Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_613.1149349322170.0
YDL106C (PHO2)5593718441e-107
Sklu_2101.44913218371e-106
AFL202C4813127742e-97
KLLA0D10043g4883507724e-97
Kwal_23.34944663007583e-95
CAGL0L07436g5152486264e-75
KLLA0B01584g464551477e-10
Kwal_47.18450370541324e-08
YML027W (YOX1)385541315e-08
Sklu_797.1386541235e-07
CAGL0G07249g345551182e-06
AER314W431541156e-06
Scas_641.12413541148e-06
YDR451C (YHP1)353631084e-05
Kwal_33.129919138932e-04
ADL394C10252860.003
AFR643C10252850.003
AER456W5743810.005
KLLA0C03135g22853830.030
KLLA0B14553g22853830.030
Sklu_2417.1159160790.15
Sklu_2417.1059160790.15
KLLA0D12892g45490701.4
Kwal_56.2229558347701.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_613.11
         (493 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_613.11                                                           858   0.0  
YDL106C (PHO2) [763] chr4 complement(270222..271901) Homeodomain...   329   e-107
Sklu_2101.4 YDL106C, Contig c2101 7279-8754 reverse complement        327   e-106
AFL202C [2993] [Homologous to ScYDL106C (PHO2) - SH] (56150..575...   302   2e-97
KLLA0D10043g 849549..851015 some similarities with sp|P07269 Sac...   301   4e-97
Kwal_23.3494                                                          296   3e-95
CAGL0L07436g 818510..820057 similar to sp|P07269 Saccharomyces c...   245   4e-75
KLLA0B01584g complement(125027..126421) weakly similar to sp|P34...    61   7e-10
Kwal_47.18450                                                          55   4e-08
YML027W (YOX1) [3938] chr13 (221406..222563) Protein involved in...    55   5e-08
Sklu_797.1 YML027W, Contig c797 554-1714 reverse complement            52   5e-07
CAGL0G07249g complement(688189..689226) similar to sp|P34161 Sac...    50   2e-06
AER314W [2815] [Homologous to ScYML027W (YOX1) - SH; ScYDR451C (...    49   6e-06
Scas_641.12                                                            49   8e-06
YDR451C (YHP1) [1270] chr4 complement(1361108..1362169) Protein ...    46   4e-05
Kwal_33.12991                                                          40   2e-04
ADL394C [1347] [Homologous to ScYCR097W (HMRA1) - NSH] (18058..1...    38   0.003
AFR643C [3835] [Homologous to ScYCR097W (HMRA1) - SH] (1607899.....    37   0.003
AER456W [2956] [Homologous to ScYCR097W (HMRA1) - NSH] complemen...    36   0.005
KLLA0C03135g complement(279869..280555) gi|10643642|gb|AAG21094....    37   0.030
KLLA0B14553g complement(1278622..1279308) sp|Q9HG12 Kluyveromyce...    37   0.030
Sklu_2417.11 , Contig c2417 20071-21846                                35   0.15 
Sklu_2417.10 , Contig c2417 20071-21846                                35   0.15 
KLLA0D12892g 1099951..1101315 weakly similar to sp|Q03236 Saccha...    32   1.4  
Kwal_56.22295                                                          32   1.8  

>Scas_613.11
          Length = 493

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/493 (88%), Positives = 434/493 (88%)

Query: 1   MSSSNQHAADPVENQMLDFHSNMINDILSQGQSFNEHFDLEYNLLTSSNNPSVMPPTXXX 60
           MSSSNQHAADPVENQMLDFHSNMINDILSQGQSFNEHFDLEYNLLTSSNNPSVMPPT   
Sbjct: 1   MSSSNQHAADPVENQMLDFHSNMINDILSQGQSFNEHFDLEYNLLTSSNNPSVMPPTEQQ 60

Query: 61  XXXXXXXXXXXXXXXNNTPPXXXXXXXXVKRMPKSRRKRAKGEELNILKSHFELNPNPSN 120
                          NNTPP        VKRMPKSRRKRAKGEELNILKSHFELNPNPSN
Sbjct: 61  EQGQGQEHDEEQEQGNNTPPSSSSNSASVKRMPKSRRKRAKGEELNILKSHFELNPNPSN 120

