Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_611.5*78778728680.0
AFL070C75736112131e-155
YPL190C (NAB3)80243412101e-154
Sklu_2391.176138011901e-152
CAGL0H03267g77537011791e-150
Kwal_56.2394580635111451e-145
KLLA0E19327g73935210931e-138
YDR432W (NPL3)414531052e-04
CAGL0H04763g383531024e-04
Sklu_2182.3371621015e-04
KLLA0F18216g70880990.001
Scas_717.4137953980.001
Scas_530.4684105980.001
Scas_621.1041559970.002
KLLA0B00979g34278960.002
Sklu_1879.442176960.002
ADR183C32070950.002
Kwal_47.1857236355950.002
CAGL0E03245g42576940.004
Sklu_1790.347369930.006
AFR107W39664910.008
YGR159C (NSR1)41477910.008
YNL286W (CUS2)285110890.010
CAGL0E03630g74699890.015
ADR035C83881880.022
KLLA0F07799g52470880.023
CAGL0C01529g236112830.046
CAGL0H02211g381129840.047
Scas_635.758163850.050
AAL018W33756840.055
YOL041C (NOP12)45963830.078
Sklu_2060.3110111770.081
Scas_88.125690810.088
CAGL0M03795g51363820.10
Scas_241.118658780.14
YFR023W (PES4)61171800.18
CAGL0F01023g396134790.21
CAGL0K06655g80259800.21
YHR015W (MIP6)659110790.28
AAR151W48157780.35
Scas_576.757593780.37
AGR122C58559770.46
KLLA0B11594g11463710.48
KLLA0D14949g87881770.51
Kwal_14.185153547760.51
KLLA0A05346g87456770.52
YER165W (PAB1)577124760.60
CAGL0L11792g579151750.73
KLLA0A08338g76671750.74
YHL024W (RIM4)71347750.86
CAGL0B04169g86171740.98
YCL011C (GBP2)42796740.98
Kwal_55.2103911964681.4
KLLA0C17600g59267712.2
AEL217W83456712.5
Sklu_905.151592702.6
CAGL0L09449g11883653.4
YDR150W (NUM1)2748145694.1
Scas_570.1411385644.7
Scas_316.148360675.7
Kwal_23.520429435658.7
AGL038C71262669.7
KLLA0D11792g685686610.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_611.5*
         (787 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_611.5*                                                          1109   0.0  
AFL070C [3123] [Homologous to ScYPL190C (NAB3) - SH] (303268..30...   471   e-155
YPL190C (NAB3) [5257] chr16 complement(185316..187724) Nuclear p...   470   e-154
Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement         462   e-152
CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces c...   458   e-150
Kwal_56.23945                                                         445   e-145
KLLA0E19327g 1713099..1715318 some similarities with sp|P38741 S...   425   e-138
YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved i...    45   2e-04
CAGL0H04763g 454589..455740 highly similar to sp|Q01560 Saccharo...    44   4e-04
Sklu_2182.3 YDR432W, Contig c2182 3920-5035                            44   5e-04
KLLA0F18216g 1677731..1679857 some similarities with sp|P38741 S...    43   0.001
Scas_717.41                                                            42   0.001
Scas_530.4                                                             42   0.001
Scas_621.10                                                            42   0.002
KLLA0B00979g 77439..78467 some similarities with sp|Q01560 Sacch...    42   0.002
Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement         42   0.002
ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH] (1024792..1...    41   0.002
Kwal_47.18572                                                          41   0.002
CAGL0E03245g complement(299236..300513) similar to sp|P27476 Sac...    41   0.004
Sklu_1790.3 YOL041C, Contig c1790 1701-3122                            40   0.006
AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH] complement(...    40   0.008
YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar ...    40   0.008
YNL286W (CUS2) [4325] chr14 (95221..96078) Suppressor of U2 snRN...    39   0.010
CAGL0E03630g complement(335091..337331) weakly similar to sp|P38...    39   0.015
ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH] (768392..77...    39   0.022
KLLA0F07799g complement(734889..736463) similar to sp|Q08208 Sac...    39   0.023
CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces c...    37   0.046
CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces c...    37   0.047
Scas_635.7                                                             37   0.050
AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C (G...    37   0.055
YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein ...    37   0.078
Sklu_2060.3 YIR009W, Contig c2060 4599-4931                            34   0.081
Scas_88.1                                                              36   0.088
CAGL0M03795g complement(428607..430148) highly similar to sp|Q99...    36   0.10 
Scas_241.1                                                             35   0.14 
YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA po...    35   0.18 
CAGL0F01023g complement(108155..109345) similar to tr|Q08208 Sac...    35   0.21 
CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces c...    35   0.21 
YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similar...    35   0.28 
AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH] complement(6...    35   0.35 
Scas_576.7                                                             35   0.37 
AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH] (978634..98...    34   0.46 
KLLA0B11594g complement(1018044..1018388) some similarities with...    32   0.48 
KLLA0D14949g complement(1259860..1262496) similar to sgd|S000631...    34   0.51 
Kwal_14.1851                                                           34   0.51 
KLLA0A05346g 485886..488510 some similarities with sp|P53316 Sac...    34   0.52 
YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding prot...    34   0.60 
CAGL0L11792g 1259275..1261014 highly similar to sp|P04147 Saccha...    33   0.73 
KLLA0A08338g 736461..738761 weakly similar to sp|P39684 Saccharo...    33   0.74 
YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for s...    33   0.86 
CAGL0B04169g complement(404713..407298) highly similar to tr|Q06...    33   0.98 
YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein inv...    33   0.98 
Kwal_55.21039                                                          31   1.4  
KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces...    32   2.2  
AEL217W [2289] [Homologous to ScYGR250C - SH] complement(225217....    32   2.5  
Sklu_905.1 YMR268C, Contig c905 196-1743                               32   2.6  
CAGL0L09449g complement(1021490..1021846) no similarity, hypothe...    30   3.4  
YDR150W (NUM1) [994] chr4 (755622..763868) Nuclear migration pro...    31   4.1  
Scas_570.14                                                            29   4.7  
Scas_316.1                                                             30   5.7  
Kwal_23.5204                                                           30   8.7  
AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH] (639306..64...    30   9.7  
KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces...    30   10.0 

>Scas_611.5*
          Length = 787

 Score = 1109 bits (2868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/787 (73%), Positives = 579/787 (73%)

Query: 1   MIRRPKQPVHKHKQTIMSANELKETDMNTEEGQEQQIESVPEAPESSNVAATQXXXXXXX 60
           MIRRPKQPVHKHKQTIMSANELKETDMNTEEGQEQQIESVPEAPESSNVAATQ       
Sbjct: 1   MIRRPKQPVHKHKQTIMSANELKETDMNTEEGQEQQIESVPEAPESSNVAATQENKESEE 60

Query: 61  XXXXXXXXXTNLYXXXXXXXXXXXXXXXXXVATEQDNKXXXXXXXXXXXXXXXXXXXXXX 120
                    TNLY                 VATEQDNK                      
Sbjct: 61  DDSADDDENTNLYSDDNNGNSGDDADNSESVATEQDNKDKDAPSEDDDDEDDASDSDESE 120

Query: 121 XXXXXXXXQDEADSETESNEAAXXXXXXXXXXXXXXXXXXXXXXXPINNEEKNTSETVNT 180
                   QDEADSETESNEAA                       PINNEEKNTSETVNT
Sbjct: 121 EATSDVADQDEADSETESNEAANASDNGDEDESSEEQDETSEQAEPINNEEKNTSETVNT 180

Query: 181 EDTPADDTENVDHHLLHKQANYIMESGMLNRPEFQNLDDKQKITAIVNLLNSNPITQLNI 240
           EDTPADDTENVDHHLLHKQANYIMESGMLNRPEFQNLDDKQKITAIVNLLNSNPITQLNI
Sbjct: 181 EDTPADDTENVDHHLLHKQANYIMESGMLNRPEFQNLDDKQKITAIVNLLNSNPITQLNI 240

Query: 241 TKPDAIENVIPPPKTYNDSNEETQRPLSDAERRRLAPRPDLRNPMTPEERERYSVYLRGE 300
           TKPDAIENVIPPPKTYNDSNEETQRPLSDAERRRLAPRPDLRNPMTPEERERYSVYLRGE
Sbjct: 241 TKPDAIENVIPPPKTYNDSNEETQRPLSDAERRRLAPRPDLRNPMTPEERERYSVYLRGE 300

Query: 301 NKITEMHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSV 360
           NKITEMHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSV
Sbjct: 301 NKITEMHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSV 360

