Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_611.5d65652921e-36
YPL189C-A68421862e-20
AFL069C58461601e-16
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_611.5d
         (65 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_611.5d                                                           117   1e-36
YPL189C-A (YPL189C-A) [5258] chr16 complement(188306..188512) Pr...    76   2e-20
AFL069C [3124] [Homologous to ScYPL190CX - SH] (305964..306140) ...    66   1e-16

>Scas_611.5d
          Length = 65

 Score =  117 bits (292), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 57/65 (87%), Positives = 57/65 (87%)

Query: 1  MRAVARNRLMNNLYLTTFVLTFASVAIGTVLPCPAHSVDSDTHLNEXXXXXXXXAKREED 60
          MRAVARNRLMNNLYLTTFVLTFASVAIGTVLPCPAHSVDSDTHLNE        AKREED
Sbjct: 1  MRAVARNRLMNNLYLTTFVLTFASVAIGTVLPCPAHSVDSDTHLNEQKQQQLQQAKREED 60

Query: 61 KEKQT 65
          KEKQT
Sbjct: 61 KEKQT 65

>YPL189C-A (YPL189C-A) [5258] chr16 complement(188306..188512)
          Protein of unknown function [207 bp, 68 aa]
          Length = 68

 Score = 76.3 bits (186), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 31/42 (73%), Positives = 39/42 (92%)

Query: 1  MRAVARNRLMNNLYLTTFVLTFASVAIGTVLPCPAHSVDSDT 42
          MRAV RN+++NNLY +TF++ FASVAIG+VLPCPAHSVDSD+
Sbjct: 1  MRAVTRNKIVNNLYFSTFLIAFASVAIGSVLPCPAHSVDSDS 42

>AFL069C [3124] [Homologous to ScYPL190CX - SH] (305964..306140)
          [177 bp, 58 aa]
          Length = 58

 Score = 66.2 bits (160), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 27/46 (58%), Positives = 39/46 (84%)

Query: 1  MRAVARNRLMNNLYLTTFVLTFASVAIGTVLPCPAHSVDSDTHLNE 46
          ++A  RNR+ N L++TTF++ F+SVA+G+VLPCPAHS+DSDT + E
Sbjct: 3  LKAATRNRVTNKLFVTTFLVAFSSVALGSVLPCPAHSLDSDTPVRE 48

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.128    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,644,844
Number of extensions: 42498
Number of successful extensions: 52
Number of sequences better than 10.0: 3
Number of HSP's gapped: 52
Number of HSP's successfully gapped: 3
Length of query: 65
Length of database: 16,596,109
Length adjustment: 38
Effective length of query: 27
Effective length of database: 15,280,625
Effective search space: 412576875
Effective search space used: 412576875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)