Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_613.1234834818360.0
Sklu_1484.13763486921e-88
KLLA0E14784g3793396331e-79
ADL282W3723356277e-79
Kwal_23.34753823516071e-75
YDL107W (MSS2)3513595683e-70
CAGL0H10296g3733455172e-62
CAGL0H04719g177111671.5
AAL146W190058654.2
YER007W (PAC2)51836636.3
YDR030C (RAD28)50646637.3
YGR047C (TFC4)102540637.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_613.12
         (348 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_613.12                                                           711   0.0  
Sklu_1484.1 YDL107W, Contig c1484 197-1327 reverse complement         271   1e-88
KLLA0E14784g complement(1321041..1322180) similar to sp|P40990 S...   248   1e-79
ADL282W [1459] [Homologous to ScYDL107W (MSS2) - SH] complement(...   246   7e-79
Kwal_23.3475                                                          238   1e-75
YDL107W (MSS2) [762] chr4 (268921..269976) Protein involved in t...   223   3e-70
CAGL0H10296g complement(1004900..1006021) similar to sp|P40990 S...   203   2e-62
CAGL0H04719g 452786..453319 similar to sp|Q04231 Saccharomyces c...    30   1.5  
AAL146W [41] [Homologous to ScYGR184C (UBR1) - SH] complement(92...    30   4.2  
YER007W (PAC2) [1429] chr5 (164526..166082) Putative tubulin-spe...    29   6.3  
YDR030C (RAD28) [881] chr4 complement(501749..503269) Protein in...    29   7.3  
YGR047C (TFC4) [2012] chr7 complement(586394..589471) RNA polyme...    29   7.3  

>Scas_613.12
          Length = 348

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/348 (100%), Positives = 348/348 (100%)

Query: 1   MNRVIIRRIATKSTSTLRPFHEIFPRKRLINRILFELDSNDTYKTLYPNFETLYLKHELP 60
           MNRVIIRRIATKSTSTLRPFHEIFPRKRLINRILFELDSNDTYKTLYPNFETLYLKHELP
Sbjct: 1   MNRVIIRRIATKSTSTLRPFHEIFPRKRLINRILFELDSNDTYKTLYPNFETLYLKHELP 60

Query: 61  STVSGPQLLLMDRVLLEVSKQQKMINEVLMKMRGELLELAAGKGENDAISTVCYNILSSP 120
           STVSGPQLLLMDRVLLEVSKQQKMINEVLMKMRGELLELAAGKGENDAISTVCYNILSSP
Sbjct: 61  STVSGPQLLLMDRVLLEVSKQQKMINEVLMKMRGELLELAAGKGENDAISTVCYNILSSP 120

Query: 121 KDDSKGDAEDASRLIGELVKAGNVLTFKHLGDLSRLKGDINEAKLWYDKFMECVDQDETR 180
           KDDSKGDAEDASRLIGELVKAGNVLTFKHLGDLSRLKGDINEAKLWYDKFMECVDQDETR
Sbjct: 121 KDDSKGDAEDASRLIGELVKAGNVLTFKHLGDLSRLKGDINEAKLWYDKFMECVDQDETR 180

Query: 181 VSDVSIIGQVLERLGEIEFNQSRVLGAEKYWLDAIARSKLEDSVKSYFYLSKVYLNSEPL 240
           VSDVSIIGQVLERLGEIEFNQSRVLGAEKYWLDAIARSKLEDSVKSYFYLSKVYLNSEPL
Sbjct: 181 VSDVSIIGQVLERLGEIEFNQSRVLGAEKYWLDAIARSKLEDSVKSYFYLSKVYLNSEPL 240

Query: 241 KSRVLLENCATQGFRESFKELGYLELNYFKNLVKANEWFRLGMELFEIECFFGFFDSCYQ 300
           KSRVLLENCATQGFRESFKELGYLELNYFKNLVKANEWFRLGMELFEIECFFGFFDSCYQ
Sbjct: 241 KSRVLLENCATQGFRESFKELGYLELNYFKNLVKANEWFRLGMELFEIECFFGFFDSCYQ 300