Query: 361 KDAIELESDEINFDKKLILEVSSSNSRPQFDHGDHGTNSSTTFISSAKRPFDNDEEDDTA 420
           KDAIELESDEINFDKKLILEVSSSNSRPQFDHGDHGTNSSTTFISSAKRPFDNDEEDDTA
Sbjct: 361 KDAIELESDEINFDKKLILEVSSSNSRPQFDHGDHGTNSSTTFISSAKRPFDNDEEDDTA 420

Query: 421 NMYNDIGVKRSKKRVPSCVIYVKRTADRNYANDVFKKFKDRTSLETDMIFLRPRMDLRKL 480
           NMYNDIGVKRSKKRVPSCVIYVKRTADRNYANDVFKKFKDRTSLETDMIFLRPRMDLRKL
Sbjct: 421 NMYNDIGVKRSKKRVPSCVIYVKRTADRNYANDVFKKFKDRTSLETDMIFLRPRMDLRKL 480

Query: 481 VNDAAYDGVWGVIFINKTHNVDIQTFYEGPHGETKFDEYVGVSVDDAVAIFINLKTSRNN 540
           VNDAAYDGVWGVIFINKTHNVDIQTFYEGPHGETKFDEYVGVSVDDAVAIFINLKTSRNN
Sbjct: 481 VNDAAYDGVWGVIFINKTHNVDIQTFYEGPHGETKFDEYVGVSVDDAVAIFINLKTSRNN 540

Query: 541 IRPPMGSQYNYDXXXXXXXXXXXXXXXXXXYYNSYGMXXXXXXXXXXXNYYSNYSAPPPQ 600
           IRPPMGSQYNYD                  YYNSYGM           NYYSNYSAPPPQ
Sbjct: 541 IRPPMGSQYNYDNQMNMGGPPPQGPAHQQGYYNSYGMPPQQGPPPPQQNYYSNYSAPPPQ 600

Query: 601 QQGYNAPPMDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 660
           QQGYNAPPMD                                                  
Sbjct: 601 QQGYNAPPMDQGYGRYQGGMPPQQQMGQGYGRYQNSSMAPPPPQQQQPPPPMQASQQNQL 660

Query: 661 XXXXXXXXXXXXPNPMDQQQLLSAIQNLPPNVVSSLLAAAXXXXXXXXXXXXXXXLIGLI 720
                       PNPMDQQQLLSAIQNLPPNVVSSLLAAA               LIGLI
Sbjct: 661 TNLLGNTSNTSNPNPMDQQQLLSAIQNLPPNVVSSLLAAAQQQQQQQQQPQTQQQLIGLI 720

Query: 721 XXXXXXXXXXXXXXXXLNQASPPPPMGNNYASQKISPPPSEQPAPTQQSPPGNNVQSLLD 780
                           LNQASPPPPMGNNYASQKISPPPSEQPAPTQQSPPGNNVQSLLD
Sbjct: 721 QSMQNQPPQQQTGYPQLNQASPPPPMGNNYASQKISPPPSEQPAPTQQSPPGNNVQSLLD 780

Query: 781 SLAKLQK 787
           SLAKLQK
Sbjct: 781 SLAKLQK 787

>AFL070C [3123] [Homologous to ScYPL190C (NAB3) - SH]
           (303268..305541) [2274 bp, 757 aa]
          Length = 757

 Score =  471 bits (1213), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 226/361 (62%), Positives = 278/361 (77%), Gaps = 26/361 (7%)

Query: 189 ENVDHHLLHKQANYIMESGMLNRPEFQNLDDKQKITAIVNLLNSNPITQLNITKPDAIEN 248
           EN+D  LL +Q  Y+++S ML+ PEFQ L  ++K+ AIV LLNSN  T +          
Sbjct: 185 ENIDRDLLQRQVQYVLDSDMLSLPEFQELSSREKVVAIVTLLNSNGDTSM---------- 234

Query: 249 VIPPPKTYNDSNEETQRPLSDAERRRLAPRPDLRNPMTPEERERYSVYLRGENKITEMHN 308
              P K        +   +S+A +RR  P PD+   MTPEER+RY+ YLRGEN+ITE+ +
Sbjct: 235 ---PSKG-------SSTGVSEAIKRRRFPPPDMSQAMTPEERQRYTEYLRGENRITEIEH 284

Query: 309 IPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSVKDAIELES 368
            P KSRLFIGNLPLKNV+KEDLFRIFSPYGHI QINIKNAFGFIQY+N QSVKDAIE ES
Sbjct: 285 FPPKSRLFIGNLPLKNVTKEDLFRIFSPYGHIFQINIKNAFGFIQYDNAQSVKDAIECES 344

Query: 369 DEINFDKKLILEVSSSNSRPQFDHGDHGTNSSTTFISSAKRPFDNDEEDDTANMYNDIGV 428
             +NF KKLILEVSSSNSRPQFDHGDHGTNSS+TF++S+KRPF  DE+ +  +MY+D   
Sbjct: 345 GTMNFGKKLILEVSSSNSRPQFDHGDHGTNSSSTFVTSSKRPF--DEQGEEEDMYSDNHY 402

Query: 429 KRSKKRVPSCVIYVKRTADRNYANDVFKKFKDRTSLETDMIFLRPRMDLRKLVNDAAYDG 488
           K++KKR+P C+I VKRTADR+YAN+VF  F++ + LETDM+FL+PRM+LRKL+NDAAYDG
Sbjct: 403 KKTKKRIPQCMILVKRTADRSYANEVFNIFRNGSGLETDMVFLKPRMELRKLINDAAYDG 462

Query: 489 VWGVIFINKTHNVDIQTFYEGPHGETKFDEYVGVSVDDAVAIFINLKTSR----NNIRPP 544
           VWGVI +NKT NVDIQTFY+GP GETKFDEYV VS +D++AIF NLKT+R     +I PP
Sbjct: 463 VWGVILVNKTRNVDIQTFYKGPQGETKFDEYVSVSCEDSIAIFNNLKTTRAGRTGSISPP 522

Query: 545 M 545
           +
Sbjct: 523 V 523

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (91%)

Query: 675 PMDQQQLLSAIQNLPPNVVSSLLA 698
           PMDQ QLL+AIQ+LP NV+SSLL+
Sbjct: 611 PMDQSQLLAAIQHLPQNVLSSLLS 634

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/16 (87%), Positives = 16/16 (100%)

Query: 772 GNNVQSLLDSLAKLQK 787
           G+NVQSLLDSLA+LQK
Sbjct: 742 GSNVQSLLDSLAQLQK 757

>YPL190C (NAB3) [5257] chr16 complement(185316..187724) Nuclear
           polyadenylated RNA-binding protein with one RNA
           recognition (RRM) domain [2409 bp, 802 aa]
          Length = 802

 Score =  470 bits (1210), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 251/434 (57%), Positives = 304/434 (70%), Gaps = 19/434 (4%)

Query: 187 DTENVDHHLLHKQANYIMESGMLNRPEFQNLDDKQKITAIVNLLNSNPITQLNITKPDAI 246
           + ENV++ LL KQ  YIM+S MLN P+FQ+L  ++K++AI+ +LNSN  T L++   D+ 
Sbjct: 202 NMENVNYDLLQKQVKYIMDSNMLNLPQFQHLPQEEKMSAILAMLNSNSDTALSVPPHDST 261

Query: 247 ENVIPPPKTYNDSNEETQR--PLSDAERRRLAPRPDLRNPMTPEERERYSVYLRGENKIT 304
            +        + +    QR  PLSDA+RR   PR DL  P+T EE +RY+ YL GENKIT
Sbjct: 262 ISTTASASATSGARSNDQRKPPLSDAQRRMRFPRADLSKPITEEEHDRYAAYLHGENKIT 321

Query: 305 EMHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSVKDAI 364
           EMHNIP KSRLFIGNLPLKNVSKEDLFRIFSPYGHI+QINIKNAFGFIQ++NPQSV+DAI
Sbjct: 322 EMHNIPPKSRLFIGNLPLKNVSKEDLFRIFSPYGHIMQINIKNAFGFIQFDNPQSVRDAI 381

Query: 365 ELESDEINFDKKLILEVSSSNSRPQFDHGDHGTNSSTTFISSAKRPFDNDEEDDTANMYN 424
           E ES E+NF KKLILEVSSSN+RPQFDHGDHGTNSS+TFISSAKRPF    + ++ +MYN
Sbjct: 382 ECESQEMNFGKKLILEVSSSNARPQFDHGDHGTNSSSTFISSAKRPF----QTESGDMYN 437

Query: 425 D---IGVKRSKKRVPSCVIYVKRTADRNYANDVFKKFKDRTSLETDMIFLRPRMDLRKLV 481
           D    G K+S++   SC I+VKRTADR YA +VF +F+D T LETDMIFL+PRM+L KL+
Sbjct: 438 DDNGAGYKKSRRHTVSCNIFVKRTADRTYAIEVFNRFRDGTGLETDMIFLKPRMELGKLI 497

