++ L   
Sbjct: 194 VGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMD-GVSRELEVLQKLNHPRIVSLKAF 252

Query: 80  FMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLK 138
           +    N  +V+EF+   DL   +     +   A  +      L  + + H   I HRDLK
Sbjct: 253 YEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAG-REISRQILEAIQYIHSKGISHRDLK 311

Query: 139 PNNLLLSPDG--VIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFG----------- 185
           P+N+L+  D   ++K+ DFGLA+ V     ++ +   T  Y APE++ G           
Sbjct: 312 PDNILIEQDDPVLVKITDFGLAK-VQGNGSIMKTFCGTLAYVAPEVIGGFTGATGEEETE 370

Query: 186 --AKHYTSAIDIWSVG-VIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF 242
                Y+S +D+WS+G ++F  L   +P+                 G+  ++ + ++   
Sbjct: 371 EERIEYSSLVDMWSMGCLVFVILTGHLPF----------------SGSTQEQLYEQIRK- 413

Query: 243 GSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPP 302
           GSY     +  P  D         S+ A +F+ G+L ++  KR    + L   + K+   
Sbjct: 414 GSY-----HEGPLKD------FRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSS 462

Query: 303 PSDPSEI 309
             D + +
Sbjct: 463 QFDANSM 469

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 105/209 (50%), Gaps = 17/209 (8%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKD-GLDMSAI--------REVKYLQE 67
           G+K+GEG    V +  +++ G+  A K  +     + G + S +         E      
Sbjct: 305 GRKLGEGASGSVSV-VERTDGKLFACKMFRKPHLNNEGTNQSQLANYSKKVTTEFCIGST 363

Query: 68  IQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHC 127
           + H+N++E +D+    D   LV+E+ P D   ++   S L T  ++  +      GV++ 
Sbjct: 364 LHHENIVETLDMLTEGDTYLLVMEYAPYDFFNLV--MSNLMTQDEVNCYFKQLCHGVNYL 421

Query: 128 HRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE--MLTSN--VVTRWYRAPELL 183
           H   + HRDLK +N +++ DG++K+ DFG A     P+E  ++ S+  V +  Y APELL
Sbjct: 422 HSMGLAHRDLKLDNCVVTKDGILKLIDFGSAVVFQYPYEDTIVKSHGIVGSDPYLAPELL 481

Query: 184 FGAKHYTSAIDIWSVGVIFAELML-RIPY 211
               +     D+WS+ +IF  ++L R P+
Sbjct: 482 KQTSYDPRVADVWSIAIIFYCMVLKRFPW 510

>Scas_700.34
          Length = 864

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 105/224 (46%), Gaps = 19/224 (8%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLG------TKQSTG----RQIAVKEIK--TSEFKDGLDM 56
           +T   Y  G  +GEG +  V LG         S+G    +Q+A+K I+  T       ++
Sbjct: 43  VTFGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKEI 102

Query: 57  SAIREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIK 114
              RE+  L+ + H N+++L ++      + +VLE+       + I + + +   PA   
Sbjct: 103 KIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGPA--C 160

Query: 115 SWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVT 174
                 + GVH+ H   ++HRDLK  NLLL     + + DFG      S  E++ ++  +
Sbjct: 161 RLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELMKTSCGS 220

Query: 175 RWYRAPELLFGAKHYTS-AIDIWSVGVIFAELMLRIPYLPGQND 217
             Y APEL+   K Y +   DIWS GVI   ++    YLP  +D
Sbjct: 221 PCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAG--YLPWDDD 262

>Kwal_26.8796
          Length = 796

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 141/306 (46%), Gaps = 48/306 (15%)

Query: 7   TPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQ 66
           T I +    K + VG+G +A V    ++ TG+  AVK I   +    +D  A RE++ LQ
Sbjct: 181 TGILRDYSIKDEVVGQGAFATVKKAIERKTGKTHAVKIISKRKVVGVMDGVA-RELEVLQ 239

Query: 67  EIQHDNVIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVH 125
            + H  ++ L   +   D+  LV+EF+   DL   +     +   A  +      L  V 
Sbjct: 240 RLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAG-REITRQILEAVK 298

Query: 126 HCHRNFILHRDLKPNNLLLSPDG--VIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELL 183
           + H   I HRDLKP+N+L+  D   ++K+ DFGLA+ +      + +   T  Y APE++
Sbjct: 299 YIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAK-IQGNGTFMKTFCGTLAYVAPEVI 357

Query: 184 FG-------AKHYTSAIDIWSVG-VIFAELMLRIPYLPG-QNDIDQMEVTFRALGTPTDK 234
            G          Y+S +D+WS+G +++  L   +P+    QND+                
Sbjct: 358 SGKNSGEKEGNTYSSLVDMWSIGCLVYVILTGHLPFSGSTQNDL---------------- 401

Query: 235 EWPEVSSFGSYNK--LQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECL 292
            + ++++ GSY++  L+ Y               S++A +F+   L ++P+ R  A + L
Sbjct: 402 -YKQITA-GSYHEGPLKDY-------------RISDDARDFIESFLQVDPRNRMTAEQAL 446

Query: 293 ESEYFK 298
              + K
Sbjct: 447 RHPWIK 452

>Scas_616.10
          Length = 1461

 Score = 83.6 bits (205), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 88/156 (56%), Gaps = 7/156 (4%)

Query: 60  REVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIKSWM 117
           RE+  ++ I H NV+ L +++     L LVLE++      + ++    +  +  +   + 
Sbjct: 185 REIVIMKLISHPNVMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKL--SEKEAVHYF 242

Query: 118 LMTLRGVHHCHRNFILHRDLKPNNLLL-SPDGVIKVADFGLARAVPSPHEMLTSNVVTRW 176
              ++GV +CH   I HRDLKP NLLL   +  IK+ADFG+A A+  P+++L ++  +  
Sbjct: 243 KQIIQGVSYCHSFNICHRDLKPENLLLDKKNKSIKIADFGMA-ALELPNKLLQTSCGSPH 301

Query: 177 YRAPELLFGAKHYTSAIDIWSVGVI-FAELMLRIPY 211
           Y +PE++ G  ++    D+WS G+I FA L   +P+
Sbjct: 302 YASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPF 337

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 82.8 bits (203), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 96/203 (47%), Gaps = 8/203 (3%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEI 68
           + + +Y  GK +G G + VV         + +A+K +     K         E+  LQ++
Sbjct: 51  VNKADYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQMLYDELSILQKL 110

Query: 69  QHDNVIELVDIFMAYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIKSWMLMTLRGVHH 126
            H N+++  D F + +   +V +        + I+K     FT  D    ++  L  V +
Sbjct: 111 DHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGK--FTETDAVKIVVQMLTAVEY 168

Query: 127 CHRNFILHRDLKPNNLLL---SPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELL 183
            H   ++HRDLKP N+L    S +  + ++DFG+A+ + S  +++     +  Y APE+L
Sbjct: 169 MHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVL 228

Query: 184 FGAKHYTSAIDIWSVGVIFAELM 206
             + H     DIWS+GVI   L+
Sbjct: 229 TTSGH-GKPCDIWSLGVITYTLL 250

>Kwal_27.9773
          Length = 406

 Score = 82.0 bits (201), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 115/254 (45%), Gaps = 48/254 (18%)

Query: 2   STEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIRE 61
           S E T+P +  EY   +++G G++  V       T R +  KEIK            I E
Sbjct: 8   SREHTSPRS-NEYQVLEEIGRGSFGSVRKVVHVPTNRVLVRKEIKYGHMNSKERQQLISE 66

Query: 62  VKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPS-DLEVII----KDRSILFTPAD-IKS 115
              L +++H+N++E  +     D L   +E+  + DL  +I    K+R   + P   + S
Sbjct: 67  CAILSQLKHENIVEFYEWDSDVDVLYFYMEYCSNGDLSQMISHFKKERK--YIPERLVWS 124

Query: 116 WMLMTLRGVHHCH---------------------RNFILHRDLKPNNLLLSPDGV----- 149
            M+  L  ++ CH                      N ++HRDLKP N+ LS + V     
Sbjct: 125 VMVQVLVALYRCHYGSDLAPLETIYDRMKPPVKGSNVVIHRDLKPGNIFLSTERVPDARV 184

Query: 150 -----------IKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSV 198
                      +K+ DFGLA+++ +  E  T+ V T +Y +PE+L   + Y+   DIWS+
Sbjct: 185 ALQAFDYSKISVKLGDFGLAKSLGASVEFATTYVGTPYYMSPEVLMD-QPYSPLSDIWSL 243

Query: 199 GVIFAELM-LRIPY 211
           G +  E+  LR P+
Sbjct: 244 GCVIYEMCTLRPPF 257

>KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces
           cerevisiae YIL035c CKA1 casein kinase II, catalytic
           alpha chain, start by similarity
          Length = 373

 Score = 81.6 bits (200), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 117/265 (44%), Gaps = 38/265 (14%)

Query: 2   STEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAV------------KEI---- 45
           +T I      ++Y    KVG G Y+ V+ G + ST  +I +            +EI    
Sbjct: 28  NTSIEWKANNSQYEVECKVGRGKYSEVFQGVQLSTRNKIVIKMLKPVKKKKIKREITILA 87

Query: 46  KTSEFKDGLDMSAIREVKY------------------LQEIQHDNVIELVDIFMAYDNLN 87
             S  K+        E KY                  L    H+N+I L+D+     +  
Sbjct: 88  NLSNEKNPPTAQPYDEAKYYTNRREEVLKYARDKVYDLPHNGHENIITLLDVVRDPISKT 147

Query: 88  LVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLS-P 146
             L F   D     +     F+  DI+ +M   L+ + +CH   I+HRD+KP+N+++   
Sbjct: 148 PALIFEHID-NTEFRRLYASFSDLDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHK 206

Query: 147 DGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELM 206
              +++ D+GLA     P       V +R+++ PELL   + Y  ++D+WS G + A ++
Sbjct: 207 QHKLRLIDWGLAEFY-HPSMEYNVRVASRFFKGPELLVDYRMYDYSLDLWSFGAMLASMV 265

Query: 207 -LRIPYLPGQNDIDQMEVTFRALGT 230
            L+ P+  G ++ DQ+    R LG+
Sbjct: 266 FLKEPFFYGSSNTDQLVKIVRVLGS 290

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score = 82.8 bits (203), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 114/252 (45%), Gaps = 48/252 (19%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR-EVKYLQEIQHDN 72
           Y+  K++G+G++AVVY G     GR IA+K +  S+ K+   +  +  E+  L++I+H +
Sbjct: 21  YSVEKEIGKGSFAVVYKGLSLRDGRNIAIKAVSRSKLKNKKLLENLEVEIAILKKIKHPH 80

Query: 73  VIELVDIFMAYDNLNLVLEFLP-SDLEVIIKDRSIL-------------FTPADIKSWML 118
           ++ L+D      +  L++E+    DL   IK R  L             + P   +   L
Sbjct: 81  IVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPPSTEHNGL 140

Query: 119 MTLRGVHHCHR----------NFILHRDLKPNNLLLS--------PDG------------ 148
             +  V++  +            ++HRD+KP NLLL         P              
Sbjct: 141 NRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFHELGFVGIYNL 200

Query: 149 -VIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELML 207
            ++K+ADFG AR +P+   +  +   +  Y APE+L   + Y +  D+WSVG +  E+  
Sbjct: 201 PILKIADFGFARFLPNT-SLAETLCGSPLYMAPEIL-NYQKYNAKADLWSVGTVLYEMCC 258

Query: 208 RIPYLPGQNDID 219
             P     N ++
Sbjct: 259 GRPPFKASNHLE 270

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 82.4 bits (202), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 105/219 (47%), Gaps = 25/219 (11%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKY-------LQEIQ 69
           G+ +G+G+Y+ V L T   +G++ A K I   E+     +   ++VKY       LQ + 
Sbjct: 203 GEALGDGSYSTVVLATCIESGKKYAAK-ILNKEY-----LIKQKKVKYVNIEKNTLQRLN 256

Query: 70  HDNVIELVDIFMAYD---NLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHH 126
              V  ++ ++  +    NL  +LE+ P+   + +  R    +    K +    L  +HH
Sbjct: 257 SSRVPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTLSEECTKYYGAQILDAIHH 316

Query: 127 CHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVP-----SPHEMLT---SNVVTRWYR 178
            H+  I+HRD+KP N+LL     IK+ DFG A+ +       P+++ T   S V T  Y 
Sbjct: 317 LHKQGIIHRDVKPENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAEYV 376

Query: 179 APELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQND 217
           +PELL    +  S  DIW+ G I  +++   P     N+
Sbjct: 377 SPELL-NDNYVDSRCDIWAFGCILFQMVAGKPPFKATNE 414