Query: 121 EERKKISNLVGMPEKSVRIWFQNRRAXXXXXXXXXXXXXXXMDSNDEDFNDETSPNTDSN 180
           EERKKISNLVGMPEKSVRIWFQNRRA               MDSNDEDFNDETSPNTDSN
Sbjct: 121 EERKKISNLVGMPEKSVRIWFQNRRAKVKKHNNLKNRNNANMDSNDEDFNDETSPNTDSN 180

Query: 181 NAKFFDRIPVRINKNYNFIDVCSITVGSWNRKKYGSLLPEDLPIVEKLSNLSPVSMNNIM 240
           NAKFFDRIPVRINKNYNFIDVCSITVGSWNRKKYGSLLPEDLPIVEKLSNLSPVSMNNIM
Sbjct: 181 NAKFFDRIPVRINKNYNFIDVCSITVGSWNRKKYGSLLPEDLPIVEKLSNLSPVSMNNIM 240

Query: 241 SNSTDLIVLTSKKNDEINYFFSAMANDTKILFRIFFPISSVKNCSLSLEXXXXXXXXXXX 300
           SNSTDLIVLTSKKNDEINYFFSAMANDTKILFRIFFPISSVKNCSLSLE           
Sbjct: 241 SNSTDLIVLTSKKNDEINYFFSAMANDTKILFRIFFPISSVKNCSLSLETDDDIITNNNV 300

Query: 301 XXXXXXXERLGELKLILTKPPTFAVYFIKSDENETVPSINQWSICEDFSEGKQVTDAFIG 360
                  ERLGELKLILTKPPTFAVYFIKSDENETVPSINQWSICEDFSEGKQVTDAFIG
Sbjct: 301 TNSSDTSERLGELKLILTKPPTFAVYFIKSDENETVPSINQWSICEDFSEGKQVTDAFIG 360

Query: 361 GSNLPHVLSGLQDSLKFLNSHILEYKSTNEILPPSTITVPSHQLQSHDLMTPMQYSSSST 420
           GSNLPHVLSGLQDSLKFLNSHILEYKSTNEILPPSTITVPSHQLQSHDLMTPMQYSSSST
Sbjct: 361 GSNLPHVLSGLQDSLKFLNSHILEYKSTNEILPPSTITVPSHQLQSHDLMTPMQYSSSST 420

Query: 421 GTNDSLLPNIISPPNTNTLFSLLMPDQNSDSNLLNNHETDNLLPNSNSQQHQNESEPSNF 480
           GTNDSLLPNIISPPNTNTLFSLLMPDQNSDSNLLNNHETDNLLPNSNSQQHQNESEPSNF
Sbjct: 421 GTNDSLLPNIISPPNTNTLFSLLMPDQNSDSNLLNNHETDNLLPNSNSQQHQNESEPSNF 480

Query: 481 FFENYDQETGKWL 493
           FFENYDQETGKWL
Sbjct: 481 FFENYDQETGKWL 493

>YDL106C (PHO2) [763] chr4 complement(270222..271901) Homeodomain
           protein required for expression of phosphate pathway and
           other genes [1680 bp, 559 aa]
          Length = 559

 Score =  329 bits (844), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 177/371 (47%), Positives = 227/371 (61%), Gaps = 41/371 (11%)

Query: 94  KSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRRAXXXXXXX 153
           + +R RAKGE L++LK  FE+NP PS  ERKKIS+L+GMPEK+VRIWFQNRRA       
Sbjct: 78  RPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQH 137

Query: 154 XXXXXXXXMDSNDEDFNDETSPNTDSN--------------NAKFFDRIPVRINKNYNFI 199
                      + +  ND    +TD+N              +  FFDRIP+  N NY F 
Sbjct: 138 GSNKDTIPSSQSRDIANDYDRGSTDNNLVTTTSTSSIFHDEDLTFFDRIPLNSNNNYYFF 197

Query: 200 DVCSITVGSWNRKKYGSLLPEDLPIVEKLSNLSPVSMNNIMSNSTDLIVLTSKKNDEINY 259
           D+CSITVGSWNR K G+L   +   +++L NLSP+ +NNIMSN+TDL+VL SKKN EINY
Sbjct: 198 DICSITVGSWNRMKSGALQRRNFQSIKELRNLSPIKINNIMSNATDLMVLISKKNSEINY 257

Query: 260 FFSAMANDTKILFRIFFPISSVKNCSLSLEXXXXXXXXXXX------------------- 300
           FFSAMAN+TKILFRIFFP+SSV NCSL+LE                              
Sbjct: 258 FFSAMANNTKILFRIFFPLSSVTNCSLTLETDDDIINSNNTSDKNNSNTNNDDDNDDNSN 317