Query: 301 LKEYKSCSKCLKSLETFKNINESYKNMVSEFVSHRENKINNMNKLLAL 348
           LKEYKSCSKCLKSLETFKNINESYKNMVSEFVSHRENKINNMNKLLAL
Sbjct: 301 LKEYKSCSKCLKSLETFKNINESYKNMVSEFVSHRENKINNMNKLLAL 348

>Sklu_1484.1 YDL107W, Contig c1484 197-1327 reverse complement
          Length = 376

 Score =  271 bits (692), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 140/348 (40%), Positives = 220/348 (63%), Gaps = 14/348 (4%)

Query: 4   VIIRRIATKSTSTLRPFHEIFPRKRLINRILFELDSNDTYKTLYPNFETLY-------LK 56
           +I +R+ + + S   PF+++FP+K+L+N++LFELDS  T+  LYP +E+LY        +
Sbjct: 7   IIWKRLISHNASRRPPFYDVFPQKKLVNKLLFELDSRLTFPKLYPLYESLYNTMDDAQSQ 66

Query: 57  HELPSTVSGPQLLLMDRVLLEVSKQQKMINEVLMKMRGELLELAAGKGENDAISTVCYNI 116
            ++P++V+   +++M +VL ++  + K IN+ L+ +  E+L  AA  G NDAIS + ++ 
Sbjct: 67  VKVPTSVTASDIMVMKKVLEKLRHRTKSINKNLLALENEILNKAAEMGNNDAISLLAFDT 126

Query: 117 LSSPKDDSKGDAEDASRLIGELVKAGNVLTFKHLGDLSRLKGDINEAKLWYDKFMECVDQ 176
           L     +S  D   A  LI EL +  + LT K  GDL+    D+  A+ +Y  F+   D 
Sbjct: 127 LKDSDSNSHEDIAYAKTLIKELYQLRHPLTVKLTGDLTFKNNDLINAEKYYKDFLALED- 185

Query: 177 DETRVSDVSIIGQVLERLGEIEFNQSRVLGAEKYWLDAIARSKLEDSVKSYFYLSKVYLN 236
                 D  + G+V  +LG+I F +  +  AE Y+L +I    LE SV SYFYL ++Y+N
Sbjct: 186 ------DTFLAGEVYGQLGQISFRKPNLFKAEDYFLKSIKLCPLEYSVHSYFYLGQMYMN 239

Query: 237 SEPLKSRVLLENCATQGFRESFKELGYLELNYFKNLVKANEWFRLGMELFEIECFFGFFD 296
           S+PLK+R LLE+ ATQGF+ESFK LG+LE+NYF++  KA EWF+LGMELFE+ECF G+FD
Sbjct: 240 SQPLKARALLESTATQGFKESFKILGFLEMNYFEDYSKAQEWFKLGMELFEMECFVGYFD 299

Query: 297 SCYQLKEYKSCSKCLKSLETFKNINESYKNMVSEFVSHRENKINNMNK 344
            C +L+E+ +  +C  S+ T    N +Y+ + S FV+ R++K+  + K
Sbjct: 300 CCVKLEEWVNAKRCFNSMTTLLQSNTNYEPVYSNFVTTRKDKLEKLEK 347

>KLLA0E14784g complement(1321041..1322180) similar to sp|P40990
           Saccharomyces cerevisiae YDL107w MSS2 ser/thr protein
           kinase singleton, start by similarity
          Length = 379

 Score =  248 bits (633), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 129/339 (38%), Positives = 206/339 (60%), Gaps = 13/339 (3%)

Query: 7   RRIATKSTSTLRPFHEIFPRKRLINRILFELDSNDTYKTLYPNFETLYL------KHELP 60
           RR+ +   +   P HEIFP+K++++RILFELDS   Y  LYP +E LY         ++P
Sbjct: 13  RRLISSLANKRPPLHEIFPQKKMVSRILFELDSRLAYNKLYPMYEKLYEGLDTGNDVDIP 72