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 81.3 bits (199), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 110/209 (52%), Gaps = 15/209 (7%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEI 68
           ++  ++  G+K+G+G +  VY    + +G   A+K I+ +E    L  + ++++K   +I
Sbjct: 95  LSLKDFEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEI---LQFNLLKQLKREVDI 151

Query: 69  Q----HDNVIELVDIFMAYDNLNLVLEF-LPSDLEVIIKDRSILFTPADIKSWMLMTLRG 123
           Q    H N+I+L   F     + L++E  +  +L   +K+    F       ++      
Sbjct: 152 QLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGP-FNDVLASHYIYQIADA 210

Query: 124 VHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVP--SPHEMLTSNVVTRWYRAPE 181
           +H+ H+  I+HRD+KP N+L+  D V+K+ADFG +   P  S  + L   +    Y +PE
Sbjct: 211 LHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILNPEGSKRKTLCGTID---YLSPE 267

Query: 182 LLFGAKHYTSAIDIWSVGVIFAELMLRIP 210
           ++   + Y   +D+W++GV+  EL++ +P
Sbjct: 268 MI-TPREYDEQVDVWALGVLAYELVVGVP 295

>CAGL0I05192g complement(493635..494756) highly similar to sp|P15790
           Saccharomyces cerevisiae YIL035c CKA1 casein kinase II,
           start by similarity
          Length = 373

 Score = 81.3 bits (199), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 75/342 (21%), Positives = 152/342 (44%), Gaps = 72/342 (21%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAV------------------------------ 42
           +Y    KVG G Y+ V+ G + ++ + I +                              
Sbjct: 39  DYEIEMKVGRGKYSEVFQGVQLASRKHIVIKMLKPVKKKKIRREIKILTNLSNEKNPPTA 98

Query: 43  KEIKTSEFKDGLDMSAIREVK-YLQEI---QHDNVIELVDIFMAYDNLN----LVLEFLP 94
           +E     +    D + +++++ Y+ E+    H+N+I+L D+    D ++    LV E + 
Sbjct: 99  QEFNRDLYFSNRDENILKQIRPYIYELPHHGHENIIQLFDVIR--DPISRTPALVFEHVN 156

Query: 95  S-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLS-PDGVIKV 152
           + D  V+    S +    DI+ +M   L+ + +CH   I+HRD+KP+N+++      +++
Sbjct: 157 NMDFRVLYPKLSDI----DIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQRKLRL 212

Query: 153 ADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELML-RIPY 211
            D+GLA       E     V +R+++ PELL   + Y  ++D+WS G + A ++  + P+
Sbjct: 213 IDWGLAEFYHVNME-YNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMIFQKEPF 271

Query: 212 LPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSY-NKLQIYPPPSIDEL----------- 259
             G ++ DQ+    R LG+           F  Y  K QI  P    ++           
Sbjct: 272 FHGTSNTDQLVKIVRVLGS---------DDFEKYLIKYQITLPREFHDMDQYIRRPWYRF 322

Query: 260 ---RKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFK 298
              + R ++ +E+ ++ +  +L  + ++R  A E +   +F+
Sbjct: 323 VNDQNRHLSDNEDVIDLLDNLLRYDHQERLTAKEAMGHPWFE 364

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 82.4 bits (202), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 103/253 (40%), Gaps = 50/253 (19%)

Query: 20   VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAI-----REVKYLQEIQHDNVI 74
            +G GT+  VY       G  +AVKEIK     D   M  I      E+  L+ + H N++
Sbjct: 1040 IGGGTFGQVYSAINLENGEILAVKEIK---IHDTTTMKKIFPLIKEEMTVLEMLNHPNIV 1096

Query: 75   ELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILH 134
            +   + +  D +N+ +E+        + D   +      + +    L G+ + H++ ++H
Sbjct: 1097 QYYGVEVHRDKVNIFMEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVH 1156

Query: 135  RDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVV----------------TRWYR 178
            RD+KP N+LL  +G+IK  DFG AR V         N                  T  Y 
Sbjct: 1157 RDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYM 1216

Query: 179  APELLFGA--KHYTSAIDIWSVGVIFAELML---------------------RIPYLPGQ 215
            APE + G+  K    A D+W++G +  E+                       RIP LP +
Sbjct: 1217 APETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAGRIPQLPNR 1276

Query: 216  NDIDQMEVTFRAL 228
               D+M    RA 
Sbjct: 1277 ---DEMTAAGRAF 1286

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 82.0 bits (201), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 100/204 (49%), Gaps = 16/204 (7%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTG---RQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQ- 69
           Y  G  +GEG +  V LG  +S     + +A+K I+    +D +  ++ +EVK  +EI  
Sbjct: 56  YIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIR----RDTIPKNSEKEVKIYREINA 111

Query: 70  -----HDNVIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRG 123
                H N++ L ++      + +VL +    +    I+ +  L  PA  + +  + + G
Sbjct: 112 LKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQL-ISG 170

Query: 124 VHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELL 183
           VH+ H   + HRDLK  NLLL     + + DFG      S ++++ ++  +  Y APEL+
Sbjct: 171 VHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSPCYAAPELV 230

Query: 184 FGAKHYTS-AIDIWSVGVIFAELM 206
              K Y +   D+WS GVI   ++
Sbjct: 231 VTTKAYEARKADVWSCGVILYAML 254

>Scas_692.24
          Length = 718

 Score = 82.0 bits (201), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 95/190 (50%), Gaps = 16/190 (8%)

Query: 68  IQHDNVIELVDIFM--AYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVH 125
           + H NVIE VDIF     +    V+++ P D   ++   +   +  +I   +   L GV 
Sbjct: 271 LHHPNVIETVDIFSDSKQNKYFEVMQYCPVDFFAVV--MTGKMSRGEINCCLKQLLEGVK 328

Query: 126 HCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE----MLTSNVVTRWYRAPE 181
           + H   + HRDLK +N +++ DG++K+ DFG A     P+E    M    V +  Y APE
Sbjct: 329 YLHSMGLAHRDLKLDNCVMNEDGILKLIDFGSAVVFRYPYEDDIAMAHGIVGSDPYLAPE 388

Query: 182 LLFGAKHYT-SAIDIWSVGVIFAELML-RIPY-LPGQNDIDQMEVTFRALGTPTDKEWPE 238
           ++   K Y    +DIWSVG+I+  +ML R P+  P ++D +     FR    P D E   
Sbjct: 389 VITSTKSYDPQCVDIWSVGIIYCCMMLKRFPWKAPRESDDN-----FRLYSMPDDMEHDY 443

Query: 239 VSSFGSYNKL 248
           V S   + +L
Sbjct: 444 VESARHHEEL 453

>Scas_640.14*
          Length = 728

 Score = 82.0 bits (201), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 97/216 (44%), Gaps = 14/216 (6%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQST---------GRQIAVKEIKTSEFKDGLD--MSAIREV 62
           Y  G  +GEG +  V +G   ++          +Q+A+K I+    K G +  M   RE+
Sbjct: 38  YIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEMKIFREI 97

Query: 63  KYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLR 122
             L+ + H N++ L ++      + +VLE+           R      A         + 
Sbjct: 98  NSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRLFAQLIS 157

Query: 123 GVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPEL 182
           GV + H   I+HRDLK  NLLL     + + DFG      + +E++ ++  +  Y APEL
Sbjct: 158 GVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMKTSCGSPCYAAPEL 217

Query: 183 LFGAKHYTS-AIDIWSVGVIFAELMLRIPYLPGQND 217
           +   + Y +   DIWS G+I   ++    YLP  +D
Sbjct: 218 VITTEPYKARKADIWSCGIILYGML--AGYLPWDDD 251

>Kwal_55.21709
          Length = 340

 Score = 80.5 bits (197), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 132/298 (44%), Gaps = 33/298 (11%)

Query: 19  KVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHD-NVIELV 77
           K+G G Y+ V+ G          +K +K  +          RE+K L  +    NVI L+
Sbjct: 55  KIGRGKYSEVFRGKCVVNDEYCVIKVLKPVK-----LKKIYRELKILTNLTGGPNVIALL 109

Query: 78  DIFMAYDNLNLVLEFLPSDLE-VIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRD 136
           DI    D+ + +   +  +++ V  +   + FT  DI+ +    L  + +CH   I+HRD
Sbjct: 110 DIVQ--DSGSKIPALIFEEVKNVDFRTLYLKFTLPDIQYYFSQLLIALDYCHSMGIMHRD 167

Query: 137 LKPNNLLLSP-DGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDI 195
           +KP N+++ P +  +++ D+GLA     P       V +R+++ PELL     Y  ++D+
Sbjct: 168 VKPQNVMIDPVERKLRLIDWGLAEFY-HPGVDYNVRVASRYHKGPELLVNLNQYDYSLDL 226

Query: 196 WSVGVIFAELMLRI-PYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPP 254
           WSVG + A ++ +  P+  G  + DQ+    R LGT               NK  +  P 
Sbjct: 227 WSVGCMLAAIVFKKEPFFKGSTNPDQLVKIARVLGT--------TELLAYLNKYGLKLPR 278

Query: 255 SIDELRKRFIAAS-------------ENALNFMCGMLTMNPKKRWNAIECLESEYFKE 299
             D + K F   +                ++ +  +L  + ++R  A E L   +FK+
Sbjct: 279 EYDNIMKDFPRKTWSEFTTPDTPLVVPEVVDLIENLLRYDHQERLTAKETLAHAFFKK 336

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 81.6 bits (200), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 128/289 (44%), Gaps = 32/289 (11%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGL---DMSAIREVKYLQEIQHDNV 73
           GK  G+G    V +  K + G+  AVK  +    ++ L         E      ++H N+
Sbjct: 267 GKVPGKGVSGSVSV-IKSTDGQLFAVKRFRPRAPRETLKEYSRKVTSEFCTGSTLRHQNI 325

Query: 74  IELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFIL 133
           IE +D+    +   +V+E+ P D   ++    +  T  ++  +     RGV + H   + 
Sbjct: 326 IETLDMLQEGELFLVVMEYCPYDFFNLVMSNQM--TKHEVWCYFKQICRGVDYLHSQGLA 383

Query: 134 HRDLKPNNLLLSPDGVIKVADFGLA----RAVPSPHEMLTSNVVTRWYRAPELLFGAKHY 189
           HRDLK +N +++ DG++K+ DFG A        S  E     V +  Y APELL    + 
Sbjct: 384 HRDLKLDNCVVTADGILKLIDFGSAIIFRYNFNSKLEPAKGIVGSDPYLAPELLTQLYYD 443

Query: 190 TSAIDIWSVGVIFAELML-RIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKL 248
            SA D+WS+ V+F  + L R P+     D+     +F+      D E     S G Y  L
Sbjct: 444 PSAADVWSIAVMFYCMSLRRFPWKKPSEDVP----SFKLFCQKPDDE--NDHSKGPYRLL 497

Query: 249 QIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYF 297
           ++ P  +      R +         +  ML ++PKKR +  E ++  +F
Sbjct: 498 KLLPRAT------RLL---------ISRMLELDPKKRASITEIIQDPWF 531

>Scas_704.50
          Length = 369

 Score = 80.5 bits (197), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 80/344 (23%), Positives = 154/344 (44%), Gaps = 54/344 (15%)

Query: 2   STEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAV------------KEIK--- 46
           +T +       +Y    KVG G Y+ V+ G K +    I +            +EI    
Sbjct: 28  NTTVEWSTNNKDYEIEVKVGRGKYSEVFQGVKLNDRSPIVIKMLKPVKKKKIKREISILT 87

Query: 47  ----------TSEFKDGLDMSAIRE------VKYLQEIQHD---NVIELVDIFMAYDNLN 87
                     T  F   L  +  +E        YL ++ HD   N+I+L DI    D ++
Sbjct: 88  NLSNEKTPPTTLPFDVDLYYTNKKESVLKFKADYLYDLPHDGHKNIIQLFDIIK--DPIS 145

Query: 88  ----LVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNL 142
               LV E + + D  V+        T  DI+ +M   L+ + +CH   I+HRD+KP+N+
Sbjct: 146 KTPALVFEHVDNIDFRVLYPK----LTDMDIRYYMFELLKALDYCHSMGIMHRDVKPHNV 201

Query: 143 LLS-PDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVI 201
           ++   +  +++ D+GLA    +  E     V +R+++ PELL   + Y  ++D+WS G +
Sbjct: 202 MIDHKNKKLRLIDWGLAEFYHANME-YNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTM 260

Query: 202 FAELML-RIPYLPGQNDIDQMEVTFRALGTPTDKEW---PEVSSFGSYNKLQIY---PPP 254
            A ++  + P+  G ++ DQ+    R LG+   +++    E++    ++ +  Y   P  
Sbjct: 261 LASMVFQKEPFFHGTSNTDQLVKIVRVLGSEDFEKYLTKYEITLPREFHDMDQYIRRPWY 320