Query: 301 -------XXXXXXXERLGELKLILTKPPTFAVYFIKSDENETVPSINQWSICEDFSEGKQ 353
                         +  GELKL +T+ PTFAVYF+ +  +E     NQWSIC+DFSEG+Q
Sbjct: 318 EDNDNSSEDKRNAKDNFGELKLTVTRSPTFAVYFLNNAPDEDPNLNNQWSICDDFSEGRQ 377

Query: 354 VTDAFIGGSNLPHVLSGLQDSLKFLNSHILEYKSTNEILPPSTITVPSHQLQSHDLMTP- 412
           V DAF+GGSN+PH L GLQ SL+F+NS IL+YKS+NEILP     +P+  +   ++  P 
Sbjct: 378 VNDAFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEILPTINTAIPTAAVPQQNIAPPF 437

Query: 413 MQYSSSSTGTN 423
           +  +SS+T +N
Sbjct: 438 LNTNSSATDSN 448

>Sklu_2101.4 YDL106C, Contig c2101 7279-8754 reverse complement
          Length = 491

 Score =  327 bits (837), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 175/321 (54%), Positives = 218/321 (67%), Gaps = 14/321 (4%)

Query: 93  PKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRRAXXXXXX 152
           PK++R RA GE L ILK  F++NPNP+ + RK+IS++  +PEK+VRIWFQNRRA      
Sbjct: 71  PKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRKSG 130

Query: 153 XXXXXXXXXMDSNDEDFNDETSPNTDSNNAKFFDRIPVRINKNYNFIDVCSITVGSWNRK 212
                          D N   S +   +    FDRIP+ IN NY F+DV S+TVGSW R 
Sbjct: 131 RQNPRPSAL------DMNGIGSLSLTVD----FDRIPLNINNNYYFLDVSSLTVGSWKRL 180

Query: 213 KYGSLLPEDLPIVEKLSNLSPVSMNNIMSNSTDLIVLTSKKNDEINYFFSAMANDTKILF 272
           K G+L  E LP ++ LSNLSP+S+N+IMSNSTDL+VL SKKN EINYFFSA+AN+TKILF
Sbjct: 181 KSGNLDKESLPNIKDLSNLSPISINDIMSNSTDLMVLISKKNFEINYFFSAIANNTKILF 240

Query: 273 RIFFPISSVKNCSLSLEXXXXXXXXXXXXXXXXX-XERLGELKLILTKPPTFAVYFIKSD 331
           RIFFPI+SV NCSLS E                   E+  ELKL ++K P FAVYF  + 
Sbjct: 241 RIFFPINSVVNCSLSFEADSIRKENEDQDEQDQDPSEKTCELKLTVSKSPKFAVYFSDAV 300

Query: 332 ENETVPSINQWSICEDFSEGKQVTDAFIGGSNLPHVLSGLQDSLKFLNSHILEYKSTNEI 391
           E+ T    NQWSICEDFSEG+QV+DAF+GGSNLPHVL+GL+DSLKF+NS IL+Y STN+I
Sbjct: 301 EHFTS---NQWSICEDFSEGRQVSDAFVGGSNLPHVLNGLEDSLKFMNSLILDYNSTNQI 357

Query: 392 LPPSTITVPSHQLQSHDLMTP 412
           +PP T+T P    Q   ++ P
Sbjct: 358 IPPPTVTQPHAVSQQSMILQP 378

>AFL202C [2993] [Homologous to ScYDL106C (PHO2) - SH] (56150..57595)
           [1446 bp, 481 aa]
          Length = 481

 Score =  302 bits (774), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 165/312 (52%), Positives = 207/312 (66%), Gaps = 29/312 (9%)

Query: 93  PKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRRAXXXXXX 152
           PKS+R RA GE L +LK  F++NPNP+ + RK+IS   G+PEK+VRIWFQNRRA      
Sbjct: 60  PKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYR--- 116

Query: 153 XXXXXXXXXMDSNDEDFNDETSPNTDSNN------AKFFDRIPVRINKNYNFIDVCSITV 206
                       +D  FN  T+  TD N          +D+IP+ IN NY FID  S+TV
Sbjct: 117 -----------KSDRTFNQRTAA-TDMNTFGSISVTVEYDKIPLNINDNYYFIDANSLTV 164

