Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_611.4*29929913040.0
Kwal_56.239543772725472e-67
YGL082W3812655314e-65
AFL071C3512665078e-62
CAGL0G09251g3632594964e-60
YPL191C3602704852e-58
Scas_720.144032704855e-58
KLLA0E19371g3482604738e-57
CAGL0H03289g3852643825e-43
KLLA0F03212g30592740.23
CAGL0K05841g137254672.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_611.4*
         (299 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_611.4*                                                           506   0.0  
Kwal_56.23954                                                         215   2e-67
YGL082W (YGL082W) [1900] chr7 (355828..356973) Member of the DUF...   209   4e-65
AFL071C [3122] [Homologous to ScYGL082W - SH; ScYPL191C - SH] (3...   199   8e-62
CAGL0G09251g complement(882028..883119) similar to sp|Q08930 Sac...   195   4e-60
YPL191C (YPL191C) [5256] chr16 complement(183596..184678) Member...   191   2e-58
Scas_720.14                                                           191   5e-58
KLLA0E19371g 1718449..1719495 similar to sp|P53155 Saccharomyces...   186   8e-57
CAGL0H03289g 309091..310248 similar to sp|P53155 Saccharomyces c...   151   5e-43
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    33   0.23 
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    30   2.4  

>Scas_611.4*
          Length = 299

 Score =  506 bits (1304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/299 (85%), Positives = 256/299 (85%)

Query: 1   MTESLQFTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKT 60
           MTESLQFTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKT
Sbjct: 1   MTESLQFTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKT 60

Query: 61  STVSLDEVNQVLANIALQSNTEMKGSNGADMDQXXXXXXXXXXXXNINPKFDGTFEDSNE 120
           STVSLDEVNQVLANIALQSNTEMKGSNGADMDQ            NINPKFDGTFEDSNE
Sbjct: 61  STVSLDEVNQVLANIALQSNTEMKGSNGADMDQLLELLPHLHTGLNINPKFDGTFEDSNE 120

Query: 121 MALFRMFKIPIVHGWVIETLSKYSYESAQQVLLKXXXXXXXXXXXXTLIQLFFDETGTQL 180
           MALFRMFKIPIVHGWVIETLSKYSYESAQQVLLK            TLIQLFFDETGTQL
Sbjct: 121 MALFRMFKIPIVHGWVIETLSKYSYESAQQVLLKAAEGDEEAVGEATLIQLFFDETGTQL 180

Query: 181 TQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGYRRRKDIVWENIKSID 240
           TQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGYRRRKDIVWENIKSID
Sbjct: 181 TQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGYRRRKDIVWENIKSID 240

Query: 241 GSEDTFCDGNLDTIDLKMGGXXXXXXXXXXXXXXXXXXXPELTSKSLKEEMCKLKTIKK 299
           GSEDTFCDGNLDTIDLKMGG                   PELTSKSLKEEMCKLKTIKK
Sbjct: 241 GSEDTFCDGNLDTIDLKMGGEEKDFKIKKNDNNKNNEFDPELTSKSLKEEMCKLKTIKK 299

>Kwal_56.23954
          Length = 377

 Score =  215 bits (547), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 161/272 (59%), Gaps = 29/272 (10%)

Query: 4   SLQFTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKTSTV 63
           SL F +K ++I G   +ILLQNENGPCAL+A+ N+LL+SPQ  R    LT+L+  K S V
Sbjct: 2   SLMFVVKGVDINGCSHRILLQNENGPCALIALCNVLLLSPQCARYAGPLTQLVANK-SEV 60

Query: 64  SLDEVNQVLANIALQSNTEMKGSNGADMDQXXXXXXXXXXXXNINPKFDGTFEDSNEMAL 123
           +L E+  +LANI +Q    +      D+D+            +INP F+G+FED +EMAL
Sbjct: 61  ALRELITILANIGVQ----IPQGAQMDVDRLLQSLPQLHTGLSINPIFNGSFEDGDEMAL 116