Query: 255 SIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFK 298
                  R +  +E+ ++ +  +L  + ++R  A E +   +F+
Sbjct: 321 RFINDANRHLCDNEDIIDLIDNLLKYDHQERLTAKEAMGHPWFE 364

>KLLA0A06820g complement(615686..618004) some similarities with
           sp|P38970 Saccharomyces cerevisiae YJL165c HAL5 ser/thr
           protein kinase, hypothetical start
          Length = 772

 Score = 81.6 bits (200), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 98/227 (43%), Gaps = 40/227 (17%)

Query: 20  VGEGTYAVVYLGTK---------------QSTGRQIAVKEIK--------------TSEF 50
           +G+G Y VV L  K                      AVKE+K              TSEF
Sbjct: 460 IGQGAYGVVKLCYKFIDPDEPDLKDNTYFHDNKLFYAVKELKPRPDEPPKKFSTRLTSEF 519

Query: 51  KDGLDMSAIREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPS-DLEVII----KDRS 105
             GL +S   + +      H N++ ++D+    +    V+EF PS DL  +I    K  S
Sbjct: 520 VIGLSLSGGNKSRRSSARTHPNILNVIDLMQTPNAFYEVMEFCPSGDLYSLITRSSKSDS 579

Query: 106 ILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPH 165
           +L  P +   +M   L G+ + H + + H D+KP NLL  P GV+K+ DFG +    +  
Sbjct: 580 VLH-PLEADCFMKQLLHGIQYMHAHGVAHCDIKPENLLFLPTGVLKICDFGTSSVFQTAW 638

Query: 166 E----MLTSNVVTRWYRAPELLFGAKHYTSA-IDIWSVGVIFAELML 207
           E      T    +  Y APE     + Y    +D WS G+I+  ++L
Sbjct: 639 EKKAHFQTGPAGSEPYVAPEEFIPKQQYDPRLVDCWSCGIIYCVMVL 685

>AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C
           (HAL5) - SH] (399738..401789) [2052 bp, 683 aa]
          Length = 683

 Score = 81.3 bits (199), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 91/191 (47%), Gaps = 26/191 (13%)

Query: 41  AVKEIK--------------TSEFKDGLDMSA-IREVKYLQEIQHDNVIELVDIFMAYDN 85
           A+KEIK              TSEF  G  +S      K L    H N+++++D+  A+D 
Sbjct: 409 AIKEIKPRADEPNEKFSTRLTSEFVIGHSLSGGAGGTKRL--TSHPNILKVLDLMQAHDV 466

Query: 86  LNLVLEFLPS-DLEVIIKDRSILFT---PADIKSWMLMTLRGVHHCHRNFILHRDLKPNN 141
              V EF PS DL  ++   S   +   P +   +M   L GV + H + + H DLKP N
Sbjct: 467 FIEVFEFCPSGDLFSLLTRSSKTGSGLHPLEADCFMKQLLNGVRYMHDHGVAHCDLKPEN 526

Query: 142 LLLSPDGVIKVADFGLARAVPSPHE----MLTSNVVTRWYRAPELLFGAKHY-TSAIDIW 196
           +L +P+G +K+ DFG +    +  E      T  V +  Y APE     + Y T  +D W
Sbjct: 527 ILFTPNGTLKLCDFGSSSVFQTAWEKRVHFQTGAVGSEPYVAPEEFIPKREYDTRLVDCW 586

Query: 197 SVGVIFAELML 207
           S G+I+  ++L
Sbjct: 587 SCGIIYCTMVL 597

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 81.3 bits (199), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 141/305 (46%), Gaps = 46/305 (15%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELVDI 79
           VG+G +A V    +++TG+  AVK I   +    +D    RE++ L+ + H  ++ L   
Sbjct: 223 VGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVD-GVTRELEVLRRLNHPRIVSLKGF 281

Query: 80  FMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLK 138
           +   ++  L++EF+   DL   +     +   A  +      L  V + H   I HRDLK
Sbjct: 282 YEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAG-REITRQILEAVRYIHEQGISHRDLK 340

Query: 139 PNNLLLSPDG--VIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFG---------AK 187
           P+N+L+  D   ++K+ DFGLA+ +      + +   T  Y APE++ G           
Sbjct: 341 PDNILIEQDDPVLVKITDFGLAK-IQDNTTFMKTFCGTLAYVAPEVIGGKNPEGNGANGN 399

Query: 188 HYTSAIDIWSVG-VIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYN 246
            Y+S +D+WS+G +++  L   +P+                 G+  ++ + ++++ GSY+
Sbjct: 400 LYSSLVDMWSIGCLVYVILTGHLPF----------------SGSTQEQLYKQIAN-GSYH 442

Query: 247 KLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSDP 306
           +           L+  +I  S+ A +F+  +L +NP  R  A   L+  +    P  S  
Sbjct: 443 E---------GPLKDYWI--SDEARDFIDSLLQINPVDRLTAERALQHPWLH--PCTSIG 489

Query: 307 SEIKI 311
           +EI +
Sbjct: 490 AEIAV 494

>KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1
           Kluyveromyces lactis cyclin-dependent kinase activating
           kinase 1, start by similarity
          Length = 321

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 76/141 (53%), Gaps = 14/141 (9%)

Query: 121 LRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAP 180
           + G+ + H N I+HRD+KP N++L+    + + DFG++      +E  T +  T  Y+AP
Sbjct: 122 IEGLVYIHGNGIIHRDVKPQNIMLNSYNEVVLGDFGISYNRNLDNEAKTCDCSTSIYKAP 181

Query: 181 ELLFGAKHYTSAIDIWSVGVIFAEL-------------MLRIPYLPGQNDIDQMEVTFRA 227
           ELLF   +Y   IDIW++ V+ ++L             ++ I +    +DI  +   F  
Sbjct: 182 ELLFSVSNYKFEIDIWALAVLISQLWNDKTQSKSKSSKVIDIDF-DECSDIKLVLTLFDK 240

Query: 228 LGTPTDKEWPEVSSFGSYNKL 248
            G P++++WP+V+   S+N +
Sbjct: 241 FGKPSNEDWPQVTKNESFNGM 261

>AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH]
           (707306..708355) [1050 bp, 349 aa]
          Length = 349

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/289 (22%), Positives = 120/289 (41%), Gaps = 64/289 (22%)

Query: 61  EVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDR------SILFTPADIK 114
           E++ LQ  QH N+I ++   +    + + + ++ +DL   ++        + L    D +
Sbjct: 44  ELRILQACQHSNIIPVLSATVEGGIVKICMPYVKTDLYAFMRQHYGGKHLAYLMPCLDSE 103

Query: 115 SW-------MLMTLRGVHHC----------HRNFILHRDLKPNNLLLSPDGVIKVADFGL 157
           +         L   R +H C          H   ++HRD+KP N+L+  +  + V DFG+
Sbjct: 104 ARGRRAQKNRLSMARTMHVCSQLADALAYLHGLGVIHRDIKPQNVLVDSNDHVYVIDFGV 163

Query: 158 A--------RAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRI 209
                    R      +    +V T  Y+APEL+F  ++Y   +D+WS+ V F++L  R 
Sbjct: 164 CYDTAQRGPRRYGETDDSKIPDVSTSIYKAPELMFSVRNYGLPVDVWSLAVTFSQLFQRY 223

Query: 210 PYLPG---------------QNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYP-- 252
               G                 DI  +   F+ LG P+ ++WP+V  +GS   + ++   
Sbjct: 224 ETPQGGIAAFVDDGAEELETGTDIRAVMSIFQQLGIPSQEQWPQVVRYGSSGFVGMFGTE 283

Query: 253 -----------PPSIDELRKRF-----IAASENALNFMCGMLTMNPKKR 285
                      P  + ++ + F     ++  E     + GML  + +KR
Sbjct: 284 GDGNYIFDKPWPEQLAKVEQLFPRLAEVSQHEELARMLLGMLHFDTQKR 332

>YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activating
           kinase (serine/threonine protein kinase) responsible for
           in vivo activation of Cdc28p, also involved in spore
           wall formation [1107 bp, 368 aa]
          Length = 368

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 105/231 (45%), Gaps = 54/231 (23%)

Query: 115 SWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGV-----IKVADFGLA-------RAVP 162
           S+    + G+   H N I+HRD+KP N++L+ +       + + DFG++       +   
Sbjct: 135 SFFRQMVEGIAFLHENKIIHRDIKPQNIMLTNNTSTVSPKLYIIDFGISYDMANNSQTSA 194

Query: 163 SPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVI----FAELMLRIPYLP----- 213
            P +   +++ T  Y+APE+LFG K Y   +D+WS+ +I    F     R+ ++P     
Sbjct: 195 EPMDSKVTDISTGIYKAPEVLFGVKCYDGGVDVWSLLIIISQWFQRETSRMGHVPAMIDD 254

Query: 214 GQNDIDQMEVTFR-------ALGTPTDKEWPEVSSFGSYN-------------------- 246
           G +D++     FR        LG P+ ++W EV+  GS +                    
Sbjct: 255 GSDDMNSDGSDFRLICSIFEKLGIPSIQKWEEVAQHGSVDAFVGMFGADGDGKYVLDQEK 314

Query: 247 KLQI----YPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLE 293
            +QI       P +DE+    +   +  +N + GM++ +P +RW+    L+
Sbjct: 315 DVQISIVERNMPRLDEIAD--VKVKQKFINCILGMVSFSPNERWSCQRILQ 363

>Kwal_33.14192
          Length = 577

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 131/307 (42%), Gaps = 65/307 (21%)

Query: 17  GKKVGEGT--------------YAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREV 62
           G+ +GEG               +AV     + S   QI   +  TSEF  G         
Sbjct: 224 GRTIGEGASGSVSVVESSDGKMFAVKRFRARGSRESQIEYSKKVTSEFCIG--------- 274

Query: 63  KYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDL-EVIIKDRSILFTPADIKSWMLMTL 121
                + H N+IE +D+     N  +V+E+ P D   +++ D   L +  +I  +     
Sbjct: 275 ---STLHHCNIIETLDMLQEGTNFLVVMEYCPYDFFNLVMSD---LMSKNEISCYFKQIC 328

Query: 122 RGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE---MLTSNVV-TRWY 177
            GV + HR  + HRDLK +N +++  G++K+ DFG A     P+E   +    +V +  Y
Sbjct: 329 NGVDYLHRMGLAHRDLKLDNCVVTKQGILKLIDFGSAVVFQYPYEKEILRAKGIVGSDPY 388

Query: 178 RAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWP 237
            APELL    +    +D+WS+ ++F  + L+    P +   D+ + +FR      D E  
Sbjct: 389 LAPELLSHPSYDPRPVDVWSIAIMFYCITLK--RFPWKAPRDKYQ-SFRLFCEGADSE-- 443

Query: 238 EVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKR----------W- 286
             S+ G +  L++ P                ++   +  ML ++PK+R          W 
Sbjct: 444 RDSTRGPFRLLKLLP---------------RHSRPVISQMLQLDPKRRILMDGVVSDPWV 488

Query: 287 NAIECLE 293
            +IEC +
Sbjct: 489 KSIECCQ 495

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 128/285 (44%), Gaps = 34/285 (11%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVK-EIKTSEFKDGLDMSAIREVKYLQEIQHDN 72
           Y   + +G G++ VV    +  +   +AVK  +K +  K+G       E+  +Q + H N
Sbjct: 65  YLFQRTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPN 124

Query: 73  VIELVDIFMAYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRN 130
           +++  D F       +V +        + I+ D    +T  D  + ++  L+ V + H  
Sbjct: 125 IVKFKDWFETESKFYIVTQLASGGELFDRIMHDGK--YTEEDAVNIVVQILKAVEYLHSQ 182

Query: 131 FILHRDLKPNNLLL---SPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAK 187
            I+HRDLKP NLL    S D  I +ADFG+AR + +  +++     +  Y APE +F + 
Sbjct: 183 NIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPE-VFTSD 241

Query: 188 HYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNK 247
            +    DIWSVGVI   L+    Y P           F+A     D    EV+S  +  K
Sbjct: 242 GHGKPSDIWSVGVITYTLL--CGYSP-----------FKA--ESVDGFLDEVTSDENPVK 286

Query: 248 LQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECL 292
            Q          R  +   SE A NF+  +L ++P  R +A E L
Sbjct: 287 FQ----------RPYWDGISELAKNFILRILDLDPACRPSATELL 321

>Scas_707.7
          Length = 376

 Score = 79.0 bits (193), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 104/221 (47%), Gaps = 49/221 (22%)

Query: 123 GVHHCHRNFILHRDLKPNNLLLS--PDGVIK--VADFGLARAVPSPHEML-------TSN 171
           G++  H   I+HRD+KP N++L    DG I   + DFG++    +P + L        ++
Sbjct: 151 GINSIHEQKIIHRDIKPQNVMLEIHDDGSISLLITDFGISYDHEAPADKLREPPLQKITD 210