Query: 207 GSWNRKKYGSLLPEDLPIVEKLSNLSPVSMNNIMSNSTDLIVLTSKKNDEINYFFSAMAN 266
           GSW R K G+L  E L  ++ LSNLSP S+N IMSN+TDL+VL SKKN E+NYFFSA+AN
Sbjct: 165 GSWKRLKSGNLHRESLSNIKYLSNLSPTSINMIMSNATDLMVLISKKNFEVNYFFSAIAN 224

Query: 267 DTKILFRIFFPISSVKNCSLSLEXXXXXXXXXXX-----XXXXXXXERLGELKLILTKPP 321
           +TKILFRIFFPI+SV NCSL L                        E++ ELKL ++KPP
Sbjct: 225 NTKILFRIFFPINSVLNCSLLLHAEGGKKDEDDANNVVQETTAPAAEQVCELKLNVSKPP 284

Query: 322 TFAVYFIKSDENETVPSINQWSICEDFSEGKQVTDAFIGGSNLPHVLSGLQDSLKFLNSH 381
            FAVYF  SD N+ + S NQWSICEDFSEG+QV+DA++GGSN PHVL+GL+ SLKF++S 
Sbjct: 285 NFAVYF--SDMNDELTS-NQWSICEDFSEGRQVSDAYVGGSNFPHVLTGLEASLKFMSSL 341

Query: 382 ILEYKSTNEILP 393
           IL+Y ST  ++P
Sbjct: 342 ILDYNSTTHVVP 353

>KLLA0D10043g 849549..851015 some similarities with sp|P07269
           Saccharomyces cerevisiae YDL106c GRF10 homeodomain
           protein singleton, hypothetical start
          Length = 488

 Score =  301 bits (772), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 174/350 (49%), Positives = 226/350 (64%), Gaps = 43/350 (12%)

Query: 97  RKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRRAXXXXXXXXXX 156
           R RA GE L ILK  F+LNP+P+ + RK+IS + G+PEK+VRIWFQNRR+          
Sbjct: 101 RTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRK------ 154

Query: 157 XXXXXMDSNDEDFNDETSPNTDSNNAKF-FDRIPVRINKNYNFIDVCSITVGSWNRKKYG 215
                   +D+  N   + +  +  + F FD+IP+ IN +Y FID+ S+TVGSW R K G
Sbjct: 155 --------SDKRMNGPGATDNTTLVSSFEFDKIPLAINSSYYFIDISSLTVGSWKRLKSG 206

Query: 216 SLLPEDLPIVEKLSNLSPVSMNNIMSNSTDLIVLTSKKNDEINYFFSAMANDTKILFRIF 275
           +L  + LP ++KLSNLSP+S+N IM+N+TDL+VL SKKN EINYFFSA+AN+TKILFRIF
Sbjct: 207 NLRSDSLPQIQKLSNLSPISINTIMANATDLMVLISKKNFEINYFFSAIANNTKILFRIF 266

Query: 276 FPISSVKNCSLSLEXXXXXXXXXXXXXXXXXXE--------RLGELKLILTKPPTFAVYF 327
           FPI++V NCSLSL+                  +        +L EL+L L+K P FAVYF
Sbjct: 267 FPINTVVNCSLSLDNTESLKGDAKNSNSPSSLDGNNDTNSSKLAELRLSLSKSPKFAVYF 326

Query: 328 IKSDENETV--PSINQWSICEDFSEGKQVTDAFIGGSNLPHVLSGLQDSLKFLNSHILEY 385
                +ET+   S NQWSICEDFSEG+QV DAFIGGSN+PHVL+GL +SLKF+NS IL+ 
Sbjct: 327 -----SETIDDASSNQWSICEDFSEGRQVNDAFIGGSNIPHVLTGLDESLKFMNSLILDM 381

Query: 386 KSTNEILPPSTITVPSHQLQSHDLMT---PMQYSSSSTGTNDSLLPNIIS 432
            ST E  PP+T      QLQ H +M    P    S++   ND   PN+I+
Sbjct: 382 NST-EHFPPTT------QLQ-HGIMHSMPPTDTQSTALRFNDD--PNLIA 421

>Kwal_23.3494
          Length = 466

 Score =  296 bits (758), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 156/300 (52%), Positives = 198/300 (66%), Gaps = 17/300 (5%)