Query: 61  STVSGPQLLLMDRVLLEVSKQQKMINEVLMKMRGELLELAAGKGENDAISTVCYNILSSP 120
           +++ G  L++M +VL +V  + K IN+ L+ +   LL+ AA  G+NDAIS +C+++L  P
Sbjct: 73  NSIKGKDLMIMKKVLEKVRHKTKAINKNLLALENVLLDRAAEIGDNDAISLLCFDVLKDP 132

Query: 121 KDDSKGDAEDASRLIGELVKAGNVLTFKHLGDLSRLKGDINEAKLWYDKFMECVDQDETR 180
             +++ D   A +LI  L +  + LT K   D++    D   A+++Y KF++  +     
Sbjct: 133 DSNTEDDVSHAKKLIKNLYQMNHPLTVKLTADIALKNHDDATAEVYYMKFLDLQN----- 187

Query: 181 VSDVSIIGQVLERLGEIEFNQSRVLGAEKYWLDAIARSKLEDSVKSYFYLSKVYLNSEPL 240
             D  + G+V  +LG+I F +  ++ AEK +L +I    ++ SV+SYF L ++Y+N++  
Sbjct: 188 --DTFLAGEVYGQLGQIHFRKPNLIEAEKCFLKSIKLCPIDYSVRSYFLLGQMYVNNDIF 245

Query: 241 KSRVLLENCATQGFRESFKELGYLELNYFKNLVKANEWFRLGMELFEIECFFGFFDSCYQ 300
           K+R L+E+ ATQGF+ESF+ LG LE+NYFKN  KA EWF+LGMEL++ ECF G+FD   +
Sbjct: 246 KARYLIESSATQGFKESFRTLGLLEMNYFKNYPKAQEWFKLGMELYDTECFVGYFDCTMK 305

Query: 301 LKEYKSCSKCLKSLETFKNINESYKNMVSEFVSHRENKI 339
             E     +C +S+E     N+    +  +F SHR + I
Sbjct: 306 NNELLLAKRCYESMEKLAENNQDVNRLFEDFSSHRASDI 344

>ADL282W [1459] [Homologous to ScYDL107W (MSS2) - SH]
           complement(206313..207431) [1119 bp, 372 aa]
          Length = 372

 Score =  246 bits (627), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 129/335 (38%), Positives = 202/335 (60%), Gaps = 14/335 (4%)

Query: 13  STSTLRPFHEIFPRKRLINRILFELDSNDTYKTLYPNFETLYLKHE-------LPSTVSG 65
           ST+   P H+IFP K+L+NR+LF+LDS  T++ L P +E +Y + +       +P  V  
Sbjct: 20  STNNRPPLHKIFPSKKLVNRMLFDLDSRLTFRKLLPVYEQVYTQLDSSTGDLVVPRGVRA 79

Query: 66  PQLLLMDRVLLEVSKQQKMINEVLMKMRGELLELAAGKGENDAISTVCYNILSSPKDDSK 125
             +++M +VL +  ++ K  N  L+ +  ELL +AA  G  DA + + ++ L +P   + 
Sbjct: 80  HDVMIMKKVLEKTRRRTKSSNRHLLALENELLYMAAQMGHKDAAALLAFDTLCNPASQTA 139

Query: 126 GDAEDASRLIGELVKAGNVLTFKHLGDLSRLKGDINEAKLWYDKFMECVDQDETRVSDVS 185
            D E A  ++ +  ++G+ LT K  GDLS   GD   A+ +Y KF++       + +D  
Sbjct: 140 ADMEYAKLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEYYMKFLK-------KEADTF 192

Query: 186 IIGQVLERLGEIEFNQSRVLGAEKYWLDAIARSKLEDSVKSYFYLSKVYLNSEPLKSRVL 245
           + G+V  +LG I F +S    AE+ +L AI  + LE SV+SYFYL ++Y+NS+PLK+R L
Sbjct: 193 LAGEVYGQLGRISFLRSHFAQAEERFLQAIKLTPLEYSVQSYFYLGQLYMNSDPLKARSL 252