Query: 172 VVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLR-------IP--------YLPGQN 216
           V T +Y++PELLFG K+Y   +DIW++ V+ ++   +       +P         L   +
Sbjct: 211 VSTSFYKSPELLFGIKNYEFEVDIWALLVLLSQFFQKETNIENFVPSMFDDGSGVLDSGS 270

Query: 217 DIDQMEVTFRALGTPTDKEWPEVSSFGSYNKL----------QIYPPPSIDELRKRFI-- 264
           DI  +   F  +GTP  K+WP+V  +GS +            +     S +  ++R +  
Sbjct: 271 DIRLIFSIFEMVGTPGVKDWPKVIEYGSKDAFVGMFGEKGDGRYILHESFENQKRRVLND 330

Query: 265 ----------AASENAL-NFMCGMLTMNPKKRWNAIECLES 294
                        +N L + + GM+    ++RW++ + LES
Sbjct: 331 WMPRLYELNNETQKNTLIDCILGMVPFASEQRWSSKQLLES 371

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score = 79.7 bits (195), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 125/262 (47%), Gaps = 16/262 (6%)

Query: 18   KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYL----QEIQHDNV 73
            K +G+G +  V L   ++T    A+K +K        D+ + R  K +     E +H  +
Sbjct: 838  KVLGKGNFGKVLLARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLLATETKHPFL 897

Query: 74   IELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFI 132
              L   F   + +   +EF+   DL   +++R +    A  K +    L  + + H N +
Sbjct: 898  TNLYCSFQTENRIYFAMEFIGGGDLMWHVQNRRLSVRRA--KFYAAEVLLSLKYFHDNGV 955

Query: 133  LHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192
            ++RDLK  N+LL+P+G IK+AD+GL +         ++   T  + APE+L G + YT A
Sbjct: 956  IYRDLKLENILLTPEGHIKIADYGLCKDNMWYGNKTSTFCGTPEFMAPEILKG-QAYTKA 1014

Query: 193  IDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYP 252
            +D W+ GV+  +++L      G+   D+ EV F A+   TD+    +   G    +QI+ 
Sbjct: 1015 VDWWTFGVLLYQMLLCQSPFSGE---DEDEV-FNAI--LTDEPLYPIDMAGDI--VQIFQ 1066

Query: 253  PPSIDELRKRFIAASENALNFM 274
                 +  KR  A  ++AL  M
Sbjct: 1067 GLLTKDPEKRLGAGPKDALEIM 1088

>CAGL0L07810g complement(857656..859446) similar to sp|P25333
           Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, start by
           similarity
          Length = 596

 Score = 79.0 bits (193), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 127/297 (42%), Gaps = 44/297 (14%)

Query: 20  VGEGTYAVVYLGTKQ-----STGRQIAVKEIK--TSEFKDGLDMSAIREVKYLQEIQHDN 72
           +G+G + VV +  K+        +  AVKE K   +E K+        E      + H N
Sbjct: 300 LGKGAFGVVRICHKKVPENPKVEKLYAVKEFKRKATEPKEKFAKRLTSEFCISSSLHHTN 359

Query: 73  VIELVDIFM-AYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIKSWMLMTLRGVHHCHR 129
           +++ +D+F  A  +   V+E+        +II    + +  AD   +    LRGV + H 
Sbjct: 360 IVDTLDLFQDANGDYCEVMEYCAGGDLFTLIIAAGKLEYMEADC--FFKQLLRGVVYMHD 417

Query: 130 NFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE---MLTSNVV-TRWYRAPELLFG 185
             + HRDLKP NL+L+ DGV+K+ DFG +       E    L+  V  +  Y APE    
Sbjct: 418 MGVCHRDLKPENLILTHDGVLKITDFGNSECFKMAWEEDIHLSGGVCGSSPYIAPEEYVL 477

Query: 186 AKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF--G 243
            +     +DIW+ GVI+  + +R               T R L T   K+ P  + +  G
Sbjct: 478 EEFDPRPVDIWACGVIY--MAMR---------------TGRQLWTAAKKDDPFYNKYLQG 520

Query: 244 SYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEM 300
              K    P  S+   R R         N +  ML   P +R N  + L SE+ +E+
Sbjct: 521 RRQKSGYEPIESLKRARCR---------NVIYSMLDPAPHRRINGKQILNSEWGREI 568

>YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine protein
           kinase involved in sensitivity to salt [1812 bp, 603 aa]
          Length = 603

 Score = 79.0 bits (193), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 127/300 (42%), Gaps = 47/300 (15%)

Query: 20  VGEGTYAVVYLGTKQSTGRQ--------IAVKEIK--TSEFKDGLDMSAIREVKYLQEIQ 69
           +G+G + VV +  K++   Q         AVKE K  TSE  +        E      + 
Sbjct: 322 LGKGAFGVVRICQKKNVSSQDGNKSEKLYAVKEFKRRTSESAEKYSKRLTSEFCISSSLH 381

Query: 70  HDNVIELVDIFM-AYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIKSWMLMTLRGVHH 126
           H N++  +D+F  A      V+E+        +++    + +  AD   +    +RGV +
Sbjct: 382 HTNIVTTLDLFQDAKGEYCEVMEYCAGGDLFTLVVAAGKLEYMEADC--FFKQLIRGVVY 439

Query: 127 CHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE---MLTSNVV-TRWYRAPEL 182
            H   + HRDLKP NLLL+ DGV+K+ DFG +       E    L+  V  +  Y APE 
Sbjct: 440 MHEMGVCHRDLKPENLLLTHDGVLKITDFGNSECFKMAWEKNIHLSGGVCGSSPYIAPEE 499

Query: 183 LFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF 242
               +     +DIW+ GVI+  + +R               T R L +  +K+ P   ++
Sbjct: 500 YIKEEFDPRPVDIWACGVIY--MAMR---------------TGRQLWSSAEKDDPFYMNY 542

Query: 243 --GSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEM 300
             G   K    P  S+   R R         N +  ML   P +R N  + L SE+ +E+
Sbjct: 543 LKGRKEKGGYEPIESLKRARCR---------NVIYSMLDPVPYRRINGKQILNSEWGREI 593

>KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase, start by
           similarity
          Length = 774

 Score = 79.0 bits (193), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 98/208 (47%), Gaps = 9/208 (4%)

Query: 8   PITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIK---TSEFKDGLDMSAIREVKY 64
           P ++     G+ +G G    V L  + S  +  AVKE +     E K         E   
Sbjct: 417 PFSKRYLKTGENLGAGAGGSVRLMKRISDNQVFAVKEFRPKFEHESKRDYVKKITSEYCI 476

Query: 65  LQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGV 124
              ++H N+I  ++I    + +  V+E+   DL  I+    + +   +I       L GV
Sbjct: 477 GTTLRHPNIISTIEIVYENNRIFQVMEYCDYDLFAIVMSNKMSY--EEICCCFKQILTGV 534

Query: 125 HHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE---MLTSNVV-TRWYRAP 180
            + H   + HRD+K +N +++  G++K+ DFG A     PH    + +S +V +  Y AP
Sbjct: 535 EYLHSIGLAHRDMKLDNCVINNQGIVKLIDFGAAEVFSYPHSKTLIESSGIVGSDPYLAP 594

Query: 181 ELLFGAKHYTSAIDIWSVGVIFAELMLR 208
           E+    K+    +DIWSV ++FA ++L+
Sbjct: 595 EVCIFTKYDPRPVDIWSVAILFACMVLK 622

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 79.0 bits (193), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 82/306 (26%), Positives = 120/306 (39%), Gaps = 52/306 (16%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDN---VIE 75
           +G+GT+  VY   K+ T R  A+K + K    K       I E   L          ++ 
Sbjct: 346 LGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTSSKASPFIVG 405

Query: 76  LVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHR 135
           L   F    +L LV +++          R   FT    K ++   +  + H H N I++R
Sbjct: 406 LKFSFQTPTDLYLVTDYMSGGELFWHLQREGRFTEDRAKFYIAELVLALEHLHDNDIVYR 465

Query: 136 DLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDI 195
           DLKP N+LL  +G I + DFGL++A     +   +   T  Y APELL     YT  +D 
Sbjct: 466 DLKPENILLDANGNIALCDFGLSKA--DLKDRTNTFCGTTEYLAPELLLDESGYTKMVDF 523

Query: 196 WSVGVIFAELMLR-IPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPP 254
           WS+GV+  E+     P+    N     ++ F  +  P D   PE  S             
Sbjct: 524 WSLGVLIFEMCCGWSPFYAEDNQKMYQKIAFGKVKFPRDILSPEGRS------------- 570

Query: 255 SIDELRKRFIAASENALNFMCGMLTMNPKKRWNAI----ECLESEYF----------KEM 300
                             F+ G+L  NPK R  AI    E     +F          K++
Sbjct: 571 ------------------FVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWELLKQKKI 612

Query: 301 PPPSDP 306
           PPP  P
Sbjct: 613 PPPFKP 618

>Scas_651.19
          Length = 801

 Score = 78.6 bits (192), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 110/246 (44%), Gaps = 42/246 (17%)

Query: 1   MSTEITTPITQTEYTKG-KKVGEGTYAVVYLGTKQ-------------STGRQI--AVKE 44
           ++ ++  P    +Y K    +G G Y VV +  +              S G+++  AVKE
Sbjct: 475 VNADVKLPCFLEQYGKSIGTIGHGAYGVVKVCARPLNPNIDETPLQTFSNGQKLFFAVKE 534

Query: 45  IK--------------TSEFKDGLDMSAIREVKYLQEIQHDNVIELVDIFMAYDNLNLVL 90
           +K              TSEF  G  +S  R  K    +   N+++++D+    D    V+
Sbjct: 535 LKLKNATQTEKFSTRITSEFIIGHSLS--RSHKKGDRVS-PNILKIIDLLENNDTFFEVM 591

Query: 91  EFLPS-DLEVIIKDRS---ILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSP 146
           EF PS DL  ++  +S       P +   +M   L GV + H + + H DLKP N+L  P
Sbjct: 592 EFCPSGDLYSLLTRKSKNGTALHPLEADCFMKQLLHGVKYMHDHGVAHCDLKPENILFHP 651

Query: 147 DGVIKVADFGLARAVPSP---HEMLTSNVV-TRWYRAPELLFGAKHYT-SAIDIWSVGVI 201
           DG++K+ DFG +    +    H    S  + +  Y APE     K Y    +D WS GV+
Sbjct: 652 DGLLKICDFGTSCVFQTAWEKHVHFQSGAMGSEPYVAPEEFISGKEYDPRLVDCWSCGVV 711

Query: 202 FAELML 207
           +  +++
Sbjct: 712 YCTMVM 717

>KLLA0C07535g 658746..660620 some similarities with sgd|S0005793
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 624

 Score = 78.6 bits (192), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 114/244 (46%), Gaps = 19/244 (7%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR---EVKYLQEIQHDNV 73
           GK +G G    V +  + S G   AVK+ ++ +  + +   A +   E      + H N+
Sbjct: 219 GKVLGSGAGGSVKVLVRPSDGAMFAVKQFRSRKPNEPIRDYARKCTSEFCVGSMLHHPNI 278

Query: 74  IELVDIFMAYDNLNL--VLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNF 131
           IE +DIF          V+E+ P D   ++   S   +  +I       +  V++ H   
Sbjct: 279 IETLDIFSDAKQTQYYQVMEYCPVDFFAVV--MSGEMSRGEINCCFKQLVEAVNYLHSKG 336

Query: 132 ILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE---MLTSNVV-TRWYRAPELLFGAK 187
             HRDLK +N +++ +G++K+ DFG A      +E    L   +V +  Y APE+L  + 
Sbjct: 337 YAHRDLKLDNCVMTKEGILKLIDFGSAFVYKYTYENDTKLAHGIVGSDPYLAPEVLVHSN 396

Query: 188 HYTSA-IDIWSVGVIFAELML-RIPY-LPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGS 244
            Y +  +DIWS+G+IF  +ML R P+ +P  +D++     F     P D E   V S   
Sbjct: 397 GYDAPMVDIWSMGIIFCCMMLKRFPWKVPKDSDVN-----FSLYCMPDDVEHDYVKSAQE 451

Query: 245 YNKL 248
           +  L
Sbjct: 452 HEAL 455

>Kwal_33.13112
          Length = 505

 Score = 78.2 bits (191), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 101/193 (52%), Gaps = 4/193 (2%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELVDI 79
           VG+G++  VY    + TG  +AVK I   E +D +D+ A +E+ +L E++   V      
Sbjct: 42  VGKGSFGDVYRAIDKETGEMVAVKIINLEETQDDIDVLA-QEIYFLSELRAPFVTTYYKT 100