Query: 93  PKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRRAXXXXXX 152
           P+++R RA GE LN+LK  F+ NPNP+ + RK+IS L G+PEK+VRIWFQNRRA      
Sbjct: 53  PRTKRTRATGEALNVLKREFDQNPNPNAQNRKRISELTGLPEKNVRIWFQNRRAKHRKSD 112

Query: 153 XXXXXXXXXMDSNDEDFNDETSPNTDSNNAKFFDRIPVRINKNYNFIDVCSITVGSWNRK 212
                     D   E         T +  A  FDRIP+  N NY FIDV S+TVGSW R 
Sbjct: 113 RGGTRGSATTDVAGEP--------TGAIPALDFDRIPLDSNSNYCFIDVKSLTVGSWKRL 164

Query: 213 KYGSLLPEDLPIVEKLSNLSPVSMNNIMSNSTDLIVLTSKKNDEINYFFSAMANDTKILF 272
           K G+L  +DLP V++LSNLSPVS+N IM+N+TDL+VL SKKN EINYFFSA+AN+TKILF
Sbjct: 165 KSGNLKQDDLPTVQRLSNLSPVSINEIMANATDLMVLISKKNHEINYFFSAIANNTKILF 224

Query: 273 RIFFPISSVKNCSLSLEXXXXXXXXXXXXXXXXXXERLGELKLILTKPPTFAVYFIKSDE 332
           RIFFPI++  +C+LS                     +L EL+L L+K PTFAVYF  SD 
Sbjct: 225 RIFFPITTTVDCALS------ATTDGAESVRSDAHNKLCELRLNLSKAPTFAVYF--SDG 276

Query: 333 NETVPSINQWSICEDFSEGKQVTDAFIGGSNLPHVLSGLQDSLKFLNSHILEYKSTNEIL 392
            +   S NQWSICEDFSE +QV++AFIGG N+PH+L+GL+ SL F+ S I ++ S   +L
Sbjct: 277 ADQFSS-NQWSICEDFSEERQVSEAFIGGLNIPHILTGLESSLSFMCSSIQDHNSGAHVL 335

>CAGL0L07436g 818510..820057 similar to sp|P07269 Saccharomyces
           cerevisiae YDL106c GRF10 homeodomain protein,
           hypothetical start
          Length = 515

 Score =  245 bits (626), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 136/248 (54%), Positives = 164/248 (66%), Gaps = 20/248 (8%)

Query: 184 FFDRIPVRINKNYNFIDVCSITVGSWNRKKYGSLLPEDLPIVEKLSNLSPVSMNNIMSNS 243
           +FD++P+ IN NY FIDV SITVGSWNR K GSL    LP+V+ L NLSPVSMN +MS++
Sbjct: 127 YFDKLPLNINNNYYFIDVFSITVGSWNRMKSGSLTANSLPVVKDLPNLSPVSMNQLMSDA 186

Query: 244 TDLIVLTSKKNDEINYFFSAMANDTKILFRIFFPISSVKNCSLSLEXXXXXXXXXXXXXX 303
           TDL+V+ SKKN EINYFFSAMAN+TKILFRIFF I++V +CSLS +              
Sbjct: 187 TDLMVVISKKNFEINYFFSAMANNTKILFRIFFRINTVASCSLSFD-----KTDEEINNR 241

Query: 304 XXXXERLGELKLILTKPPTFAVYFIKSDENETVPSINQWSICEDFSEGKQVTDAFIGGSN 363
                +  ELKL + KPP FAVYF+   EN      NQW +CEDFSEGKQV DAF+GGSN
Sbjct: 242 TDPANKQAELKLKVNKPPKFAVYFLNQPENNNT---NQWCLCEDFSEGKQVNDAFVGGSN 298

Query: 364 LPHVLSGLQDSLKFLNSHILEYKSTNEI-----LPPSTITVPSHQLQSHDLMTP-----M 413
           +PHVL GL+ SLK LNS IL+Y STN+      LPP    V S  L  H  M P     M
Sbjct: 299 VPHVLKGLESSLKILNSLILDYISTNDTITSAPLPPPPTNVGSDIL--HPQMHPAPHGLM 356

Query: 414 QYSSSSTG 421
            Y++  +G
Sbjct: 357 AYNAGMSG 364

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (86%)

Query: 94  KSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRRA 146
           KS+R RAKGE L+ILKS F+LNPNPS +ER +IS L GMPEK+VRIWFQNRRA
Sbjct: 6   KSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRA 58