Query: 482 NDAAYDGVWGVIFINKTHNVDIQTFYEGPHGETKFDEYVGVSVDDAVAIFINLKTSRNNI 541
           NDAAY+GVWGV+ +NKTHNVD+QTFY+G  GETKFDEY+ +S DDAVAIF N+K +RNN 
Sbjct: 498 NDAAYNGVWGVVLVNKTHNVDVQTFYKGSQGETKFDEYISISADDAVAIFNNIKNNRNNS 557

Query: 542 RP----PMGSQYNYDXX--XXXXXXXXXXXXXXXXYYNSYGMXXXXXXXXXXXNYYSNYS 595
           RP     M  Q N                      YY  Y M             Y NY 
Sbjct: 558 RPTDYRAMSHQQNIYGAPPLPVPNGPAVGPPPQTNYYQGYSMPPPQQQQQQP---YGNYG 614

Query: 596 APPPQQ-QGYNAPP 608
            PPP   QGY + P
Sbjct: 615 MPPPSHDQGYGSQP 628

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 60/130 (46%), Gaps = 18/130 (13%)

Query: 676 MDQQQLLSAIQNLPPNVVSSLLAAAXXXXXXXXXXXXXXXLIGLIXXXXXXXXXXXXXXX 735
           MDQQQLLSAIQNLPPNVVS+LL+ A               LI  +               
Sbjct: 673 MDQQQLLSAIQNLPPNVVSNLLSMAQQQQQQPHAQQQLVGLIQSMQGQAPQQQQQQLGGY 732

Query: 736 XLNQASPPPPMGNNYASQKISPPPSEQPAP------------------TQQSPPGNNVQS 777
               +S PPPM  NY  Q IS  PS  P                     QQ P GNNVQS
Sbjct: 733 SSMNSSSPPPMSTNYNGQNISAKPSAPPMSHQPPPPQQQQQQQQQQQQQQQQPAGNNVQS 792

Query: 778 LLDSLAKLQK 787
           LLDSLAKLQK
Sbjct: 793 LLDSLAKLQK 802

>Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement
          Length = 761

 Score =  462 bits (1190), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 239/380 (62%), Positives = 289/380 (76%), Gaps = 17/380 (4%)

Query: 176 ETVNTEDT--PADDT--ENVDHHLLHKQANYIMESGMLNRPEFQNLDDKQKITAIVNLLN 231
           +++ TE T  P  D   +NV++ LL +QA+YIM S MLN  EF+ L+  +KI AI+ +LN
Sbjct: 211 KSIGTESTTLPVSDAKGDNVNYDLLQRQADYIMASDMLNLQEFKELNSDEKIVAILTMLN 270

Query: 232 SNPITQLNITKPDAIENVIPPPKTYNDSNEETQRPLSDAERRRLAPRPDLRNPMTPEERE 291
           SNP T +    P   +  +    T N ++ E+        +RRL PR DL  PMTP ER+
Sbjct: 271 SNPETSM----PRPSQESVNTNVTNNSAHLES-------AKRRLHPRTDLSQPMTPIERQ 319

Query: 292 RYSVYLRGENKITEMHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGF 351
           RY+ YLRGEN+ITE+ + P KSRLFIGNLPLKNV+KEDLFRIFSPYGHI QINIKNAFGF
Sbjct: 320 RYTEYLRGENRITEIQHFPPKSRLFIGNLPLKNVTKEDLFRIFSPYGHIFQINIKNAFGF 379

Query: 352 IQYNNPQSVKDAIELESDEINFDKKLILEVSSSNSRPQFDHGDHGTNSSTTFISSAKRPF 411
           IQY++PQSVKDAIE ES E+NF KKLILE+SSSNSRPQFDHGDHGTNSS+TFISS+KRPF
Sbjct: 380 IQYDDPQSVKDAIECESQELNFGKKLILEISSSNSRPQFDHGDHGTNSSSTFISSSKRPF 439

Query: 412 DNDEEDDTANMYNDIGVKRSKKRVPSCVIYVKRTADRNYANDVFKKFKDRTSLETDMIFL 471
             +EE    +MY+D   K+ K+R+P C IYVKRTADR+YAN+VF KF+  T LETDMIFL
Sbjct: 440 AEEEE--EEDMYSDNTYKKGKRRIPQCQIYVKRTADRSYANEVFGKFRQGTGLETDMIFL 497

Query: 472 RPRMDLRKLVNDAAYDGVWGVIFINKTHNVDIQTFYEGPHGETKFDEYVGVSVDDAVAIF 531
           +PRM+LRK++ND+AYDGVWGV+ +NKT NVDIQTFY+GP GETKFDEY+ VS DDAVAIF
Sbjct: 498 KPRMELRKMINDSAYDGVWGVVLVNKTRNVDIQTFYKGPQGETKFDEYISVSCDDAVAIF 557

Query: 532 INLKTSRNNIRPPMGSQYNY 551
            NLK SR N    M  Q  Y
Sbjct: 558 NNLKNSRTNGGSGMSQQQYY 577

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 59/114 (51%), Gaps = 14/114 (12%)

Query: 675 PMDQQQLLSAIQNLPPNVVSSLLAAAXXXXXXXXXXXXXXXLIGLIXXXXXXXXXXXXXX 734
           P+DQQQLLSAIQ+LPPNVVSSLL+ A               LIGL+              
Sbjct: 661 PLDQQQLLSAIQHLPPNVVSSLLSMA-----QQQTQPQQQQLIGLVQSMQNQQPH----- 710

Query: 735 XXLNQASPPPPMGNNYASQKISPPP-SEQPAPTQQSPPGNNVQSLLDSLAKLQK 787
               QA P     N Y S + SP   S  P   QQ   GNNVQSLLDSLA+LQK
Sbjct: 711 ---QQAVPSQSNPNPYQSYQQSPSQMSNTPQQQQQPSGGNNVQSLLDSLAQLQK 761

>CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces
           cerevisiae YPL190c NAB3 polyadenylated RNA-binding
           protein, hypothetical start
          Length = 775

 Score =  458 bits (1179), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 226/370 (61%), Positives = 279/370 (75%), Gaps = 25/370 (6%)

Query: 187 DTENVDHHLLHKQANYIMESGMLNRPEFQNLDDKQKITAIVNLLNSNPITQLNITKPDAI 246
           + ENVD +L+ KQ  +I +S +L + +FQ L D +KIT ++ LLNSN  T+   T   A 
Sbjct: 223 EKENVDANLIEKQVKFIEDSHLLEKTQFQKLTDTEKITVVLKLLNSNTETKFQATNKKA- 281

Query: 247 ENVIPPPKTYNDSNEETQRPLSDAERRRLAPRPDLRNPMTPEERERYSVYLRGENKITEM 306
                               + D+   RL P+PD+  PMTPEE  RY+ YL+GENKITEM
Sbjct: 282 ------------------NAVVDSNGLRLFPKPDITKPMTPEESVRYNDYLKGENKITEM 323

Query: 307 HNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSVKDAIEL 366
           H+IP KSRLFIGNLPLKNVSK+DLFR+FSP+GHILQINIKNAFGFIQY+NP+SV+ AIE 
Sbjct: 324 HSIPPKSRLFIGNLPLKNVSKQDLFRLFSPFGHILQINIKNAFGFIQYDNPKSVRAAIEC 383

Query: 367 ESDEINFDKKLILEVSSSNSRPQFDHGDHGTNSSTTFISSAKRPFDNDEEDDTANMY--N 424
           ES EINF KKLILEVSSSN+RPQ+DHGDHGTNSS+TFIS++KRPF + E+++  +MY  N
Sbjct: 384 ESQEINFGKKLILEVSSSNNRPQYDHGDHGTNSSSTFISTSKRPFQH-EDEEPVDMYAEN 442

Query: 425 DIGVKRSKKRVPSCVIYVKRTADRNYANDVFKKFKDRTSLETDMIFLRPRMDLRKLVNDA 484
           +   K+ K+R PSCVI+VKRTADRNYAN+VF KF + T LETDM+FL+PR++LRKLVNDA
Sbjct: 443 NNAHKKPKRRTPSCVIFVKRTADRNYANEVFNKFNNMTGLETDMVFLKPRLELRKLVNDA 502

Query: 485 AYDGVWGVIFINKTHNVDIQTFYEGPHGETKFDEYVGVSVDDAVAIFINLKT--SRNNIR 542
           AY+GVWGVI +NKT N+D+QTF+ GP GETKFDEYV VS DDA AIF NLK   +R+   
Sbjct: 503 AYEGVWGVILVNKTRNLDVQTFHPGPRGETKFDEYVSVSADDAAAIFNNLKVIKNRSGGM 562

Query: 543 PPM-GSQYNY 551
           PP+ G Q  Y
Sbjct: 563 PPLAGPQSGY 572

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 55/114 (48%), Gaps = 1/114 (0%)