Query: 80  FMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLM-TLRGVHHCHRNFILHRDL 137
           ++   ++ +V+EF        ++K       P +  ++++   L G+ + H    +HRD+
Sbjct: 101 YVEDVSMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLHSQRKIHRDV 160

Query: 138 KPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWS 197
           K  N+LL+ +G +K+ DFG++  + +  +  T  V T ++ APE++     Y    DIWS
Sbjct: 161 KAANILLTDEGEVKLGDFGVSGQIMATLKRNTF-VGTPYWMAPEIIARDNGYDEKADIWS 219

Query: 198 VGVIFAELMLRIP 210
           +G+   EL+   P
Sbjct: 220 LGITAMELLTGQP 232

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 78.6 bits (192), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 97/196 (49%), Gaps = 13/196 (6%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           Y   K++GEG++  VYL T + T +++ +K        D  D + +REV Y ++  +  +
Sbjct: 42  YKIQKQIGEGSFGKVYLATHRPTKQKVVLKT------GDKSDPNVVREVFYHRQFDYPYI 95

Query: 74  IELVDIFMAYDNLNLVLEFLPSDL---EVIIKDRSILFTPADIKSWMLMTLRGVHHCHRN 130
            +L ++ +    + + LE+ P       ++ K R      A++ + +      VH+ H  
Sbjct: 96  TKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQITG---AVHYAHTL 152

Query: 131 FILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYT 190
             +HRDLK  N+LL  +G  K+ DFG  R   +   +L +   T  Y APE++    +  
Sbjct: 153 NCVHRDLKLENVLLDKNGNAKLTDFGFTRESMT-KAVLETVCGTTVYMAPEMIQHKPYDG 211

Query: 191 SAIDIWSVGVIFAELM 206
             +DIWS+GVI   L+
Sbjct: 212 FKVDIWSLGVILYTLL 227

>YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kinase
           II (protein kinase CK2), catalytic (alpha) subunit [1119
           bp, 372 aa]
          Length = 372

 Score = 77.4 bits (189), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 91/170 (53%), Gaps = 18/170 (10%)

Query: 70  HDNVIELVDIFMAYDNLN----LVLEFLPSDLEVIIKDRSILF---TPADIKSWMLMTLR 122
           H N+I L DI    D ++    LV E++ +       D  IL+   T  +I+ +M   L+
Sbjct: 130 HANIIHLFDIIK--DPISKTPALVFEYVDN------VDFRILYPKLTDLEIRFYMFELLK 181

Query: 123 GVHHCHRNFILHRDLKPNNLLLS-PDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPE 181
            + +CH   I+HRD+KP+N+++   +  +++ D+GLA       E     V +R+++ PE
Sbjct: 182 ALDYCHSMGIMHRDVKPHNVMIDHKNKKLRLIDWGLAEFYHVNME-YNVRVASRFFKGPE 240

Query: 182 LLFGAKHYTSAIDIWSVGVIFAELML-RIPYLPGQNDIDQMEVTFRALGT 230
           LL   + Y  ++D+WS G + A ++  R P+  G ++ DQ+    + LGT
Sbjct: 241 LLVDYRMYDYSLDLWSFGTMLASMIFKREPFFHGTSNTDQLVKIVKVLGT 290

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score = 78.6 bits (192), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 80/151 (52%), Gaps = 6/151 (3%)

Query: 13  EYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDN 72
           +Y   K + +G Y  VYL  K+ TG   A+K +K S+      ++ ++  + +  +Q D 
Sbjct: 701 DYDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSDK 760

Query: 73  --VIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPAD-IKSWMLMTLRGVHHCH 128
             V  L   F   +NL LV+++L   D+  +IK    L  P    K ++   + GV   H
Sbjct: 761 PYVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGNL--PEKWAKQYICEVISGVDDMH 818

Query: 129 RNFILHRDLKPNNLLLSPDGVIKVADFGLAR 159
           +N I+H DLKP+NLL+   G IK+ DFGL+R
Sbjct: 819 QNGIIHHDLKPDNLLIDSLGHIKLTDFGLSR 849

>Scas_700.28
          Length = 896

 Score = 78.6 bits (192), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 91/189 (48%), Gaps = 9/189 (4%)

Query: 19  KVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELVD 78
           ++GEG++  VYL   + T  ++ +K        D  D + +REV Y ++  +  + +L +
Sbjct: 43  QIGEGSFGKVYLAQHRPTHTKVVLKS------SDKNDPNIVREVFYHRQFDYPYITKLYE 96

Query: 79  IFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPAD-IKSWMLMTLRGVHHCHRNFILHRDL 137
           + +    + + LE+ P   E+  +  S+   P D         + GVH+ H    +HRDL
Sbjct: 97  VIITETKVWMALEYCPGK-ELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHSLNCVHRDL 155

Query: 138 KPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWS 197
           K  N+LL   G  K+ DFG  R   +    L +   T  Y APEL+    +    IDIWS
Sbjct: 156 KLENILLDKSGDAKLTDFGFTRECMT-KTTLETICGTTVYMAPELIERKSYDGFKIDIWS 214

Query: 198 VGVIFAELM 206
           +GVI   ++
Sbjct: 215 LGVILYTMI 223

>Scas_715.34
          Length = 1150

 Score = 78.6 bits (192), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 98/199 (49%), Gaps = 16/199 (8%)

Query: 18   KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYL----QEIQHDNV 73
            K +G+G +  V L   ++TGR  A+K +K        D+ + R  K +     + +H  +
Sbjct: 827  KVLGKGNFGKVILSRSKNTGRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFL 886

Query: 74   IELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFI 132
              L   F   + +   +EF+   DL   ++++ +    A  K +    L  + + H N +
Sbjct: 887  TNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLLALKYFHDNGV 944

Query: 133  LHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELL----FGAKH 188
            ++RDLK  N+LL+P G IK+AD+GL +      EM  +N  + +   PE +       + 
Sbjct: 945  IYRDLKLENILLTPQGHIKIADYGLCK-----DEMWYNNKTSTFCGTPEFMAPEILKEQG 999

Query: 189  YTSAIDIWSVGVIFAELML 207
            YT A+D W+ GV+  +++L
Sbjct: 1000 YTRAVDWWAFGVLLYQMLL 1018

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 78.2 bits (191), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 107/223 (47%), Gaps = 14/223 (6%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQST----GRQIAVKEIK--TSEFKDGLDMSAIREV 62
           +T   Y  G  +GEG +  V LG  ++      R +A+K I+  T       ++   RE+
Sbjct: 40  VTFGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKEIKIYREL 99

Query: 63  KYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIKSWMLMT 120
             L+ + H N++ L ++      + +VL++       + I K R +   PA      L++
Sbjct: 100 NALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLFAQLIS 159

Query: 121 LRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAP 180
             GVH+ H   + HRDLK  NLLL     + + DFG        ++++ ++  +  Y AP
Sbjct: 160 --GVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEF-HKNDLMRTSCGSPCYAAP 216

Query: 181 ELLFGAKHYTSA-IDIWSVGVIFAELMLRIPYLPGQNDIDQME 222
           EL+  +K Y++   D+WS GVI   ++    YLP  +D +  E
Sbjct: 217 ELVVSSKPYSAQKADVWSCGVILYAMLAG--YLPWDDDPENPE 257

>Kwal_47.17252
          Length = 872

 Score = 78.2 bits (191), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 82/346 (23%), Positives = 145/346 (41%), Gaps = 78/346 (22%)

Query: 13  EYTKGKKVGEGTYAVVYLG---TKQSTGRQIAVKEIKTSEFKDGLDMSAIR-EVKYLQEI 68
           +Y   +++G+G++A VY G   + +     IA+K +  S+ K+   +  +  E+  L++I
Sbjct: 19  KYLVQQEIGKGSFATVYKGRIASNRDLNDFIAIKAVSRSKLKNKKLLENLEIEIAILKKI 78

Query: 69  QHDNVIELVDIFMAYDNLNLVLEFLP-SDLEVIIKDRSILFT--------------PAD- 112
           +H +++ L+D      +  L++E+    DL  +IK R  L                P++ 
Sbjct: 79  KHPHIVGLMDCERTGADFFLIMEYCALGDLTFLIKKRGGLIEKHPLVRTMFEKYPPPSES 138

Query: 113 --------IKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGV--------------- 149
                   + S++      +       ++HRD+KP NLLLS   V               
Sbjct: 139 HNGLNRVVVVSYLQQLSSALMFLRSKNLVHRDIKPQNLLLSTPLVNYSDRETFHKMGFVG 198

Query: 150 ------IKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFA 203
                 +K+ADFG AR +P+   +  +   +  Y APE+L   K Y +  D+WSVG +  
Sbjct: 199 IYNLPILKIADFGFARFLPNT-SLAETLCGSPLYMAPEILDYQK-YNAKADLWSVGTVLY 256

Query: 204 ELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSIDELRKRF 263
           E+    P     N ++  +   RA          +V SF ++ K+     P + EL    
Sbjct: 257 EMCCGRPPFKASNHLELFKKIKRA---------NDVISFPTHCKVD----PQMREL---- 299

Query: 264 IAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSDPSEI 309
                     +CG+LT +P +R    E   +E   E   P +   I
Sbjct: 300 ----------ICGLLTFDPSQRMGFNEFFSNEVVNEDLSPYEEEHI 335

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 77.4 bits (189), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 118/271 (43%), Gaps = 57/271 (21%)

Query: 12  TEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHD 71
            E+   +++G G++  V       T + +  KEIK            I E   L  ++H+
Sbjct: 25  NEFKVLEEIGRGSFGSVRKVLHVPTSKLMVRKEIKYGHMNSKERQQLIAECTILAGLRHE 84

Query: 72  NVIELVDIFMA---------YDN---LNLVLEFLP-SDLEVIIKDRSIL--FTPA-DIKS 115
           N++E  +   A         Y N   L L +E+    DL  +IK    +  + P  DI  
Sbjct: 85  NIVEFYNWDHASSRTGNSVDYGNGEVLYLYMEYCSCGDLSQMIKHYKGMRKYVPERDIWR 144

Query: 116 WMLMTLRGVHHCHRNF--------------------------ILHRDLKPNNLLLSPDGV 149
             +  L  ++ CH +                           ++HRDLKP N+ L+ DGV
Sbjct: 145 IAVQLLLALYKCHTSCDLPQLDTIYDKISKSAIESEAGKVTSVIHRDLKPGNIFLTGDGV 204

Query: 150 ------------IKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWS 197
                       +K+ DFGLA+++ S  E  T+ V T +Y +PE+L   + Y+   DIWS
Sbjct: 205 GGRGSVDYSKVEVKLGDFGLAKSLQSAIEFATTYVGTPYYMSPEVLMD-QPYSPLSDIWS 263

Query: 198 VGVIFAELM-LRIPYLPGQNDIDQMEVTFRA 227
           +G +  EL  LR+P+ P +N ++   +  RA
Sbjct: 264 LGCVIYELCALRVPF-PARNFMELQRMIQRA 293

>ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH]
           (1263082..1265541) [2460 bp, 819 aa]
          Length = 819

 Score = 78.2 bits (191), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 87/322 (27%), Positives = 139/322 (43%), Gaps = 68/322 (21%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEI 68
           +  +EY K + +G G  + VY   + S+ R  A+K +   EF D        E++ L+++
Sbjct: 487 VNGSEYEKVELLGRGGSSKVY-KVRNSSNRIYALKRVSFDEFDDASADGFKGEIELLKKL 545

Query: 69  QHDN-VIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIK------SWMLMTL 121
           ++   V++L+D  M +  L +V+E    DL  ++  RS +  P DI+        ML  +
Sbjct: 546 ENQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRSSM--PLDIEFVRYHAQEMLKCV 603

Query: 122 RGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEM---LTSNVVTRWYR 178
           + VH      I+H DLKP N +    G++K+ DFG+A AVP  H +     + + T  Y 
Sbjct: 604 KVVHDA---GIVHSDLKPANFVFV-KGILKIIDFGIANAVPD-HTVNIYRDTQIGTPNYM 658

Query: 179 APELLFGAKHYTS------------------AIDIWSVGVIFAELML-RIPY--LPGQND 217
           APE L  A +YT                     DIWS G I  +++  + PY    GQN 
Sbjct: 659 APEALV-AMNYTQDSDQIQQEMHHNRWKVGKPSDIWSCGCIMYQMIYGKPPYGSFQGQNR 717

Query: 218 IDQMEVTFRALGTPTDK-EWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCG 276
           +        A+  P  K  +PE +  G +                        AL+ +  
Sbjct: 718 L-------LAIMNPEVKIVYPEKTPTGDF--------------------VPRTALDTIKA 750

Query: 277 MLTMNPKKRWNAIECLESEYFK 298
            L  NP++RW   E L   + K
Sbjct: 751 CLERNPERRWTVDELLRGPFIK 772

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 78.2 bits (191), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 128/289 (44%), Gaps = 45/289 (15%)