>KLLA0B01584g complement(125027..126421) weakly similar to sp|P34161
           Saccharomyces cerevisiae YML027w YOX1 homoeodomain
           protein, start by similarity
          Length = 464

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%)

Query: 91  RMPKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRR 145
           ++ + +R+R    E +ILK  FE+NP PS E R ++S +  M EK+V++WFQNRR
Sbjct: 207 QLARRKRRRTSKNESDILKKEFEVNPAPSKERRSELSIICNMSEKAVQVWFQNRR 261

>Kwal_47.18450
          Length = 370

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (66%)

Query: 92  MPKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRR 145
           + + +R+R    ELNIL+S FEL P P   +R ++S    M EK+++IWFQN+R
Sbjct: 158 LARRKRRRTSKHELNILQSEFELCPTPDKFKRIELSERCCMSEKAIQIWFQNKR 211

>YML027W (YOX1) [3938] chr13 (221406..222563) Protein involved in
           transcriptional derepression during the M/G1 phase of
           the cell cycle along with Yhp1p, contains homeodomain
           [1158 bp, 385 aa]
          Length = 385

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 38/54 (70%)

Query: 92  MPKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRR 145
           + + +R+R   +EL+IL++ FE  P PS E+R +++    M EK+V+IWFQN+R
Sbjct: 175 LARRKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKR 228

>Sklu_797.1 YML027W, Contig c797 554-1714 reverse complement
          Length = 386

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 35/54 (64%)

Query: 92  MPKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRR 145
           + + +R+R    ELNIL++ FE    P  ++R +++    M EK+V+IWFQN+R
Sbjct: 168 LARRKRRRTSKNELNILQAEFEACSTPDKQKRIELAQRCSMSEKAVQIWFQNKR 221

>CAGL0G07249g complement(688189..689226) similar to sp|P34161
           Saccharomyces cerevisiae YML027w YOX1 homoeodomain
           protein, start by similarity
          Length = 345

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 35/55 (63%)

Query: 91  RMPKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRR 145
           ++ + +R+R   +ELNIL++ F+    P  + R  ++    M EK+V++WFQN+R
Sbjct: 152 QLARRKRRRTSSQELNILQAEFQRCSTPDKQTRINLAQRCNMTEKAVQVWFQNKR 206

>AER314W [2815] [Homologous to ScYML027W (YOX1) - SH; ScYDR451C
           (YHP1) - SH] complement(1218410..1219705) [1296 bp, 431
           aa]
          Length = 431

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 34/54 (62%)

Query: 92  MPKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRR 145
           + + +R+R    EL IL+  F+    PS E+R +++    M EK+V+IWFQN+R
Sbjct: 196 LARRKRRRTSKHELTILQQEFDQCRTPSKEKRIELATRCNMTEKAVQIWFQNKR 249

>Scas_641.12
          Length = 413

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 35/54 (64%)

Query: 92  MPKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRR 145
           + + +R+R    EL+IL++ FE    PS + R +++    M +K+V+IWFQN+R
Sbjct: 182 LARRKRRRTSSHELSILQAEFEKCSTPSKQVRLELAKRCSMTDKAVQIWFQNKR 235

>YDR451C (YHP1) [1270] chr4 complement(1361108..1362169) Protein
           involved in transcriptional derepression during the M/G1
           phase of the cell cycle along with Yox1p, contains a
           homeodomain [1062 bp, 353 aa]
          Length = 353

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%)

Query: 104 ELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRRAXXXXXXXXXXXXXXXMD 163
           EL IL++ F+  P P+  +R ++S    M EKSV+IWFQN+R                + 
Sbjct: 184 ELGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKKHKNSGNTSHCKVH 243

Query: 164 SND 166
           SND
Sbjct: 244 SND 246

>Kwal_33.12991
          Length = 91

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 108 LKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRR 145
           L+S FE   +P++ ERK I++  G+    VR+WF NRR
Sbjct: 52  LESVFEKKKSPNSRERKAIADKCGLTPVQVRVWFTNRR 89

>ADL394C [1347] [Homologous to ScYCR097W (HMRA1) - NSH]
           (18058..18366) [309 bp, 102 aa]
          Length = 102

 Score = 37.7 bits (86), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 94  KSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRR 145
           + RR     E    L+S FE    P+ +ER+ I+   G+    +RIWF N+R
Sbjct: 41  QRRRTVLPKEPKEFLESVFERKRCPNAKERRAIAEKCGLTPIQIRIWFTNKR 92