Query: 124 FRMFKIPIVHGWVI---------ETLSKYSYESAQQVLLKXXXXXXXXXXXXT------- 167
           FR+F + IVHGW+          E +SKYSYE AQ+VL++            +       
Sbjct: 117 FRLFNVSIVHGWIADYADDPAQYEHVSKYSYEEAQKVLIEAYDIQHGSGSPASPNPGHSA 176

Query: 168 --------LIQLFFDETGTQLTQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSL 219
                    I+ F   + TQLT+ GL  L  +L E  F VLFRNDHFSTI K  N+LY+L
Sbjct: 177 EQVLEDAGYIKSFLARSATQLTEYGLHQLRELLIENSFAVLFRNDHFSTIVKHKNELYAL 236

Query: 220 VTDLGYRRRKDIVWENIKSIDGSEDTFCDGNL 251
           VTDLGY+  ++IVWE++KS++GS+DTF  G  
Sbjct: 237 VTDLGYKDDENIVWESLKSVNGSQDTFYTGRF 268

>YGL082W (YGL082W) [1900] chr7 (355828..356973) Member of the DUF544
           protein of unknown function family, has moderate
           similarity to uncharacterized S. cerevisiae Ypl191p
           [1146 bp, 381 aa]
          Length = 381

 Score =  209 bits (531), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 160/265 (60%), Gaps = 27/265 (10%)

Query: 7   FTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKTSTVSLD 66
           F  KN++I GT FKILLQN  G CAL+A+ N+LLISP H R    ++ L+  K  TV+L+
Sbjct: 5   FLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGK-ETVTLN 63

Query: 67  EVNQVLANIALQSNTEMKGSNGADMDQXXXXXXXXXXXX--NINPKFDGTFEDSNEMALF 124
           E+ Q LA++ +Q+       NG D+D+              NINP+F+G+FED  EM++F
Sbjct: 64  ELVQTLADMGVQN------PNGTDVDKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIF 117

Query: 125 RMFKIPIVHGWVI---------ETLSKYSYESAQQVLLKXXXXXXXXXXXXTLIQL---- 171
           R++ + IVHGW+I         E +SKYSY  AQ+VL++               Q+    
Sbjct: 118 RLYNVGIVHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNNAQFENSEQIQSDA 177

Query: 172 -----FFDETGTQLTQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGYR 226
                F   + TQLT+ GL +L  IL E+ + VLFRNDHF T+YK N +L++LVTD  YR
Sbjct: 178 PYLKSFLARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPTYR 237

Query: 227 RRKDIVWENIKSIDGSEDTFCDGNL 251
            RKDI W+++KS++GS+D++  GN 
Sbjct: 238 NRKDINWQSLKSVNGSQDSYYTGNF 262

>AFL071C [3122] [Homologous to ScYGL082W - SH; ScYPL191C - SH]
           (301720..302775) [1056 bp, 351 aa]
          Length = 351

 Score =  199 bits (507), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 108/266 (40%), Positives = 153/266 (57%), Gaps = 24/266 (9%)

Query: 4   SLQFTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKTSTV 63
           SL F  K I + G P +ILLQNENGPCAL+A+ N+LL+SP +      L  L   +  TV
Sbjct: 2   SLTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTSQLRNL--AQAPTV 59

Query: 64  SLDEVNQVLANIALQSNTEMKGSNGADMDQXXXXXXXXXXXXNINPKFDGTFEDSNEMAL 123
           +L ++  VLA+IA+Q    + G +  DMD+             I+P F+GTF + +EMAL
Sbjct: 60  TLRDLVAVLADIAMQ----LGGDSHRDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMAL 115

Query: 124 FRMFKIPIVHGWVIET---------LSKYSYESAQQVLLKXXXXXXXXXXXXTLIQL--- 171
           FRMF++ +VH W+++          LS+ SYE AQ++L++               QL   
Sbjct: 116 FRMFQVGLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGSVASEKADQLLQD 175

Query: 172 ------FFDETGTQLTQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGY 225
                 F   + TQ+T  GL +L  +L E  + VLFRNDHF+TI K+  +L+ LVTDLGY
Sbjct: 176 AHILRSFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGY 235

Query: 226 RRRKDIVWENIKSIDGSEDTFCDGNL 251
           + R DIVW+++   DGSEDTF  G+ 
Sbjct: 236 QYRHDIVWQSLSYPDGSEDTFYTGDF 261