Query: 675 PMDQQQLLSAIQNLPPNVVSSLLAAAXXXXXXXXXXXXXXXLIGLIXXXXXXXXXXXXXX 734
           PM+QQQLL+AIQNLPPNVVS+LL+ A               +I  +              
Sbjct: 662 PMNQQQLLAAIQNLPPNVVSNLLSMAQQQQQQPDSQQQILNMIQSMQTPQQNQQQQQQQQ 721

Query: 735 XXLNQASPPPPMGNNYASQKISPPPSEQPAPTQQ-SPPGNNVQSLLDSLAKLQK 787
             +N        GN   S + + P S   A  QQ   P NNVQSLLDSL +LQK
Sbjct: 722 QPVNMPPQNSFGGNVQPSNQPTNPVSPSAAANQQDQQPANNVQSLLDSLTQLQK 775

>Kwal_56.23945
          Length = 806

 Score =  445 bits (1145), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 221/351 (62%), Positives = 272/351 (77%), Gaps = 20/351 (5%)

Query: 190 NVDHHLLHKQANYIMESGMLNRPEFQNLDDKQKITAIVNLLNSNPITQLNITKPDAIENV 249
           NVD++L+ +QAN+I+ S ML  PEFQ L + +KI AI+  LNS+P               
Sbjct: 256 NVDYNLVQRQANFILSSNMLELPEFQRLSEHEKINAILTFLNSSPGAAFQ---------- 305

Query: 250 IPPPKTYNDSNEETQRPLSDAERRRLAPRPDLRNPMTPEERERYSVYLRGENKITEMHNI 309
               +++      +  P S    ++ A RPDL  PM   ER+RY+ YLRGEN+ITE+ NI
Sbjct: 306 ---ERSFTSG---SAAPQSQQIEQQHA-RPDLMQPMNAIERKRYNEYLRGENRITEIQNI 358

Query: 310 PAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSVKDAIELESD 369
           P KSRLFIGNLPLKNV+K+DLFRIFSPYGHI QINIKNAFGFIQY+NPQSV+ AI  ES+
Sbjct: 359 PPKSRLFIGNLPLKNVAKDDLFRIFSPYGHIYQINIKNAFGFIQYDNPQSVRAAIAGESN 418

Query: 370 EINFDKKLILEVSSSNSRPQFDHGDHGTNSSTTFISSAKRPFDNDEEDDTANMYNDIGVK 429
           E+NF KKLILE+SSSNSRPQ+DHGDHGTNSS+TFISS+KRPFD +EE+D   MY+D   K
Sbjct: 419 EMNFGKKLILEISSSNSRPQYDHGDHGTNSSSTFISSSKRPFDEEEEED---MYSDSSYK 475

Query: 430 RSKKRVPSCVIYVKRTADRNYANDVFKKFKDRTSLETDMIFLRPRMDLRKLVNDAAYDGV 489
           R K+RVP C IYVKRTADR+YAN+VF +F+  + LETDMIFL+PRM+LRK++NDAAYDGV
Sbjct: 476 RGKRRVPECQIYVKRTADRSYANEVFNRFRQGSGLETDMIFLKPRMELRKMINDAAYDGV 535

Query: 490 WGVIFINKTHNVDIQTFYEGPHGETKFDEYVGVSVDDAVAIFINLKTSRNN 540
           WGV+ +NKT NVDIQTFY+GP GETKFDEY  VS +DA+AIF NL++SRN+
Sbjct: 536 WGVVLVNKTRNVDIQTFYKGPQGETKFDEYASVSCEDAIAIFNNLRSSRND 586

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 60/137 (43%), Gaps = 28/137 (20%)

Query: 673 PNP-MDQQQLLSAIQNLPPNVVSSLLAAAXXXXXXXXXXXXXXXLIGLIXXXXXXXXXXX 731
           P P MDQQQL SAIQNLPPNVVSSLL+ A               L+G+I           
Sbjct: 675 PTPQMDQQQLFSAIQNLPPNVVSSLLSMA------QQQPQQQQQLLGIIQSMQPQSQPPN 728

Query: 732 XXXXXLNQASPPP-PMGNNYASQKISPPPSEQPAPTQQSPPG------------------ 772
                  Q +P   P   + A Q ++ PP +Q   T   P                    
Sbjct: 729 AHQQPPAQPAPSAYPGYQHMAPQPLNSPPMQQQHFTSNPPLAKNTPAQNPVPQQQSQPPS 788

Query: 773 --NNVQSLLDSLAKLQK 787
             NNVQSLLDSLA+LQ+
Sbjct: 789 GNNNVQSLLDSLAQLQQ 805

>KLLA0E19327g 1713099..1715318 some similarities with sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation
           singleton, hypothetical start
          Length = 739

 Score =  425 bits (1093), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 201/352 (57%), Positives = 261/352 (74%), Gaps = 15/352 (4%)

Query: 187 DTENVDHHLLHKQANYIMESGMLNRPEFQNLDDKQKITAIVNLLNSNPITQLNITKPDAI 246
           +++N+D  LL KQ   I E+ +L  P F+N  ++++I+A++ +LNS+P T +    P A 
Sbjct: 162 ESDNIDKALLEKQFKLIKEACILQNPSFKNASEQEQISALIAILNSDPQTAMPHAAPVAT 221

Query: 247 ENVIPPPKTYNDSNEETQRPLSDAERRRLAPRPDLRNPMTPEERERYSVYLRGENKITEM 306
                           T    S  +  R  PRP++  PM+ EE+ERYS YL GE KITE+
Sbjct: 222 STT-------------TAASESKGKNVRF-PRPNMSQPMSAEEKERYSEYLNGETKITEI 267

Query: 307 HNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSVKDAIEL 366
            + P KSRLFIGNLPLKNV+KEDLFRIFSPYGHI QINIKNAFGFIQY+N +SV DAIE 
Sbjct: 268 QSFPPKSRLFIGNLPLKNVTKEDLFRIFSPYGHIFQINIKNAFGFIQYDNQRSVLDAIEC 327

Query: 367 ESDEINFDKKLILEVSSSNSRPQFDHGDHGTNSSTTFISSAKRPFDNDEEDDTANMYNDI 426
           ES+E+NF KKLILEVSSSN+RPQFDHGDHG+N+S+T+++S+KR +DN+E DD  +MY+D 
Sbjct: 328 ESEEMNFGKKLILEVSSSNARPQFDHGDHGSNTSSTYVTSSKRNYDNEENDDE-DMYSDN 386

Query: 427 GVKRSKKRVPSCVIYVKRTADRNYANDVFKKFKDRTSLETDMIFLRPRMDLRKLVNDAAY 486
             K+SKKR P C+IYVK+ ADR YA  VF     +T LETDM+ L+PRM+LRKLVN+AAY
Sbjct: 387 HYKKSKKRTPQCLIYVKKAADRTYAYSVFTNLSKKTGLETDMVILKPRMELRKLVNEAAY 446

Query: 487 DGVWGVIFINKTHNVDIQTFYEGPHGETKFDEYVGVSVDDAVAIFINLKTSR 538
           DGVWGV+ +NK  N+D+QTFY GP GETK DEYV VS+D+A++IF N+K ++
Sbjct: 447 DGVWGVVLVNKNKNIDVQTFYLGPSGETKSDEYVAVSIDEAISIFNNIKATK 498

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 17/18 (94%)

Query: 676 MDQQQLLSAIQNLPPNVV 693
           +DQ QLL+A+QNLPPNVV
Sbjct: 587 LDQNQLLAALQNLPPNVV 604

>YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved in
           18S and 25S rRNA processing, export of RNA from the
           nucleus, import of proteins into the nucleus, associated
           with U1 snRNP, has 2 RNA recognition (RRM) domains [1245
           bp, 414 aa]
          Length = 414

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 313 SRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSVKDAIE 365
           +RLF+   PL +V + +L  IF P+G + ++ I N F F+++   +S   AIE
Sbjct: 125 TRLFVRPFPL-DVQESELNEIFGPFGPMKEVKILNGFAFVEFEEAESAAKAIE 176

>CAGL0H04763g 454589..455740 highly similar to sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3, hypothetical
           start
          Length = 383

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 313 SRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSVKDAIE 365
           +RLF+   PL +V + +L  IF P+G + ++ I N F F+++   +S   AIE
Sbjct: 105 TRLFVRPFPL-DVQESELNEIFGPFGAMKEVKILNGFAFVEFEEAESASKAIE 156

>Sklu_2182.3 YDR432W, Contig c2182 3920-5035
          Length = 371

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 36/62 (58%), Gaps = 5/62 (8%)

Query: 311 AKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSVKDAIELESDE 370
           + +RLF+   P  +V + +L  IFSP+G + ++ I N F F+++   +S   AI    DE
Sbjct: 73  STTRLFVRPFPF-DVQESELNEIFSPFGPMKEVKILNGFAFVEFEESESAAKAI----DE 127