>AFR643C [3835] [Homologous to ScYCR097W (HMRA1) - SH]
           (1607899..1608207) [309 bp, 102 aa]
          Length = 102

 Score = 37.4 bits (85), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 94  KSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRR 145
           + RR     E    L+S FE    P+ +ER+ I+   G+    +RIWF N+R
Sbjct: 41  QRRRTVLPKETKEFLESVFERKRWPNAKERRAIAEKCGLTPIQIRIWFTNKR 92

>AER456W [2956] [Homologous to ScYCR097W (HMRA1) - NSH]
           complement(1512285..1512285,1512359..1512531) [174 bp,
           57 aa]
          Length = 57

 Score = 35.8 bits (81), Expect = 0.005,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 103 EELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRR 145
           E    L+S FE    P+ +ER+ I+   G+    +RIWF N+R
Sbjct: 5   ETKEFLESVFERKRCPNAKERRAIAEKCGLTPIQIRIWFTNKR 47

>KLLA0C03135g complement(279869..280555)
           gi|10643642|gb|AAG21094.1|AF195067_2 Kluyveromyces
           lactis a1p, start by similarity
          Length = 228

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 93  PKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRR 145
           P  +R   K E   IL+  F++   P+  ER  I+  + +    VRIWF N+R
Sbjct: 155 PTYKRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKR 207

>KLLA0B14553g complement(1278622..1279308) sp|Q9HG12 Kluyveromyces
           lactis A1p, start by similarity
          Length = 228

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 93  PKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRR 145
           P  +R   K E   IL+  F++   P+  ER  I+  + +    VRIWF N+R
Sbjct: 155 PTYKRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKR 207

>Sklu_2417.11 , Contig c2417 20071-21846
          Length = 591

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 188 IPVRINKNYNFIDVCSITVGSWNRKKYGSLLPEDLPIVEKLSNLSPVSMNNI-MSNSTDL 246
           IP  +  NY   D    T GSW+    GS++P D  +VEKL +   V   +  MS   D+
Sbjct: 144 IPFVVKDNYATKDKMDTTAGSWSLM--GSVVPRDAYVVEKLRDAGAVLFGHATMSEWADM 201

>Sklu_2417.10 , Contig c2417 20071-21846
          Length = 591

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 188 IPVRINKNYNFIDVCSITVGSWNRKKYGSLLPEDLPIVEKLSNLSPVSMNNI-MSNSTDL 246
           IP  +  NY   D    T GSW+    GS++P D  +VEKL +   V   +  MS   D+
Sbjct: 144 IPFVVKDNYATKDKMDTTAGSWSLM--GSVVPRDAYVVEKLRDAGAVLFGHATMSEWADM 201

>KLLA0D12892g 1099951..1101315 weakly similar to sp|Q03236
           Saccharomyces cerevisiae YMR187c hypothetical protein
           singleton, start by similarity
          Length = 454

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 11/90 (12%)

Query: 202 CSITVGSWNRKKYGSLLPEDLPIVEKLSNLSPVSMNNIMSNST-DLIVLTSKKNDEIN-- 258
           C   VG W  +   +L  E+L  + K+ N+S     ++ + +   ++ ++++K  +I   
Sbjct: 201 CLFKVGLWQLR---TLFSEEL--LRKILNISNTKALDVYAETLKGMLSISTEKQLQIIGF 255

Query: 259 --YFFSAMANDTK-ILFRIFFPISSVKNCS 285
             Y F+  AN T  +L RI FP   +KNC 
Sbjct: 256 PLYLFTFKANGTIPLLLRIVFPYFFLKNCG 285

>Kwal_56.22295
          Length = 583

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 188 IPVRINKNYNFIDVCSITVGSWNRKKYGSLLPEDLPIVEKLSNLSPV 234
           IP  +  NY   D    T GSW     GS++P D  +V KL +   V
Sbjct: 135 IPFVVKDNYATKDKMDTTCGSW--ALLGSVVPRDAHVVAKLRDAGAV 179

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.129    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,032,109
Number of extensions: 783780
Number of successful extensions: 3043
Number of sequences better than 10.0: 103
Number of HSP's gapped: 3049
Number of HSP's successfully gapped: 111
Length of query: 493
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 387
Effective length of database: 12,926,601
Effective search space: 5002594587
Effective search space used: 5002594587
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)