Query: 14  YTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           Y   K +GEG++  VYL T + T +++ +K        +  D + +REV Y ++     +
Sbjct: 37  YKISKFIGEGSFGKVYLATHRLTHQKVVLKT------GNKRDPNVVREVFYHRQFDFPYI 90

Query: 74  IELVDIFMAYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNF 131
            +L ++ +    + +VLE+       E ++K++ +    +  K         V++ H   
Sbjct: 91  TKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEES--KKLFSQIASAVYYAHELK 148

Query: 132 ILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTS 191
            +HRDLK  N+LL  +G  K+ DFG  R + +  ++ T    T  Y APEL+    +   
Sbjct: 149 CVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETI-CGTTVYMAPELIERKCYDGF 207

Query: 192 AIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTD--KEWPEVSSFGSYNKLQ 249
            +DIWS+G+I   ++    Y+P   D D ++   + +    D  +EW             
Sbjct: 208 KVDIWSLGIILYTMI--NGYMPFDED-DDIKTKLKIVNDELDFNQEW------------- 251

Query: 250 IYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFK 298
                            S++A++ + GML  NP +R +  + L   + +
Sbjct: 252 ----------------ISDDAIDLIQGMLRKNPNERISLAQVLSHPFLQ 284

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 82/309 (26%), Positives = 122/309 (39%), Gaps = 52/309 (16%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDN---VIE 75
           +G+GT+  VY   K+ T R  A+K + K    K       I E   L      +   ++ 
Sbjct: 331 LGKGTFGQVYQVRKKDTMRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKSSPFIVG 390

Query: 76  LVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHR 135
           L   F    +L LV +F+          +   FT    K ++   +  + + H N I++R
Sbjct: 391 LKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTEDRAKFYIAELVLALEYLHDNDIVYR 450

Query: 136 DLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDI 195
           DLKP N+LL  +G I + DFGL++A     +   +   T  Y APELL     YT  +D 
Sbjct: 451 DLKPENILLDANGNIALCDFGLSKA--DLKDRTNTFCGTTEYLAPELLMDETGYTKMVDF 508

Query: 196 WSVGVIFAELMLR-IPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPP 254
           WS+GV+  E+     P+    N     ++ F  +  P D   PE  S             
Sbjct: 509 WSLGVLIFEMCCGWSPFFASDNQKMYQKIAFGKVKFPRDVLSPEGRS------------- 555

Query: 255 SIDELRKRFIAASENALNFMCGMLTMNPKKRWNAI----ECLESEYF----------KEM 300
                             F+ G+L  NPK R  AI    E     +F          K++
Sbjct: 556 ------------------FVKGLLNRNPKHRLGAIDDGRELRAHPFFNDIDWEAVRQKKI 597

Query: 301 PPPSDPSEI 309
           PPP  P  I
Sbjct: 598 PPPFKPHLI 606

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 135/325 (41%), Gaps = 78/325 (24%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGR-QIAVKEIKTSEFKDGLDMSAIR-EVKYLQ 66
           I   +Y   K++G+G++A VY G   +  +  IAVK +  S+ K+   +  +  E+  L+
Sbjct: 6   IQDGKYVVEKEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILK 65

Query: 67  EIQHDNVIELVDIFMAYDNLNLVLEFLP-SDLEVIIKDRSIL------------------ 107
           +I+H +++ L+D      +  LV+++    DL  +IK R  L                  
Sbjct: 66  KIKHPHIVGLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPS 125

Query: 108 -----FTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSP------DG-------- 148
                   A +  ++      +       ++HRD+KP NLLL+       D         
Sbjct: 126 KEHNGLNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGY 185

Query: 149 -------VIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVI 201
                  ++K+ADFG AR +PS   +  +   +  Y APE+L   + Y +  D+WSVG +
Sbjct: 186 VGIYNLPILKIADFGFARFLPST-SLAETLCGSPLYMAPEIL-NYQKYNAKADLWSVGTV 243

Query: 202 FAELMLRIPYLPGQNDIDQMEVTFRALGTPTDK-EWPEVSSFGSYNKLQIYPPPSIDELR 260
             E+   +P     N ++     F+ +    D+  +PEV                 D L+
Sbjct: 244 LFEMCCGVPPFTASNHLE----LFKKIKRAHDEINFPEVCEVE-------------DGLK 286

Query: 261 KRFIAASENALNFMCGMLTMNPKKR 285
           +            +C +LT +P KR
Sbjct: 287 E-----------LICSLLTFDPAKR 300

>Kwal_14.1249
          Length = 344

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 23/145 (15%)

Query: 123 GVHHCHRNFILHRDLKPNNLLLSPDG-----VIKVADFGLARAVPSPHEMLTS---NVVT 174
            + + H + I+HRD+K  N+++  DG      + + DFG+A    +  E   S   +V T
Sbjct: 128 ALSNLHEHKIIHRDVKLQNVMVDEDGPHDIPQLVLIDFGIAYDPETSQEAADSKITDVST 187

Query: 175 RWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLR-------IP--------YLPGQNDID 219
             Y+APELLF  K+Y+SA DIWS+ V+ ++L          IP         L   +DI 
Sbjct: 188 SIYKAPELLFSVKNYSSAADIWSLMVLVSQLFQTESSSDRFIPAFVSDGSEVLEQGSDIR 247

Query: 220 QMEVTFRALGTPTDKEWPEVSSFGS 244
            +   F  LG P+ +EWPEV   GS
Sbjct: 248 LVSSIFEKLGIPSLQEWPEVRDHGS 272

>CAGL0F03707g complement(359839..361665) similar to sp|Q08732
           Saccharomyces cerevisiae YOR267c, start by similarity
          Length = 608

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/254 (27%), Positives = 111/254 (43%), Gaps = 42/254 (16%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEI---KTSEFKDGLDMSAIREVKYLQEIQHDNV 73
           GK +G G    V +  + + G   AVKE    K +E         I E      + H NV
Sbjct: 183 GKTLGSGAGGSVKILKRPTDGATFAVKEFRPKKPTETSKQYAKKCIAEFTIGSTLHHVNV 242

Query: 74  IELVDIFMAYDNLNL--VLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNF 131
           IE +DIF          V+E+ P D   ++   S   +  ++   +     GV + H   
Sbjct: 243 IETMDIFSDAKKQRYFEVMEYCPVDFFAVV--MSGKMSRGEVNCCLKQLACGVKYLHSMG 300

Query: 132 ILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEM---LTSNVV-TRWYRAPELLFGAK 187
           + HRDLK +N +++ +G++K+ DFG A     P E    L S +V +  Y APE+L    
Sbjct: 301 LAHRDLKLDNCVMTENGILKLIDFGSAVVFRYPFEQEVTLASGIVGSDPYLAPEVLGKIS 360

Query: 188 ----------HYT--------------SAIDIWSVGVIFAELML-RIPY-LPGQNDIDQM 221
                     H T               A+D+WS+G+IF+ +ML R P+  P ++D +  
Sbjct: 361 RADGDESEEPHQTIKIDKKTGLSLYDPQAVDVWSIGIIFSCMMLKRFPWKAPKESDPN-- 418

Query: 222 EVTFRALGTPTDKE 235
              F+    P D+E
Sbjct: 419 ---FKLYNMPEDEE 429

>Kwal_33.14167
          Length = 838

 Score = 77.4 bits (189), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 87/317 (27%), Positives = 134/317 (42%), Gaps = 62/317 (19%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEI 68
           +  TEY K + +G G  + VY     +  +  A+K +   EF D        E++ L+++
Sbjct: 510 VNGTEYEKLELLGRGGTSKVYKVKNANNNKVYALKRVSFDEFDDSSIDGFKGEIELLKKL 569

Query: 69  Q-HDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIK------SWMLMTL 121
           +    V++L+D  M +  L +V+E    DL   +  RS +  P D++        ML  +
Sbjct: 570 ETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGM--PLDVEFVRYHAQEMLKCV 627

Query: 122 RGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEM---LTSNVVTRWYR 178
           + VH      I+H DLKP N +    G++K+ DFG+A AVP  H +     + + T  Y 
Sbjct: 628 KVVHDA---GIVHSDLKPANFVFV-KGILKIIDFGIANAVPE-HTVNIYRETQIGTPNYM 682

Query: 179 APELLFGAKHYT-------------SAIDIWSVGVIFAELML-RIPY--LPGQNDIDQME 222
           APE L  A +YT                DIWS G I  +++  R PY    GQN +    
Sbjct: 683 APEALV-AMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL---- 737

Query: 223 VTFRALGTPTDK-EWPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMN 281
               A+  P  K  +PE +S G                        + A++ M   L  N
Sbjct: 738 ---LAIMNPEVKIVYPEKTSNGD--------------------TVPKTAIDTMKACLERN 774

Query: 282 PKKRWNAIECLESEYFK 298
           P KRW   E     + K
Sbjct: 775 PNKRWTVEEVANGSFVK 791

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 101/230 (43%), Gaps = 15/230 (6%)

Query: 1   MSTEITTPITQTEYTKGKKVGEGTYAVVYLGTKQ--STG--------RQIAVKEIKTSEF 50
           MS+     +T   Y  G  +GEG +  V LG  +  STG        +Q+A+K I+    
Sbjct: 31  MSSRGKKHVTFGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTI 90

Query: 51  --KDGLDMSAIREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILF 108
                 ++   RE+  L+ + H NV+ L ++      + +VLE+           R    
Sbjct: 91  VKNSEKEIKIYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRL 150

Query: 109 TPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEML 168
             +         + GV + H   ++HRDLK  NLLL  +  + + DFG        +E +
Sbjct: 151 KESTACRLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYM 210

Query: 169 TSNVVTRWYRAPELLFGAKHYTS-AIDIWSVGVIFAELMLRIPYLPGQND 217
            ++  +  Y APEL+   + Y +   D+WS G+I   ++    YLP  +D
Sbjct: 211 KTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAML--AGYLPWDDD 258

>Kwal_47.18307
          Length = 621

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 101/221 (45%), Gaps = 26/221 (11%)

Query: 19  KVGEGTYAVVYLGTKQS-TGRQIAVKEIKTSEFKDGLDMSAIRE--VKY----------L 65
           ++G+G+Y+ VY   ++S +GR  A+K               IRE  VKY          L
Sbjct: 15  RLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHI--------IREKKVKYVTIEKDLLNML 66

Query: 66  QEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVH 125
            +  H  +++L   F   +NL  VLE++     + +  R    T    +      +  V 
Sbjct: 67  AKGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQRLGRLTEDLSRHITAQLVDTVD 126

Query: 126 HCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPH----EMLTSNVVTRWYRAPE 181
           + H   ++HRDLKP N+LLS +G + + DFG A           +   S V T  Y +PE
Sbjct: 127 YMHSKGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFVGTAEYVSPE 186

Query: 182 LLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQME 222
           LL  ++   S+ DIW++G I  +L    P   G+N++   E
Sbjct: 187 LLLHSQCGFSS-DIWALGCIIYQLNQGKPPFRGENELQTFE 226

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 101/228 (44%), Gaps = 7/228 (3%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDN---VIE 75
           +G+GT+  VY   K+ T R  A+K + K    K       I E   L      +   ++ 
Sbjct: 310 LGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKSCPFIVG 369

Query: 76  LVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHR 135
           L   F    +L LV +FL          +   FT    K ++   +  + + H N I++R
Sbjct: 370 LKFSFQTPTDLYLVTDFLSGGELFWHLQKEGRFTEERAKFYIAELVLALEYLHDNDIVYR 429

Query: 136 DLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDI 195
           DLKP N+LL  +G I + DFGL++A     +   +   T  Y APELL     YT  +D 
Sbjct: 430 DLKPENILLDANGNIALCDFGLSKA--DLKDRTNTFCGTTEYLAPELLLDETGYTKMVDF 487

Query: 196 WSVGVIFAELMLR-IPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF 242
           WS+GV+  E+     P+    N     ++ F  +  P D   PE  SF
Sbjct: 488 WSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSF 535

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 97/199 (48%), Gaps = 16/199 (8%)

Query: 18   KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYL----QEIQHDNV 73
            K +G+G +  V L   ++T R  A+K +K        D+ + R  K +     + +H  +
Sbjct: 828  KVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFL 887

Query: 74   IELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFI 132
              L   F   + +   +EF+   DL   ++++ +    A  K +    L  + + H N +
Sbjct: 888  TNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLLALKYFHDNGV 945

Query: 133  LHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELL----FGAKH 188
            ++RDLK  N+LL+P+G IK+AD+GL +      EM   N  + +   PE +       + 
Sbjct: 946  IYRDLKLENILLTPEGHIKIADYGLCK-----DEMWYGNRTSTFCGTPEFMAPEILKEQE 1000