Query: 246 LENCATQGFRESFKELGYLELNYFKNLVKANEWFRLGMELFEIECFFGFFDSCYQLKEYK 305
           LE+ A+QGF+ESFK LG+LE+NYF +L KA EWF+LGMEL E+EC  G FD    L +  
Sbjct: 253 LESAASQGFKESFKTLGHLEMNYFCDLTKAREWFKLGMELGELECMIGCFDCAITLGDLA 312

Query: 306 SCSKCLKSLETFKNINESYKNMVSEFVSHRENKIN 340
              +  KSLE     ++ Y+ + ++F  +R  K++
Sbjct: 313 LAHRASKSLEALAKTDKIYQALYTQFADYRHEKLS 347

>Kwal_23.3475
          Length = 382

 Score =  238 bits (607), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 126/351 (35%), Positives = 207/351 (58%), Gaps = 15/351 (4%)

Query: 1   MNRVI-IRRIATKSTSTLRPFHEIFPRKRLINRILFELDSNDTYKTLYPNFETLY----- 54
           +NR + + R+A+       PF+E+FP+K+++N+ILF+LDS  T+  LYP FE+LY     
Sbjct: 9   LNRSLQLTRLASSLAKKRPPFYEVFPQKKMVNKILFQLDSKLTFPKLYPVFESLYDNAGN 68

Query: 55  --LKHELPSTVSGPQLLLMDRVLLEVSKQQKMINEVLMKMRGELLELAAGKGENDAISTV 112
                 +P++     +++M +VL ++  + K  N+ L+ +  ELLE AA  G+NDAI+ +
Sbjct: 69  RDPSELIPTSFKASDVMIMKKVLEKIRHRTKSTNKNLIGLENELLETAAEMGDNDAIALL 128

Query: 113 CYNILSSPKDDSKGDAEDASRLIGELVKAGNVLTFKHLGDLSRLKGDINEAKLWYDKFME 172
            ++ L +P   +  D   A  LI EL +  + LT K   DL+       +A+ +Y  F+E
Sbjct: 129 AFSFLKNPGKHAPEDVLHAKNLIKELYQLQHPLTIKLTADLAVKSNHFEDAERYYLHFLE 188

Query: 173 CVDQDETRVSDVSIIGQVLERLGEIEFNQSRVLGAEKYWLDAIARSKLEDSVKSYFYLSK 232
                    S+    G+V  +LG I F +  +  AE+ +L +I    LE    SY++L++
Sbjct: 189 LE-------SETPRAGEVYGQLGLIYFRRPNLKEAERCFLSSIRLCPLEAVTHSYYHLAQ 241

Query: 233 VYLNSEPLKSRVLLENCATQGFRESFKELGYLELNYFKNLVKANEWFRLGMELFEIECFF 292
           +Y++SEPLK+R L+E+ A++GFRESF+ LG+LE+NYF +  KA +WFRLGMEL++ EC+ 
Sbjct: 242 LYMDSEPLKARSLMESAASEGFRESFQLLGFLEMNYFHDYAKALQWFRLGMELYQFECYI 301

Query: 293 GFFDSCYQLKEYKSCSKCLKSLETFKNINESYKNMVSEFVSHRENKINNMN 343
           G+FD   ++++ K    CL SL+     N+ + +    FV  R+  IN +N
Sbjct: 302 GYFDCSIKMQDLKKARNCLTSLQKLSKTNDLFASAFKSFVDSRQETINKVN 352

>YDL107W (MSS2) [762] chr4 (268921..269976) Protein involved in
           translocation of the Cox2p C-terminal end across the
           mitochondrial inner membrane [1056 bp, 351 aa]
          Length = 351

 Score =  223 bits (568), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 128/359 (35%), Positives = 214/359 (59%), Gaps = 26/359 (7%)

Query: 1   MNRVIIRRIATKSTSTLRPFHEIFPRKRLINRILFELDSNDTYKTLYPNF---------E 51
           M R + + ++T      + F EIFP+KR +N+ILF+LD+  TY  +YP F         E
Sbjct: 1   MQRFVSKFVSTPPVP--KKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQVSQNTNEE 58