Query: 371 IN 372
           +N
Sbjct: 128 VN 129

>KLLA0F18216g 1677731..1679857 some similarities with sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation
           singleton, hypothetical start
          Length = 708

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 41/80 (51%), Gaps = 8/80 (10%)

Query: 315 LFIGNLPLKNVSKEDLFRIFSPYGHILQINIKN------AFGFIQYNNPQSVKDAIELES 368
           +FIG L  K V+K  L   FS YG I   N+ +       F FI+Y  P S   A+E E+
Sbjct: 325 IFIGQLNFK-VTKPLLLERFSKYGEIDNCNLIHKQEQLKCFAFIKYKTPASAAKALEREN 383

Query: 369 DEINFDKKLILEVSS-SNSR 387
             I  +K L +++   SNSR
Sbjct: 384 HSIFVEKILHVQIREVSNSR 403

>Scas_717.41
          Length = 379

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 313 SRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSVKDAIE 365
           +RLF+   P  +V + +L  IF+P+G + ++ I N F F+++    S   AIE
Sbjct: 83  TRLFVRPFPF-DVQEAELNEIFTPFGPMKEVKILNGFAFVEFEEADSAAKAIE 134

>Scas_530.4
          Length = 684

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 11/105 (10%)

Query: 312 KSRLFIGNLPLKNVSKEDLFRI-FSPYGHILQINI----KNAFGFIQYNNPQSVKDAIEL 366
           K  +F+G LP +  + E++ +I FS +G IL +N+    KN F FIQY    +   A+E 
Sbjct: 356 KKSIFVGQLPEE--TTEEVLKIHFSKHGKILDLNLIHKPKNVFAFIQYETENAAAIALET 413

Query: 367 ESDEINFDKKLILEVSSSNSRPQFDHGDHGTNSSTTFISSAKRPF 411
           E+  I   K + ++           HG   +  S  F  + + P+
Sbjct: 414 ENHSIFISKTIHVQYKEIGGI----HGRRNSKRSQYFSDNTQNPY 454

>Scas_621.10
          Length = 415

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 9/59 (15%)

Query: 315 LFIGNLPLKNVSKEDLFRIFSPYGHILQINIKN--------AFGFIQYNNPQSVKDAIE 365
           LF+GNL   N  ++ +  +FS YG I+ + I           FG++QY N +  K A+E
Sbjct: 264 LFLGNLSF-NADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALE 321

>KLLA0B00979g 77439..78467 some similarities with sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3 nucleolar protein
           singleton, hypothetical start
          Length = 342

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 313 SRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSVKDAIELESDEIN 372
           +RLF+   P  +V+  ++  IF P+G + +I I N F F+++   +S   AI+  + ++ 
Sbjct: 52  TRLFVKPFP-PDVTDAEMKEIFEPFGALKEIKILNGFAFVEFEEAESASQAIQNVAGKMF 110

Query: 373 FDKKLILEVSSSNSRPQF 390
            D  L + V S   +P+F
Sbjct: 111 ADYPLEV-VFSKKLKPRF 127

>Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement
          Length = 421

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 40/76 (52%), Gaps = 11/76 (14%)

Query: 300 ENKITEMHNIPAK--SRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKN--------AF 349
           +++  +  ++P++    LF+GNL   N  +++LF IFS +G ++ + I           F
Sbjct: 259 DDRAKKFGDVPSQPSDTLFLGNLSF-NADRDNLFEIFSQHGEVISVRIPTHPETEQPKGF 317

Query: 350 GFIQYNNPQSVKDAIE 365
           G++QY +    K A E
Sbjct: 318 GYVQYGSIDDAKKAFE 333

>ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH]
           (1024792..1025754) [963 bp, 320 aa]
          Length = 320

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 313 SRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSVKDAIELESDEIN 372
           +RL +   P  +V + +L  IFSPYG + ++ + + F F+++  P+S + AI+  + ++ 
Sbjct: 37  TRLHVKPFP-PDVEEHELDEIFSPYGALKEVKLMSGFAFVEFEKPESAEQAIKDVNGKMF 95

Query: 373 FDKKLILEVS 382
            D  L +  S
Sbjct: 96  ADMPLTVSYS 105

>Kwal_47.18572
          Length = 363

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 311 AKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSVKDAIE 365
           + +RLF+   P  +V   +L  IF P+G + ++ I N F F+++    S   AIE
Sbjct: 80  STTRLFVRPFPF-DVQDSELNEIFGPFGPMKEVKILNGFAFVEFEEADSAARAIE 133

>CAGL0E03245g complement(299236..300513) similar to sp|P27476
           Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, start by
           similarity
          Length = 425

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 39/76 (51%), Gaps = 11/76 (14%)

Query: 300 ENKITEMHNIPAK--SRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKN--------AF 349
           E++     +IP++    LF+GNL   N  +++++ IF  +G I+ + I           F
Sbjct: 262 EDRQKRFGDIPSEPSDTLFLGNLSF-NADRDNIYEIFGKFGEIISVRIPTHPETEQPKGF 320

Query: 350 GFIQYNNPQSVKDAIE 365
           G++QY +    K A+E
Sbjct: 321 GYVQYTSIDDAKKALE 336

>Sklu_1790.3 YOL041C, Contig c1790 1701-3122
          Length = 473

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 9/69 (13%)

Query: 312 KSRLFIGNLPLKNVSKEDLFRIFSPYGHILQI--------NIKNAFGFIQYNNPQSVKDA 363
           K  +FIGNL  + + +E+L++ FSP G +  I        N+   F ++Q+ + QSV  A
Sbjct: 306 KRSVFIGNLDFEEL-EENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKA 364

Query: 364 IELESDEIN 372
           + L   +IN
Sbjct: 365 LLLNEKKIN 373

>AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH]
           complement(628898..630088) [1191 bp, 396 aa]
          Length = 396

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 12/64 (18%)

Query: 315 LFIGNLPLKNVSKEDLFRIFSPYGHILQINIKN--------AFGFIQYNN---PQSVKDA 363
           LF+GNL   N  ++ LF +FS +G+++ + I           FG++QY +    Q+  DA
Sbjct: 270 LFLGNLSF-NADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDA 328

Query: 364 IELE 367
           ++ E
Sbjct: 329 LQGE 332

>YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar
           protein involved in processing 20S to 18S rRNA, has 2
           RNA recognition (RRM) domains and is member of GAR
           (glycine/arginine-rich repeats) family of proteins [1245
           bp, 414 aa]
          Length = 414

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 9/77 (11%)

Query: 315 LFIGNLPLKNVSKEDLFRIFSPYGHILQINIKN--------AFGFIQYNNPQSVKDAIEL 366
           LF+GNL   N  ++ +F +F+ +G ++ + I           FG++Q++N +  K A++ 
Sbjct: 269 LFLGNLSF-NADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDA 327

Query: 367 ESDEINFDKKLILEVSS 383
              E   ++ + L+ SS
Sbjct: 328 LQGEYIDNRPVRLDFSS 344

>YNL286W (CUS2) [4325] chr14 (95221..96078) Suppressor of U2 snRNA
           mutations and homolog of human Tat-SF1 protein, contains
           two RNA recognition motif (RRM) domains [858 bp, 285 aa]
          Length = 285

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 24/110 (21%)

Query: 305 EMHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHI-----------LQINIKNAF---G 350
           E +N    + ++I  LP    +KE L   F  YG I           L +N K AF    
Sbjct: 37  EYNNASKNTSIYISGLPTDKTTKEGLTEQFCKYGMIRTNRDGEPLCKLYVNDKGAFKGDA 96

Query: 351 FIQYNNPQSVKDAIELESDEINFDKKLILEVSSSNSRPQFDH--GD--HG 396
            I Y+  +SV  AIE+ ++ I   K++ +E      R QF +  GD  HG
Sbjct: 97  LITYSKEESVTLAIEMMNESIFLGKQIRVE------RAQFQNKEGDNMHG 140

>CAGL0E03630g complement(335091..337331) weakly similar to sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation,
           hypothetical start
          Length = 746

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 8/99 (8%)

Query: 312 KSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI----KNAFGFIQYNNPQSVKDAIELE 367
           K  +F+G L L + +KE L + FS +G I  I++       F FI+Y   Q+   A++ E
Sbjct: 375 KKSIFVGQLDL-STTKEILVKRFSTHGKIRNIDVVSKPTTVFAFIEYETEQAAAAALDKE 433

Query: 368 SDEINFDKKLIL---EVSSSNSRPQFDHGDHGTNSSTTF 403
           +  I   K + +   E+   + R  F    +    S TF
Sbjct: 434 NHSILLSKTMHVQYKEIGGPHGRRLFKRNSYFKEVSKTF 472

>ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH]
           (768392..770908) [2517 bp, 838 aa]
          Length = 838

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 44/81 (54%), Gaps = 10/81 (12%)

Query: 306 MHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI--------KNAFGFIQYNNP 357
           +  I A  RLF+ N+ L + ++ED  ++FSPYG + ++++           F ++ + +P
Sbjct: 294 LTKIRATGRLFLRNI-LYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDP 352

Query: 358 QSVKDAIELESDEINFDKKLI 378
           +   +A  +E D+  F  +L+
Sbjct: 353 EHAANAY-IELDKQIFQGRLL 372

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 14/77 (18%), Positives = 38/77 (49%), Gaps = 8/77 (10%)

Query: 317 IGNLPLKNVSKEDLFRIFSPYGHILQINI-------KNAFGFIQYNNPQSVKDAIELESD 369
           + NLP +  +++D+F +FS +G +  + +          F F+++  P   ++A++    
Sbjct: 716 VKNLPFE-ATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQG 774

Query: 370 EINFDKKLILEVSSSNS 386
                ++L+++ +   S
Sbjct: 775 VHLLGRRLVMQYAEQES 791

>KLLA0F07799g complement(734889..736463) similar to sp|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, start by
           similarity
          Length = 524

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 9/70 (12%)

Query: 315 LFIGNLPLKNVSKEDLFRIFSPYGHILQI--------NIKNAFGFIQYNNPQSVKDAIEL 366
           +F+GNL  + V +E L++ F P G I  +        N+   F ++Q+ + QSV  A+ L
Sbjct: 361 VFVGNLDFEEV-EESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLL 419

Query: 367 ESDEINFDKK 376
              +I+  KK
Sbjct: 420 HEKKIHEGKK 429

>CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces
           cerevisiae YPL178w SAE1, start by similarity
          Length = 236

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 48/112 (42%), Gaps = 10/112 (8%)

Query: 298 RGENKITEMHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIK--------NAF 349
           R  N + ++      S +++GNL     S+E ++ +FS  G I +I +           F
Sbjct: 31  RNPNGLNDLRQSLKSSTIYVGNLSFY-TSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGF 89

Query: 350 GFIQYNNPQSVKDAIELESDEINFDKKLILEVS-SSNSRPQFDHGDHGTNSS 400
            FI YN PQ   +A++   D    DK + +++        QF  G  G   S
Sbjct: 90  CFIIYNTPQEALNAVKYLGDTKLDDKSITIDLDPGFEDGRQFGRGKSGGQVS 141

>CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor,
           hypothetical start
          Length = 381

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 59/129 (45%), Gaps = 13/129 (10%)

Query: 309 IPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHI--LQI---------NIKNAFGFIQYNNP 357
           +  +  + I NLP   + K+ L  IF  YG I  L+I         ++ +   F+ Y NP
Sbjct: 189 VLERREIIIRNLPKTMLVKDTLLDIFKKYGAIDDLRIPKKQLEMLSDLNHGCAFVVYTNP 248

Query: 358 QSVKDAIELESDEINFDKKLILEVSSSNSRPQFDHGDHGTNSSTTFISSAKRPF-DNDEE 416
           +  K A+E+ +  I+ D K+ + +S S++  +    +   NS  T   +A  P  D   +
Sbjct: 249 EDAKSALEMNNHVID-DIKISVNLSDSHAYLERKEVNRIINSKHTEKYAAIYPISDKTSK 307

Query: 417 DDTANMYND 425
           +   N  ND
Sbjct: 308 EQIRNFIND 316

>Scas_635.7
          Length = 581

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 9/63 (14%)

Query: 313 SRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI--------KNAFGFIQYNNPQSVKDAI 364
            ++FIG L  +  +++ L   FS YG+++++ I           FGF+ + NP SV + +
Sbjct: 196 CKMFIGGLNWE-TTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVV 254

Query: 365 ELE 367
           + +
Sbjct: 255 KTQ 257

>AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C
           (GBP2) - SH] complement(309542..310555) [1014 bp, 337
           aa]
          Length = 337

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 7/56 (12%)

Query: 315 LFIGNLPLKNVSKEDLFRIFSPYGHILQINI------KNAFGFIQYNNPQSVKDAI 364
           +FIGNL   + + EDL ++F   GH+++ +I          G ++Y N Q V +AI
Sbjct: 9   VFIGNLTY-DTTPEDLRQLFGEVGHVVRADIITSRGHHRGMGTVEYTNAQDVDEAI 63

>YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein
           important for the synthesis of 25S pre-rRNA [1380 bp,
           459 aa]
          Length = 459

 Score = 36.6 bits (83), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 9/63 (14%)

Query: 312 KSRLFIGNLPLKNVSKEDLFRIFSPYGHILQI--------NIKNAFGFIQYNNPQSVKDA 363
           K  +F+GNL  + + +E L++ F P G I  +        N+   F ++Q+ + QSV  A
Sbjct: 278 KRSIFVGNLDFEEI-EESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKA 336

Query: 364 IEL 366
           + L
Sbjct: 337 LLL 339

>Sklu_2060.3 YIR009W, Contig c2060 4599-4931
          Length = 110

 Score = 34.3 bits (77), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 60/111 (54%), Gaps = 11/111 (9%)

Query: 285 MTPEERERYSVYLRGENKITEMHNIPAKSRLFIGNLPLK---NVSKEDLFRIFSPYGHIL 341
           MT EE  R  + L+GE+   +    P K+ L++ NL  +   N  +E+L+ +FS YG ++
Sbjct: 1   MTTEEPLRKKIKLQGESHEGQPETSP-KNTLYVNNLNDQIRPNTLRENLYLLFSTYGEVI 59

Query: 342 QINIKN-----AFGFIQYNNPQSVKDAIELESDEINFDKKLILEVSSSNSR 387
           Q+++ +     AF  ++  N  ++   I L+ DE  F K L +  S ++S+
Sbjct: 60  QVSMTSKERGQAFVLLRTMNEANLA-MISLQ-DEPFFGKPLRIRFSRTDSQ 108

>Scas_88.1
          Length = 256

 Score = 35.8 bits (81), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 16/90 (17%)

Query: 314 RLFIGNLPLKNVSKEDLFRIFSPYGHILQINI--------KNAFGFIQYNNPQSVKDAIE 365
           RLF+  +  K +   D  ++FSPYG + ++++           F +I + NP++  DA  
Sbjct: 2   RLFVHFIHCKGI---DFXQLFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAY- 57

Query: 366 LESDEINFDKKLI----LEVSSSNSRPQFD 391
           +E D+  F  +L+     E   S+   +FD
Sbjct: 58  IELDKQIFQGRLLHILPAEAKKSHRLDEFD 87

>CAGL0M03795g complement(428607..430148) highly similar to sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 513

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 9/63 (14%)

Query: 313 SRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI--------KNAFGFIQYNNPQSVKDAI 364
            ++FIG L  +  +++ L   FS YG+++++ I           FGF+ ++ P SV + +
Sbjct: 130 CKMFIGGLNWE-TTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFDAPSSVDEVV 188

Query: 365 ELE 367
           + +
Sbjct: 189 KTQ 191

>Scas_241.1
          Length = 186

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 310 PAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI--KNAFGFIQYNNPQSVKDAIE 365
           P  + +FIG L    VS++DL + F P+G I+ + I      GF+QY +  S + AI 
Sbjct: 23  PNNTTVFIGGLS-SLVSEDDLRQYFQPFGDIIYVKIPTGKGCGFVQYVDRLSAELAIS 79

>YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA
           polymerase epsilon mutation, contains four RNA
           recognition motif (RRM) domains [1836 bp, 611 aa]
          Length = 611

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 315 LFIGNLPLKN--VSKEDLFRIFSPYGHILQINI--KNAFGFIQYNNPQSVKDAIELESDE 370
           +F  NLPL N  ++    +  FS YG IL   +  +   GF+ + + ++ ++ I++ ++ 
Sbjct: 181 VFFSNLPLNNPLLTTRVFYDTFSRYGKILSCKLDSRKDIGFVYFEDEKTARNVIKMYNNT 240

Query: 371 INFDKKLILEV 381
             F KK++  +
Sbjct: 241 SFFGKKILCGI 251

>CAGL0F01023g complement(108155..109345) similar to tr|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, hypothetical
           start
          Length = 396

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 54/134 (40%), Gaps = 17/134 (12%)

Query: 315 LFIGNLPLKNVSKEDLFRIFSPYGHILQI--------NIKNAFGFIQYNNPQSVKDAIEL 366
           +F+GNL  +   +E L++ F   G I  +        N+   F ++Q+N  QSV  A+ L
Sbjct: 230 VFVGNLDFEE-DEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKALLL 288