Query: 189  YTSAIDIWSVGVIFAELML 207
            YT A+D W+ GV+  +++L
Sbjct: 1001 YTKAVDWWAFGVLLYQMLL 1019

>Scas_690.13
          Length = 354

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 95/193 (49%), Gaps = 11/193 (5%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR----EVKYLQEIQHDNV 73
           + +G G++  V+L      GR  A+K +K  +    + M  I     E + L+ ++H  +
Sbjct: 48  RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQV---VRMKQIEHTNDERRMLKLVEHPFL 104

Query: 74  IELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFIL 133
           I +   F    NL +V++++       +  +S  F     K +      G+ + H + I+
Sbjct: 105 IRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLGLEYLHSHNII 164

Query: 134 HRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAI 193
           +RDLKP N+LL  +G IK+ DFG A+ V +    L        Y APE++   K Y  ++
Sbjct: 165 YRDLKPENILLDRNGHIKITDFGFAKEVDTVTWTLCGPPD---YIAPEVI-ATKPYNKSV 220

Query: 194 DIWSVGVIFAELM 206
           D WS+GV+  E++
Sbjct: 221 DWWSLGVLIFEML 233

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 96/193 (49%), Gaps = 11/193 (5%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR----EVKYLQEIQHDNV 73
           + +G G++  V+L      GR  A+K +K ++    + M  I     E + L+ ++H  +
Sbjct: 55  RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQV---VKMKQIEHTNDERRMLKLVEHPFL 111

Query: 74  IELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFIL 133
           I +   F    NL +V++++       +  +S  F     K +       + + H + I+
Sbjct: 112 IRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALEYLHFHNII 171

Query: 134 HRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAI 193
           +RDLKP N+LL  +G IK+ DFG A+ V +    L     T  Y APE++   K Y  ++
Sbjct: 172 YRDLKPENILLDRNGHIKITDFGFAKEVETVTWTLCG---TPDYIAPEVI-ATKPYNKSV 227

Query: 194 DIWSVGVIFAELM 206
           D WS+GV+  E++
Sbjct: 228 DWWSLGVLIYEML 240

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 93/194 (47%), Gaps = 2/194 (1%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMS-AIREVKYLQEIQHDNVIEL 76
           K +G+G++  V    K+ T +  A+K I+ S      +++  + E   L  + +  ++ L
Sbjct: 386 KVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPL 445

Query: 77  VDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRD 136
              F + + L LVL F+          R   F  +  + +    L  +   H   I++RD
Sbjct: 446 KFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRD 505

Query: 137 LKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIW 196
           LKP N+LL   G I + DFGL +      E  T+   T  Y APELL G + YT  +D W
Sbjct: 506 LKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLG-QGYTKVVDWW 564

Query: 197 SVGVIFAELMLRIP 210
           ++GV+  E++  +P
Sbjct: 565 TLGVLLYEMLTGLP 578

>Kwal_56.24059
          Length = 353

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 95/193 (49%), Gaps = 11/193 (5%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR----EVKYLQEIQHDNV 73
           + +G G++  V+L      GR  A+K +K  +    + M  I     E + L+ + H  +
Sbjct: 47  RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQV---IRMKQIEHTNDERRMLKLVDHPFL 103

Query: 74  IELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFIL 133
           I +   F    NL +V++++       +  +S  F     K +    +  + + H + I+
Sbjct: 104 IRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHSHDII 163

Query: 134 HRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAI 193
           +RDLKP N+LL  +G IK+ DFG A+ V +    L     T  Y APE++   K Y  ++
Sbjct: 164 YRDLKPENILLDRNGHIKITDFGFAKEVDTVTWTLCG---TPDYIAPEVI-ATKPYNKSV 219

Query: 194 DIWSVGVIFAELM 206
           D WS+G++  E++
Sbjct: 220 DWWSLGILIFEML 232

>Kwal_26.7635
          Length = 691

 Score = 76.3 bits (186), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 93/194 (47%), Gaps = 2/194 (1%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLD-MSAIREVKYLQEIQHDNVIEL 76
           K +G+G++  V    K+ T +  A+K I+ S      + +  + E   L  +++  ++ L
Sbjct: 362 KVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPL 421

Query: 77  VDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRD 136
              F + D L +VL F+          R   F+ +  + +    L  +   H   +++RD
Sbjct: 422 KFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRD 481

Query: 137 LKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIW 196
           LKP N+LL   G I + DFGL +      +   +   T  Y APELL G + Y+  +D W
Sbjct: 482 LKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLG-QGYSKVVDWW 540

Query: 197 SVGVIFAELMLRIP 210
           ++GV+  E+M  +P
Sbjct: 541 TLGVLLYEMMTGLP 554

>Scas_703.5
          Length = 749

 Score = 76.3 bits (186), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 81/306 (26%), Positives = 120/306 (39%), Gaps = 52/306 (16%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDN---VIE 75
           +G+GT+  VY   K+ T R  A+K + K    K       I E   L          ++ 
Sbjct: 350 LGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEVAHTIGERNILVTTATKASPFIVG 409

Query: 76  LVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHR 135
           L   F    +L LV +F+          +   FT    K ++   +  + + H N I++R
Sbjct: 410 LKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTEERAKFYIAELVLALEYLHDNDIVYR 469

Query: 136 DLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDI 195
           DLKP N+LL  +G I + DFGL++A     +   +   T  Y APELL     YT  +D 
Sbjct: 470 DLKPENILLDANGNIALCDFGLSKA--DLKDRTNTFCGTTEYLAPELLLDEAGYTKMVDF 527

Query: 196 WSVGVIFAELMLR-IPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPP 254
           WS+GV+  E+     P+    N     ++ F  +  P D   PE  S             
Sbjct: 528 WSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRS------------- 574

Query: 255 SIDELRKRFIAASENALNFMCGMLTMNPKKRWNAI----ECLESEYF----------KEM 300
                             F+ G+L  NPK R  AI    E     +F          K++
Sbjct: 575 ------------------FVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWDALREKKI 616

Query: 301 PPPSDP 306
           PPP  P
Sbjct: 617 PPPFKP 622

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score = 76.3 bits (186), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 132/293 (45%), Gaps = 44/293 (15%)

Query: 18   KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYL----QEIQHDNV 73
            K +G+G +  V L   ++T R  A+K +K        D+ + R  K +     + +H  +
Sbjct: 821  KVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFL 880

Query: 74   IELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFI 132
              L   F   + +   +EF+   DL   ++++ +    A  K +    L  +   H N +
Sbjct: 881  TNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLLALKFFHDNGV 938

Query: 133  LHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192
            ++RDLK  N+LL+P+G IK+AD+GL +         ++   T  + APELL   + YT A
Sbjct: 939  IYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEFMAPELL-REQDYTKA 997

Query: 193  IDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYP 252
            +D W+ GV+  +++L      G    D  +  F A+ T    + P            +YP
Sbjct: 998  VDWWAFGVLLYQMLLCQSPFSG----DDEDEVFNAILT----DEP------------LYP 1037

Query: 253  PPSIDELRKRFIAASENALNFMCGMLTMNPKKRW-----NAIECLESEYFKEM 300
                       I  + + +    G+LT +P+KR      +A+E +E  +F+ +
Sbjct: 1038 -----------IDMAGDIVQIFQGLLTKDPEKRLGAGPRDALEIMEEPFFRNI 1079

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 75.9 bits (185), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 121/306 (39%), Gaps = 52/306 (16%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDN---VIE 75
           +G+GT+  VY   K+ T R  A+K + K    K       I E   L      +   ++ 
Sbjct: 418 LGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTASKSSPFIVG 477

Query: 76  LVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHR 135
           L   F    +L LV +++          +   F+    K ++   +  + H H N I++R
Sbjct: 478 LKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYR 537

Query: 136 DLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDI 195
           DLKP N+LL  +G I + DFGL++A     +   +   T  Y APELL     YT  +D 
Sbjct: 538 DLKPENILLDANGNIALCDFGLSKA--DLKDRTNTFCGTTEYLAPELLLDETGYTKMVDF 595

Query: 196 WSVGVIFAELMLR-IPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPP 254
           WS+GV+  E+     P+    N     ++ F  +  P D                     
Sbjct: 596 WSLGVLIFEMCCGWSPFFAENNQKMYQKIAFGKVKFPRD--------------------- 634

Query: 255 SIDELRKRFIAASENALNFMCGMLTMNPKKRWNAI----ECLESEYF----------KEM 300
                       S+   +F+ G+L  NPK R  AI    E     +F          K++
Sbjct: 635 ----------VLSQEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWEALKQKKI 684

Query: 301 PPPSDP 306
           PPP  P
Sbjct: 685 PPPFKP 690

>Scas_660.20
          Length = 957

 Score = 75.9 bits (185), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 104/217 (47%), Gaps = 16/217 (7%)

Query: 18  KKVGEGTYAVVYLGT-KQSTGRQIAVKEIKTSEFKDGLDMSAIREV-------KYLQEIQ 69
           +++G G+Y+ VY    K++T R  A+K    +     +  S ++ V         L +  
Sbjct: 15  EELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHI---IKESKVKYVTIEKNTLNLLAKAH 71

Query: 70  HDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHR 129
           H  +++L   F   +NL  VL++LP    + +  +   F+    K + +  +  +   H 
Sbjct: 72  HPGIVKLYYTFHDEENLYYVLDYLPGGELLSLLHKMKTFSEVWSKHFTVQLVDTLEFIHS 131

Query: 130 NFILHRDLKPNNLLLSPDGVIKVADFGLARAVPS----PHEMLTSNVVTRWYRAPELLFG 185
             ++HRDLKP N+LL  DG + + DFG A    +     ++  +S V T  Y +PELL  
Sbjct: 132 QGVIHRDLKPENVLLDRDGKLMITDFGAAYTTTAGNNDANKSSSSFVGTAEYVSPELLLH 191

Query: 186 AKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQME 222
            +   S+ D+W++G +  + +   P   G+N++   E
Sbjct: 192 NQCSFSS-DVWALGCMIFQFVTGSPPFRGENELKTFE 227

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 75.9 bits (185), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 108/221 (48%), Gaps = 28/221 (12%)

Query: 17  GKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKY-------LQEIQ 69
           G+ VG+G Y+ V L T + +G++ AVK +   E+     +   ++VKY       LQ + 
Sbjct: 185 GEMVGDGAYSTVMLATAKDSGKKYAVK-VLNKEY-----LIKQKKVKYVNIEKNALQRLN 238

Query: 70  HD-NVIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHC 127
           +   +++L   F    +L  +LE+ P+ D   ++K    L      + +    + G+ + 
Sbjct: 239 NSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDC-TRYYSAQIIDGIKYL 297

Query: 128 HRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHE--------MLT---SNVVTRW 176
           H   I+HRD+KP N+LL  D  +K+ DFG A+ +   +E        +LT   S V T  
Sbjct: 298 HSKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAE 357

Query: 177 YRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQND 217
           Y +PELL  + +  +  DIW+ G +  +++   P     N+
Sbjct: 358 YVSPELLNDS-YVDARCDIWAFGCMVFQMIAGKPPFKATNE 397

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 74.7 bits (182), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 101/203 (49%), Gaps = 9/203 (4%)

Query: 12  TEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEF-KDGLDMSAIREVKYLQEIQH 70
            ++  GK +G+G +  VY      +G   A+K ++  +  +  ++    REV+    ++H
Sbjct: 107 ADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSSLRH 166

Query: 71  DNVIELVDIFMAYDNLNLVLEFL-PSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHR 129
            N+ +L   F     + L++E+L   +L   +K RS  F       ++      + + H 
Sbjct: 167 PNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRS-HFNDVVASYYVYQMADALDYMHE 225

Query: 130 NFILHRDLKPNNLLLSPDGVIKVADFGLARAVP--SPHEMLTSNVVTRWYRAPELLFGAK 187
             ILHRD+KP N+++  +  IK+ DFG +   P  S  + L   V    Y +PEL+  ++
Sbjct: 226 RNILHRDIKPENIIIGFNNTIKLTDFGWSVITPKGSKRKTLCGTVD---YLSPELI-RSR 281

Query: 188 HYTSAIDIWSVGVIFAELMLRIP 210
            Y   +D+W++GV+  EL++  P
Sbjct: 282 EYNEKVDVWALGVLTYELLVGSP 304

>Scas_201.1*
          Length = 274

 Score = 73.6 bits (179), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 91/191 (47%), Gaps = 12/191 (6%)

Query: 24  TYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSA---IREVKYLQEIQHDNVIELVDIF 80
           T+ VV    +  +   +AVK +  +  K G D+       E+  LQ + H N++   D F
Sbjct: 45  TFGVVRQARQFFSQEAVAVKILLKNALK-GNDVQLQMLYDELSILQRLHHPNIVAFKDWF 103