Query: 52  TLYLKHELPSTVSGPQLLLMDRVLLEVSKQQKMINEVLMKMRGELLELAAGKGENDAIST 111
            +  + + P  +    ++ M  VL+ +  Q K +++ L+ M  +LL +AA  G NDAIS 
Sbjct: 59  NIPWRKKYP-YIRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAISI 117

Query: 112 VCYNILSSPKDDS-----KGDAEDASRLIGELVKAGNVLTFKHLGDLSRLKGDINEAKLW 166
           + +N++   K ++     + D E A+  I +L    + LT K +GDL       ++A+ +
Sbjct: 118 LSFNVIHEYKKENVKSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKY 177

Query: 167 YDKFMECVDQDETRVSDVSIIGQVLERLGEIEFNQ-SRVLGAEKYWLDAIARSKLEDSVK 225
           Y +F++   ++ T+++     G+V  +LGEI+  Q +  L AEK WL  I   ++E S +
Sbjct: 178 YQEFLKL--ENSTKLA-----GEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEIERSSR 230

Query: 226 SYFYLSKVYLNSEPLKSRVLLENCATQGFRESFKELGYLELNYFKNLVKANEWFRLGMEL 285
            YF L+++Y++SEP+K++ LLENCA+ GF+E FK LG+LELNYF N  +A EWF+ GME+
Sbjct: 231 WYFLLARLYMSSEPMKAKALLENCASIGFKECFKTLGFLELNYFNNYERAKEWFKTGMEI 290

Query: 286 FEIECFFGFFDSCYQLKEYKSCSKCLKSLETFKNINESYKNMVSEFVSHRENKINNMNK 344
            ++ECFFGFFD C + + +K    CL+S++   N ++  K M++ F+  R++ I  ++K
Sbjct: 291 MDLECFFGFFDCCVKEENFKGARDCLESVKKLGN-DKDKKTMINVFLESRKDSIKLLDK 348

>CAGL0H10296g complement(1004900..1006021) similar to sp|P40990
           Saccharomyces cerevisiae YDL107w MSS2 ser/thr protein
           kinase, hypothetical start
          Length = 373

 Score =  203 bits (517), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 125/345 (36%), Positives = 205/345 (59%), Gaps = 20/345 (5%)

Query: 18  RPFHEIFPRKRLINRILFELDSNDTYKTLYPNFETLYLKHELPST------VSGPQLLLM 71
           + F E FP+K+ IN++LF+L+S  TYK LYP +  LY    +P        V G  L++M
Sbjct: 22  KKFMEHFPKKKTINKLLFDLNSRLTYKKLYPIYVGLYHGVPVPQQQKLLDGVKGSDLIVM 81

Query: 72  DRVLLEVSKQQKMINEVLMKMRGELLELAAGKGENDAISTVCY-NILSSPKDDSKGDAED 130
             VL +V  + +     ++K+  +LLELAA  G NDAI+ + + +I  +   +S  +A +
Sbjct: 82  RNVLEKVRNRTRYARPDMLKLEDKLLELAAELGNNDAIAILSFRSIRENMGTNSAAEANN 141

Query: 131 -----ASRLIGELVKAGNVLTFKHLGDLSRLKGDINEAKLWYDKFMECVDQDETRV--SD 183
                A +L  +L    ++L  K LGDL+    +  EA  +Y+K++    +D   +   +
Sbjct: 142 EEVTIAKKLFKDLYNINHLLAIKLLGDLALEANNWEEALTFYNKYINIAVKDNGHLLTGN 201

Query: 184 VSIIGQVLERLGEIEFNQ-SRVLGAEKYWLDAIARSKLEDSVKSYFYLSKVYLNSEPLKS 242
             + G+V  +LGEIEF   + +  AE+YW   +  + +EDSV+ YF  +++Y++SEPLKS
Sbjct: 202 DDLTGEVYGKLGEIEFTYLANMTKAEEYWQKCLELTSVEDSVRWYFLAAQIYMSSEPLKS 261

Query: 243 RVLLENCATQGFRESFKELGYLELNYFKNLVKANEWFRLGMELFEIECFFGFFDSCYQLK 302
           R+LLE  A+QGF+ES   LG+LE+NYF++  +A EWF+LGME+FE++ + GFFD C + +
Sbjct: 262 RILLEKAASQGFKESLTSLGFLEMNYFRDYGRAKEWFKLGMEVFELQSYIGFFDCCVKNE 321