Query: 367 E-----SDEINFDKKLILEVSSSNSR---PQFDHGDHGTNSSTTFISSAKRPFDNDEEDD 418
                 S   +  K+ +      N R   P    G + T+   T +  AK+  +  E   
Sbjct: 289 NEKPMISQNEHLKKRKLRVTRCKNIRKVEPTLKSGKYMTDGQKTKLGRAKKILNKAERSK 348

Query: 419 TANMYNDIGVKRSK 432
                   G++ +K
Sbjct: 349 LLKELTVEGIRATK 362

>CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces
           cerevisiae YBR212w Negative growth regulatory protein,
           hypothetical start
          Length = 802

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 5/59 (8%)

Query: 310 PAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI---KNAFGFIQYNNPQSVKDAIE 365
           P  + +F+G L    V ++ L +IF P+G+IL I I   KN  GF+++ +    + AI+
Sbjct: 464 PTNTTVFVGGLG-PTVQEQQLRKIFQPFGNILSIKIPPGKNC-GFVKFEHKIDAEAAIQ 520

>YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similarity
           to Pes4p and Pab1p in the N-terminal region, contains
           four RNA recognition (RRM) domains [1980 bp, 659 aa]
          Length = 659

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 54/110 (49%), Gaps = 12/110 (10%)

Query: 293 YSVYLRGENKIT-EMHNIPAK----SRLFIGNLPLKN--VSKEDLFRIFSPYGHILQINI 345
           Y+V+   E KI   M N   +    + +F  NLPL+N  ++    + I   YG++L   +
Sbjct: 174 YTVFFGQEVKIMPSMKNTLFRKNIGTNVFFSNLPLENPQLTTRSFYLIMIEYGNVLSCLL 233

Query: 346 --KNAFGFIQYNNPQSVKDAIELESDEINFDKKLILEV---SSSNSRPQF 390
             +   GF+ ++N  S ++ I+  +++  F  K+I  +       +RP+F
Sbjct: 234 ERRKNIGFVYFDNDISARNVIKKYNNQEFFGNKIICGLHFDKEVRTRPEF 283

>AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH]
           complement(617434..618879) [1446 bp, 481 aa]
          Length = 481

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 311 AKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI--KNAFGFIQYNNPQSVKDAIE 365
           A + +FIG L    +S+  L  +F P+G+IL + +      GF+++ N    + AI+
Sbjct: 324 ANTTVFIGGLS-NMISEGQLHALFMPFGNILSVKVPPGRGCGFVRFENRMDAEAAIQ 379

>Scas_576.7
          Length = 575

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 26/93 (27%)

Query: 299 GENKITEMHNIPAKSRLF---------------IGNLPLKN----VSKEDLFRIFSPYGH 339
           G+  I +++  P K RL                 GN+ +KN    +  + LF  FS +G+
Sbjct: 89  GKKAIEQLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGN 148

Query: 340 ILQINI-------KNAFGFIQYNNPQSVKDAIE 365
           IL   I          FGF+ + +  S K+AI+
Sbjct: 149 ILSSKIATDETGKSKGFGFVHFEHESSAKEAID 181

>AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH]
           (978634..980391) [1758 bp, 585 aa]
          Length = 585

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 11/59 (18%)

Query: 318 GNLPLKN----VSKEDLFRIFSPYGHILQI-------NIKNAFGFIQYNNPQSVKDAIE 365
           GN+ +KN    +  + L   FS +G+IL          +   FGF+ + N    +DAIE
Sbjct: 126 GNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIE 184

>KLLA0B11594g complement(1018044..1018388) some similarities with
           sp|P40567 Saccharomyces cerevisiae YIR009w MSL1 U2
           snRNA-associated protein with singleton, hypothetical
           start
          Length = 114

 Score = 32.0 bits (71), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 327 KEDLFRIFSPYGHILQINI---KNAFGFIQYNNPQSVKDAIELESDEINFDKKLILEVSS 383
           +E L+ +F+ YG ++++++   +    FI + +      A+    DE+ F+K L+L+ S 
Sbjct: 49  RESLYMLFATYGEVIKVSMTPKQRGQAFITFKSVDEANLALLSLKDELFFNKPLVLQFSK 108

Query: 384 SNS 386
             +
Sbjct: 109 QTT 111

>KLLA0D14949g complement(1259860..1262496) similar to sgd|S0006316
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 878

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 306 MHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI--------KNAFGFIQYNNP 357
           +  I    RLF+ N+ L   +++D  ++FSPYG + +++I           F ++ + N 
Sbjct: 323 LKKIRETGRLFLRNI-LYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYVLFKNA 381

Query: 358 QSVKDAIELESDEINFDKKLI 378
            +   A  +E D+  F  +L+
Sbjct: 382 DNAATAF-VELDKQIFQGRLL 401

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/76 (18%), Positives = 40/76 (52%), Gaps = 8/76 (10%)

Query: 312 KSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI-------KNAFGFIQYNNPQSVKDAI 364
           + ++ + NLP +  +++D+F +FS +G +  + +          F F+++  P+  ++A+
Sbjct: 751 QGKIIVKNLPFE-ATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAM 809

Query: 365 ELESDEINFDKKLILE 380
           +         ++L++E
Sbjct: 810 DQLQGVHLLGRRLVME 825

>Kwal_14.1851
          Length = 535

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 310 PAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI--KNAFGFIQY 354
           P  + +FIG L    +S+  L  +FSP+G I+ + I      GF++Y
Sbjct: 393 PNNTTVFIGGL-TSQISERQLHSLFSPFGAIINVKIPPGKGCGFVKY 438

>KLLA0A05346g 485886..488510 some similarities with sp|P53316
           Saccharomyces cerevisiae YGR250c singleton, hypothetical
           start
          Length = 874

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 9/56 (16%)

Query: 307 HNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI--------KNAFGFIQY 354
           H +     L++  +P KN++KEDL  IF+ +G IL + I           FGF+ Y
Sbjct: 185 HALNHPGNLYVRGIP-KNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFVSY 239

>YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding protein
           of cytoplasm and nucleus, part of the 3'-end
           RNA-processing complex (cleavage factor I), involved in
           translation termination with Sup35p, has 4 RNA
           recognition (RRM) domains [1734 bp, 577 aa]
          Length = 577

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 55/124 (44%), Gaps = 19/124 (15%)

Query: 313 SRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKN--------AFGFIQYNNPQSVKDAI 364
           + L++G+L   +VS+  L+ IFSP G +  I +           + ++ +N+ ++ + AI
Sbjct: 38  ASLYVGDLE-PSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAI 96

Query: 365 ELESDEINFD--KKLILEVSSSNSRPQFDHGDHGTNSSTTFISSAKRPFDNDEEDDTANM 422
           E    ++N+   K  +  +  S   P          S   FI +     DN    DT ++
Sbjct: 97  E----QLNYTPIKGRLCRIMWSQRDPSL----RKKGSGNIFIKNLHPDIDNKALYDTFSV 148

Query: 423 YNDI 426
           + DI
Sbjct: 149 FGDI 152

>CAGL0L11792g 1259275..1261014 highly similar to sp|P04147
           Saccharomyces cerevisiae YER165w PAB1 mRNA
           polyadenylate-binding protein, start by similarity
          Length = 579

 Score = 33.5 bits (75), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 64/151 (42%), Gaps = 19/151 (12%)

Query: 286 TPEERERYSVYLRGENKITEMHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI 345
           T E+ E  S+  + E    E  +    + L++G+L   +VS+  L+ IFSP G +  I +
Sbjct: 8   TAEQLENLSLQDKQEGTNEENQSETVSASLYVGDLD-PSVSEAHLYDIFSPIGAVSSIRV 66

Query: 346 KN--------AFGFIQYNNPQSVKDAIELESDEINFD--KKLILEVSSSNSRPQFDHGDH 395
                      + ++ +N+  + K AIE    ++NF   K  +  +  S   P       
Sbjct: 67  CRDAITKTSLGYAYVNFNDHDAAKTAIE----KLNFTPIKGKLCRIMWSQRDPSLRKKGA 122

Query: 396 GTNSSTTFISSAKRPFDNDEEDDTANMYNDI 426
           G      FI +     DN    DT +++ +I
Sbjct: 123 G----NIFIKNLHPDIDNKALYDTFSVFGNI 149

>KLLA0A08338g 736461..738761 weakly similar to sp|P39684
           Saccharomyces cerevisiae YFR023w PES4 DNA-directed DNA
           polymerase epsilon suppressor, start by similarity
          Length = 766

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 315 LFIGNLPLKN--VSKEDLFRIFSPYGHILQINI--KNAFGFIQYNNPQSVKDAIELESDE 370
           +F  NLPL N  ++    +  F  +G IL   +  +   GFI + N  + K+AI+  + +
Sbjct: 228 VFFSNLPLDNTKLTTRVFYDEFKKFGKILSCKLDRRKNIGFIYFENDAAAKEAIKQYNGK 287