Query: 81  MAYDNLNLVLEFLPSD--LEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLK 138
            + D   +V +        + IIK     FT  D  + M+  L  V + H   I+HRDLK
Sbjct: 104 ESRDKFYIVTQLATGGELFDRIIKKGK--FTEVDAVNIMVQLLDAVKYIHSQNIVHRDLK 161

Query: 139 PNNLLL---SPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDI 195
           P N+L    S +  + +ADFG+A+ + S  +++     +  Y APE+L    H     DI
Sbjct: 162 PENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAPEVLTKEGH-GKPCDI 220

Query: 196 WSVGVIFAELM 206
           WS+GVI   L+
Sbjct: 221 WSLGVITYTLL 231

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score = 75.5 bits (184), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 136/334 (40%), Gaps = 86/334 (25%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGT-KQSTGRQIAVKEIKTSEFKDGLDMSAIR-EVKYLQ 66
           I    Y   K++G G++AVVY G    S+   +A+K +  S+ ++   +  +  E+  L+
Sbjct: 13  IVAERYVVEKEIGRGSFAVVYKGHLADSSAGNVAIKAVSRSKLRNKKLLENLEIEIAILK 72

Query: 67  EIQHDNVIELVDIFMAYDNLNLVLEFLP-SDLEVIIKDRSILFTPADIKSWMLMTL---- 121
           +I+H +++ L++      +  L++E+    DL   IK R  L      K  ++ TL    
Sbjct: 73  KIKHPHIVGLLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMD----KHPLVRTLFEKY 128

Query: 122 --RGVHHCHRNFIL---------------------HRDLKPNNLLLSPDGV--------- 149
                HH   N +L                     HRD+KP NLLLS   V         
Sbjct: 129 PPPSEHHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSTPLVDYNDPAEFH 188

Query: 150 ------------IKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDIWS 197
                       +K+ADFG AR +P+   +  +   +  Y APE+L   K Y +  D+WS
Sbjct: 189 ARGFVGIYNLPILKIADFGFARFLPNT-SLAETLCGSPLYMAPEILNYQK-YNAKADLWS 246

Query: 198 VGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQIYPPPSID 257
           VG +  E+    P     N ++  +   +A                  N +  +P     
Sbjct: 247 VGTVLYEMCCGKPPFKASNHLELFQKIKKA------------------NDVIQFPKH--- 285

Query: 258 ELRKRFIAASENAL-NFMCGMLTMNPKKRWNAIE 290
                  AA E+A+ + +CG+LT  P KR    E
Sbjct: 286 -------AALESAMVDLICGLLTFEPAKRMGFTE 312

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 74.3 bits (181), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 95/193 (49%), Gaps = 11/193 (5%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR----EVKYLQEIQHDNV 73
           + +G G++  V+L      GR  A+K +K  +    + M  I     E + L+ ++H  +
Sbjct: 40  RTLGTGSFGRVHLVRSIHNGRYYAIKVLKKQQV---IRMKQIEHTNDERRMLKVVEHPFL 96

Query: 74  IELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFIL 133
           I +   F    NL +V++++       +  +S  F     K +       + + H + I+
Sbjct: 97  IRMWGTFQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHAHNII 156

Query: 134 HRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAI 193
           +RDLKP N+LL  +G IK+ DFG A+ V +    L     T  Y APE++   K Y  +I
Sbjct: 157 YRDLKPENILLDRNGHIKITDFGFAKEVDTVTWTLCG---TPDYIAPEVI-TTKPYNKSI 212

Query: 194 DIWSVGVIFAELM 206
           D WS+G++  E++
Sbjct: 213 DWWSLGILIFEML 225

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 74.7 bits (182), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 107/217 (49%), Gaps = 23/217 (10%)

Query: 20  VGEGTYAVVYLGTKQSTGRQI-AVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELVD 78
           +GEG    V    K  TG+++ A+K I             +RE+++ +  + + ++    
Sbjct: 186 LGEGAGGSV-AKCKLRTGKKVFALKTINILNGDPEFQKQLLRELQFNKSFKSEYIVRYFG 244

Query: 79  IFMAYDN--LNLVLEFLPS-DLEVIIKDRSILFTPADIKSWML-----MTLRGVHHCHRN 130
           +F    N  + + +E++    LE I K+  +L     I   +L       LRG+ + H  
Sbjct: 245 MFTDEQNSSIYIAMEYMGGKSLEAIYKE--LLSRGGRISEKVLGKISEAVLRGLSYLHEK 302

Query: 131 FILHRDLKPNNLLLSPDGVIKVADFGLA-RAVPSPHEMLTSNVVTRWYRAPELLFGAKHY 189
            ++HRD+KP N+LL+ DG +K+ DFG++  AV S   + T+   T +Y APE + G + Y
Sbjct: 303 KVIHRDIKPQNILLNEDGQVKLCDFGVSGEAVNS---LATTFTGTSYYMAPERIQG-QPY 358

Query: 190 TSAIDIWSVGVIFAELML-RIPYLPGQNDIDQMEVTF 225
           +   D+WS+G+   E+     P+ P     D+M  T 
Sbjct: 359 SVTCDVWSLGLTILEVAQGHFPFGP-----DKMATTI 390

>Kwal_55.21545
          Length = 865

 Score = 75.1 bits (183), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 132/289 (45%), Gaps = 34/289 (11%)

Query: 12  TEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEI-QH 70
           T + + + +G G + VVY G    T +  A+K +      D ++    +E+++L  + Q 
Sbjct: 17  TLFKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDEVE-DVQKEIQFLSSLKQV 75

Query: 71  DNVIELVDIFMAYDNLNLVLEFLPS-DLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHR 129
            N+      ++    L +++E+     L  +++   I      I   M   L  + H H+
Sbjct: 76  PNITHYYGSYLNDTKLWVIMEYCAGGSLRTLLRPGKI--GEQYIGVIMRELLTALMHIHK 133

Query: 130 NFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHY 189
           + ++HRD+K  N+L++ DG IK+ DFG+A  +        +   T ++ APE++    +Y
Sbjct: 134 DGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMAGTPYWMAPEVIMEGVYY 193

Query: 190 TSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKLQ 249
            + +DIWS+G+   E+                     A G P    + EV +  +   + 
Sbjct: 194 DTKVDIWSLGITAYEI---------------------ATGNP---PYCEVEALRAMQLIT 229

Query: 250 IYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFK 298
              PP + E R+   A  E  +  +C  L  +PK+R +A + L++++ K
Sbjct: 230 KSKPPRL-EGRQHSSALKE--IIALC--LDEDPKERPSAEDLLKTKFIK 273

>Kwal_47.16761
          Length = 744

 Score = 75.1 bits (183), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 111/249 (44%), Gaps = 9/249 (3%)

Query: 20  VGEGTYAVVYLGTKQSTGRQIAVKEI-KTSEFKDGLDMSAIREVKYLQEIQHDNVIELVD 78
           +G+GT+  VY   K+ T R  A+K + K    K       I E   L      +   +V 
Sbjct: 340 LGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKSCPFIVG 399

Query: 79  IFMAYD---NLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFILHR 135
           +  ++    +L LV +F+          +   F     + ++   +  + + H N I++R
Sbjct: 400 LKFSFQTPADLYLVTDFMSGGELFWHLQKEGRFAEDRARFYIAELVLALEYLHENDIVYR 459

Query: 136 DLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAIDI 195
           DLKP N+LL  +G I + DFGL++A     +   +   T  Y APELL     YT  +D 
Sbjct: 460 DLKPENILLDANGNIALCDFGLSKA--DLKDRTNTFCGTTEYLAPELLLDESGYTKMVDF 517

Query: 196 WSVGVIFAELMLR-IPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSF--GSYNKLQIYP 252
           WS+GV+  E+     P+    N     ++ F  +  P D   PE  SF  G  N+   + 
Sbjct: 518 WSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPRHR 577

Query: 253 PPSIDELRK 261
             +ID+ R+
Sbjct: 578 LGAIDDGRE 586

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 75.1 bits (183), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 99/204 (48%), Gaps = 17/204 (8%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQHDNVIELV 77
           K+VGEG++  VYL T + T +++ +K    S      D + +REV Y ++ ++  + +L 
Sbjct: 41  KQVGEGSFGKVYLATHKLTHQKVVLKTGAKS------DPNVVREVFYHRQFEYPFITKLY 94

Query: 78  DIFMAYDNLNLVLEFLPSDL---EVIIKDRSILFTPAD-IKSWMLMTLRGVHHCHRNFIL 133
           ++ +    + + LE+ P +     +++K R     P D  +      +  V + H    +
Sbjct: 95  EVIVTETRVWMALEYCPGNELYDYLLLKQR----IPLDETRRLFAQIVSAVFYAHSLQCV 150

Query: 134 HRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAI 193
           HRDLK  N+LL  +G   + DFG  R   +  ++ T    T  Y APEL+    +    +
Sbjct: 151 HRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETV-CGTTVYMAPELIKREAYDGYKV 209

Query: 194 DIWSVGVIFAELMLRIPYLPGQND 217
           D WS+G+I   ++    Y+P   D
Sbjct: 210 DTWSLGIILYTMLH--GYMPFDED 231

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 112/223 (50%), Gaps = 11/223 (4%)

Query: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEF-KDGLDMSAIREVKYLQE 67
           +T  ++  GK +G+G +  VY    + TG   A+K ++  E  +  +     REV+    
Sbjct: 95  MTLQDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGS 154

Query: 68  IQHDNVIELVDIFMAYDNLNLVLEFLP-SDLEVIIKDRSILFTPADIKSWMLMTL-RGVH 125
            +H N+ +L   F     + L++E++   +L   +K+   L     + S+ +  +   + 
Sbjct: 155 FKHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPL--NETLASYFVYQMANALD 212

Query: 126 HCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFG 185
           + H   ILHRD+KP N+L+  +  IK+ DFG +       +  T    T  Y +PEL+  
Sbjct: 213 YMHSKNILHRDIKPENILIGFNNTIKLTDFGWSVYNEDGQKRKTL-CGTIDYLSPELI-K 270

Query: 186 AKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRAL 228
           ++ Y + +D+W++GV+  EL++  P  P + D  +M  T+R +
Sbjct: 271 SREYNNKVDVWALGVLTYELLVGSP--PFEEDTKEM--TYRRI 309

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 75.1 bits (183), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 107/219 (48%), Gaps = 28/219 (12%)

Query: 18  KKVGEGTYAVVYLGT--------------KQSTGRQIAVKEIKTSEFKDGLDMSAIREVK 63
           +K G+G    VYL                K   G ++A+K++  S  K       + E+ 
Sbjct: 592 EKAGQGASGSVYLAERLQLPPYKDELEAEKNQLGNKVAIKQMILS--KQPRKELIVNEIL 649

Query: 64  YLQEIQHDNVIELVDIFM-AYDNLNLVLEFLPS-DLEVIIKD-------RSILFTPADIK 114
            +++ +H+N++  ++ ++   D+L +V+E++    L  II++       +S L  P  I 
Sbjct: 650 VMKDSKHNNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLTEP-QIA 708

Query: 115 SWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVT 174
             +  T +G+   H   I+HRD+K +N+LL   G +K+ DFG    +        + V T
Sbjct: 709 YIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRGRVKITDFGFCAKLTDKRSKRATMVGT 768

Query: 175 RWYRAPELLFGAKHYTSAIDIWSVGVIFAELM-LRIPYL 212
            ++ APE++   + Y   +D+WS+G++  E++    PYL
Sbjct: 769 PYWMAPEVV-KQREYDEKVDVWSLGIMTIEMLESEPPYL 806

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 95/193 (49%), Gaps = 11/193 (5%)

Query: 18  KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIR----EVKYLQEIQHDNV 73
           + +G G++  V+L      GR  A+K +K  +    + M  I     E + L+ ++H  +
Sbjct: 66  RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQI---IRMKQIEHTNDERRMLKLVEHPFL 122

Query: 74  IELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCHRNFIL 133
           I +   F    NL +V++++       +  +S  F     K +       + + H + I+
Sbjct: 123 IRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSHNII 182

Query: 134 HRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSAI 193
           +RDLKP N+LL  +G IK+ DFG A+ V +    L     T  Y APE++   K Y  ++
Sbjct: 183 YRDLKPENILLDRNGHIKITDFGFAKEVITVTWTLCG---TPDYIAPEVI-TTKPYNKSV 238

Query: 194 DIWSVGVIFAELM 206
           D WS+G++  E++
Sbjct: 239 DWWSLGILIFEML 251

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,440,603
Number of extensions: 436192
Number of successful extensions: 2927
Number of sequences better than 10.0: 649
Number of HSP's gapped: 1862
Number of HSP's successfully gapped: 699
Length of query: 312
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 211
Effective length of database: 13,099,691
Effective search space: 2764034801
Effective search space used: 2764034801
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)