Query: 303 EYKSCSKCLKSLETFKNI-----NESYKNMVSEFVSHRENKINNM 342
           ++ +  KCLKS+E    +     + + K  VS F++ R   I+ +
Sbjct: 322 DWIAALKCLKSIEKIGTMESFGSDNTNKATVSNFMNSRAEFIDKV 366

>CAGL0H04719g 452786..453319 similar to sp|Q04231 Saccharomyces
           cerevisiae YML011c, hypothetical start
          Length = 177

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 14/111 (12%)

Query: 35  FELDSNDTYKTLYPNFETLYLKHELPSTVSGPQLLLMDRVLLEVSKQQK--------MIN 86
           F L+ +   K + P FE+L L       V   Q+++    +++  K  K        M N
Sbjct: 35  FSLEGDMVVKDMVPYFESLELPRRFYKHVRKDQVVIEGTDIVDFDKLLKLTYHILVFMDN 94

Query: 87  EVLMKMRGELLELAAGKGENDAISTVCYNILSSPKDDSK-----GDAEDAS 132
           E L+    ELL  ++GK  N ++  +  ++L S KD  K     GDA++ S
Sbjct: 95  ETLIDSLWELLIRSSGKDRNGSVRDIKDHVL-SIKDFQKIENYLGDAQNIS 144

>AAL146W [41] [Homologous to ScYGR184C (UBR1) - SH]
            complement(92509..98211) [5703 bp, 1900 aa]
          Length = 1900

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 125  KGDAEDASRLIGELVKAGNVLTFKHLGDLSRLKGDINE----AKLWYDKFMECVDQDE 178
            K    + S  +G++V    +++ KHL +L+   GD       AKL Y     C+D+++
Sbjct: 980  KTHLAEGSNAVGQVVLQPQLISPKHLDELAAHLGDFTRTQVFAKLIYKLLQACIDRED 1037

>YER007W (PAC2) [1429] chr5 (164526..166082) Putative
           tubulin-specific chaperone, involved in formation of
           alpha-beta-tubulin heterodimer [1557 bp, 518 aa]
          Length = 518

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 304 YKSCSKCLKSLETFKNINESYKNMVSEFVSHRENKI 339
           YK   K LKS  T K ++ SY N+ S  + + EN+I
Sbjct: 217 YKHIGKLLKSFRTLKMLDLSYNNLTSAGIQNFENEI 252

>YDR030C (RAD28) [881] chr4 complement(501749..503269) Protein
           involved in the same pathway as Rad26p, has WD (WD-40)
           repeats [1521 bp, 506 aa]
          Length = 506

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 4/46 (8%)

Query: 133 RLIGELVKAGNVLTFKHLG--DLSRLK--GDINEAKLWYDKFMECV 174
           R   E+++   + ++  LG  DLSR+K    ++   LW+DKF+ C+
Sbjct: 387 RPFTEILQPEGLASYSQLGTQDLSRIKYKKRVSRRLLWFDKFLLCI 432

>YGR047C (TFC4) [2012] chr7 complement(586394..589471) RNA
           polymerase transcription III initiation factor TFIIIC
           (tau), 131 kDa subunit, has 11 tetratricopeptide (TPR)
           repeats [3078 bp, 1025 aa]
          Length = 1025

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 125 KGDAEDASRLIGELVK--AGNVLTFKHLGDLSRLKGDINE 162
           + D + A RL  E++K  A N   ++ LGD+ +L+G +N+
Sbjct: 141 RNDLQVAERLFNEVIKKDARNFAAYETLGDIYQLQGRLND 180

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,240,835
Number of extensions: 491180
Number of successful extensions: 1833
Number of sequences better than 10.0: 31
Number of HSP's gapped: 1856
Number of HSP's successfully gapped: 31
Length of query: 348
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 246
Effective length of database: 13,065,073
Effective search space: 3214007958
Effective search space used: 3214007958
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)