Query: 371 INFDKKLILEV 381
             FD  ++  V
Sbjct: 288 EFFDSTIMCGV 298

>YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for
           sporulation and formation of meiotic spindle, has two
           RNA recognition motif (RRM) domains [2142 bp, 713 aa]
          Length = 713

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 312 KSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI----KNAFGFIQY 354
           K  +F+G L  K  ++E+L R FS +G I  IN+     N F FI+Y
Sbjct: 345 KRSIFVGQLD-KETTREELNRRFSTHGKIQDINLIFKPTNIFAFIKY 390

>CAGL0B04169g complement(404713..407298) highly similar to tr|Q06106
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 861

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 39/71 (54%), Gaps = 10/71 (14%)

Query: 306 MHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI--------KNAFGFIQYNNP 357
           +  I    RLF+ N+ L + +++D  ++FSPYG + ++++           F ++ +  P
Sbjct: 318 IAKIQKTGRLFLRNI-LYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKP 376

Query: 358 -QSVKDAIELE 367
            ++V+  IEL+
Sbjct: 377 EEAVQAYIELD 387

>YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein
           involved in mRNA export, binds poly(A)+ RNA and
           single-stranded G-strand telomere sequence, has three
           RNA recognition (RRM) domains [1284 bp, 427 aa]
          Length = 427

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 44/96 (45%), Gaps = 18/96 (18%)

Query: 315 LFIGNLPLKNVSKEDLFRIFSPYGHILQINI------KNAFGFIQYNNPQSVKDAIELES 368
           +F+ NL   + + EDL  +F   G +++ +I          G +++   +SV+DAI    
Sbjct: 124 IFVRNLTF-DCTPEDLKELFGTVGEVVEADIITSKGHHRGMGTVEFTKNESVQDAISKFD 182

Query: 369 DEINFDKKLIL-----------EVSSSNSRPQFDHG 393
             +  D+KL++           E S   +R + D+G
Sbjct: 183 GALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNG 218

>Kwal_55.21039
          Length = 119

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 327 KEDLFRIFSPYGHILQINIKNAF---GFIQYNNPQSVKDAIELESDEINFDKKLILEVSS 383
           +E+LF +FS YG +LQI++        FI          A+   ++E  F K L ++ S 
Sbjct: 52  RENLFLLFSTYGEVLQIDMSKRIRGQAFIVLKTVDEANIALISLNNEPFFGKDLHIQFSK 111

Query: 384 SNSR 387
            +SR
Sbjct: 112 KDSR 115

>KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces
           cerevisiae YER165w PAB1 mRNA polyadenylate-binding
           protein, start by similarity
          Length = 592

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 11/67 (16%)

Query: 310 PAKSRLFIGNLPLKN----VSKEDLFRIFSPYGHILQINI-------KNAFGFIQYNNPQ 358
           PA  +   GN+ +KN    +  + L   FS +G +L   +          FGF+ +    
Sbjct: 130 PAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGNSRGFGFVHFKEES 189

Query: 359 SVKDAIE 365
             KDAIE
Sbjct: 190 DAKDAIE 196

>AEL217W [2289] [Homologous to ScYGR250C - SH]
           complement(225217..227721) [2505 bp, 834 aa]
          Length = 834

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 9/56 (16%)

Query: 307 HNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI--------KNAFGFIQY 354
           H +     L+I  +P K++S +DL  IFS +G +L + I           +GFI Y
Sbjct: 211 HALTHPGNLYIRGIP-KDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISY 265

>Sklu_905.1 YMR268C, Contig c905 196-1743
          Length = 515

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 43/92 (46%), Gaps = 15/92 (16%)

Query: 312 KSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINIKNA------------FGFIQYNNPQS 359
           K  +FI  L    VS   L ++   YG + ++++ N+            F F+ Y N +S
Sbjct: 275 KREIFIRKLDFYKVSLSKLTKLVEKYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTNEES 334

Query: 360 VKDAIELESDEINFDKKLILEVSSSNSRPQFD 391
            + A+EL    ++  +  +L VS ++ +P  +
Sbjct: 335 AQKALEL---NMSVFEGRVLAVSIADRKPYLE 363

>CAGL0L09449g complement(1021490..1021846) no similarity,
           hypothetical start
          Length = 118

 Score = 29.6 bits (65), Expect = 3.4,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 7/83 (8%)

Query: 312 KSRLFIGNLPLKNVSKE---DLFRIFSPYGHILQINIK----NAFGFIQYNNPQSVKDAI 364
           K+ L+I NL  K  +K     LF +FS YG +L++ I      A  FI   + +    A 
Sbjct: 33  KNTLYIRNLNEKINTKRLRHGLFMLFSIYGEVLKVTINFKALRAQAFITLRSVEEASLAK 92

Query: 365 ELESDEINFDKKLILEVSSSNSR 387
                E+ F+  L +E S +N++
Sbjct: 93  AALEGEVFFNIPLSIEFSKANTK 115

>YDR150W (NUM1) [994] chr4 (755622..763868) Nuclear migration
           protein, controls interaction of bud-neck cytoskeleton
           with G2 nucleus [8247 bp, 2748 aa]
          Length = 2748

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 61/145 (42%), Gaps = 28/145 (19%)

Query: 172 KNTSETVNTEDTPADDTENVDHHLLHKQANYIMESG--MLNRPEFQNLDD---------- 219
           K  +E +N    P DD  +     L     Y+  SG  +L   EF+NL++          
Sbjct: 379 KEVAENLNMIALPNDDNYSKKEFSLESHIKYLEASGYKVLPLEEFENLNESLSNPSYNYL 438

Query: 220 KQKITAIVNLLNSNPITQ--LNITKPDAIENVIP----------PPKTYNDSNEETQRPL 267
           K+K+ A+  +    PI Q   N+ K   I+ ++P          P K YND  E  + P 
Sbjct: 439 KEKLQALKKI----PIDQSTFNLLKEPTIDFLLPLTSKIDCLIIPTKDYNDLFESVKNPS 494

Query: 268 SDAERRRLAPRPDLRNPMTPEERER 292
            +  ++ L  + DL++ +     ER
Sbjct: 495 IEQMKKCLEAKNDLQSNICKWLEER 519

>Scas_570.14
          Length = 113

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 7/85 (8%)

Query: 309 IPAKSRLFIGNLPLKNVSKE---DLFRIFSPYGHILQINI----KNAFGFIQYNNPQSVK 361
           I  K+ L++ NL  K  +K    +LF +FS YG +L++ I    +    FI         
Sbjct: 26  IDPKNTLYVNNLDEKINTKRLRTNLFLLFSIYGEVLKVAISAKKQRGQAFITMRTVDEAN 85

Query: 362 DAIELESDEINFDKKLILEVSSSNS 386
            A+   ++E  FDK L ++ S +NS
Sbjct: 86  LALISLNNEPFFDKPLHIQFSKTNS 110

>Scas_316.1
          Length = 483

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 287 PEERERYSVYLRGENK-ITEMHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI 345
           PE++ R     R EN+ + E   +  K +L I N+P        L +IFS +G +++ +I
Sbjct: 55  PEKKTRTDTIARDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASI 114

>Kwal_23.5204
          Length = 294

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 4/35 (11%)

Query: 306 MHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHI 340
           +HN      +++ NLPL + +K+ + + FS YG I
Sbjct: 44  LHNCA----IYVSNLPLGSTTKDAVVKEFSKYGII 74

>AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH]
           (639306..641444) [2139 bp, 712 aa]
          Length = 712

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 312 KSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI------KNAFGFIQYNNPQSVKDAIE 365
           K  +F+  L   +V+KE L + FS +G +  +N+         F FI+Y   ++   A+E
Sbjct: 379 KKSIFVSQLD-PSVTKEKLTQRFSKHGKVEDVNLIFKDNNTKVFAFIKYETEEATATALE 437

Query: 366 LE 367
            E
Sbjct: 438 RE 439

>KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces
           cerevisiae YPL043w NOP4 nucleolar protein, start by
           similarity
          Length = 685

 Score = 30.0 bits (66), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 28/68 (41%), Gaps = 7/68 (10%)

Query: 309 IPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI-------KNAFGFIQYNNPQSVK 361
           +  K +L I N+P        L +IF  YG +++  I          F F+  N   + K
Sbjct: 129 MKGKPKLIIRNMPWSCRDPTKLKKIFGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCK 188

Query: 362 DAIELESD 369
            AIE   D
Sbjct: 189 AAIEGTKD 196

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.129    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,170,850
Number of extensions: 893282
Number of successful extensions: 3640
Number of sequences better than 10.0: 95
Number of HSP's gapped: 3689
Number of HSP's successfully gapped: 108
Length of query: 787
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 677
Effective length of database: 12,788,129
Effective search space: 8657563333
Effective search space used: 8657563333
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)