>CAGL0G09251g complement(882028..883119) similar to sp|Q08930
           Saccharomyces cerevisiae YPL191c, hypothetical start
          Length = 363

 Score =  195 bits (496), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 106/259 (40%), Positives = 152/259 (58%), Gaps = 23/259 (8%)

Query: 5   LQFTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKTSTVS 64
           + F  K I + G    IL+QNENGPCAL+A+ N+LL+S  H+     L EL++ K   V 
Sbjct: 1   MNFATKRIRVDGNDRSILMQNENGPCALVALTNVLLLSSHHEH--SELLELVQPKK--VD 56

Query: 65  LDEVNQVLANIALQSNTEMKGSNGADMDQXXXXXXXXXXXXNINPKFDGTFEDSNEMALF 124
           LD++  VLA+IA+ +N +       ++              NINP+FDGTFED+ E+++F
Sbjct: 57  LDQLLTVLADIAIATNPK-----DEELSVLLSLLPQLHTGLNINPRFDGTFEDTKELSVF 111

Query: 125 RMFKIPIVHGWVI--ETLSKYSYESAQQVLLKXXXXXXXXX------------XXXTLIQ 170
           ++F I I+HGW+   + + KY+YE +QQ+L +                         LI+
Sbjct: 112 KLFDIDIIHGWISSDDKVQKYTYEESQQLLTQAVDIRDRETPGSGNPQDDNILAEANLIE 171

Query: 171 LFFDETGTQLTQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGYRRRKD 230
            F +++ TQLT NGL  +NT ++E  + VLFRNDHF+TI K N   Y+LVTDLG+R   +
Sbjct: 172 QFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLGFRSCNN 231

Query: 231 IVWENIKSIDGSEDTFCDG 249
           IVWE + SIDGS D F DG
Sbjct: 232 IVWEYMGSIDGSNDIFFDG 250

>YPL191C (YPL191C) [5256] chr16 complement(183596..184678) Member of
           the DUF544 protein of unknown function family, has
           moderate similarity to uncharacterized S. cerevisiae
           Ygl082p [1083 bp, 360 aa]
          Length = 360

 Score =  191 bits (485), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 114/270 (42%), Positives = 160/270 (59%), Gaps = 23/270 (8%)

Query: 5   LQFTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKTSTVS 64
           L FT K+++I G   +ILLQNENGPCALLA+ N+L++SP H R +  L  L+  K S +S
Sbjct: 3   LSFTTKSVKINGQNHRILLQNENGPCALLALANILILSPDHTRFSNELIRLV-NKGSQIS 61

Query: 65  LDEVNQVLANIALQSNTEMKGSNGADMDQXXXXXXXXXXXXNINPKFDGTFEDSNEMALF 124
           L E+ +VLA+IALQ    +      D+ +            NINP+F+G+FE++ EM++F
Sbjct: 62  LKELIEVLADIALQ----VTDKPSTDISELLSLLPRLHEGLNINPEFNGSFENTKEMSIF 117

Query: 125 RMFKIPIVHGWVI---------ETLSKYSYESAQQVL---------LKXXXXXXXXXXXX 166
           R+F + +VHGWVI         E LS YSYESAQ++L         +             
Sbjct: 118 RLFNVDVVHGWVINSFINENIDEKLSHYSYESAQRILTQAADINCGISQDENSDEVLRDA 177

Query: 167 TLIQLFFDETGTQLTQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGYR 226
             + LF +E+ TQLT  GL  L   L    F +LFRNDHFST++K  ++LY+LVTD GY+
Sbjct: 178 MHLGLFLNESPTQLTAFGLLRLREKLLHNKFSILFRNDHFSTLFKYEDRLYTLVTDFGYK 237

Query: 227 RRKDIVWENIKSIDGSEDTFCDGNLDTIDL 256
             KDIVW+++ S+DGS D F  GN    ++
Sbjct: 238 NCKDIVWQSLDSVDGSCDAFFAGNFSAAEV 267

>Scas_720.14
          Length = 403

 Score =  191 bits (485), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 162/270 (60%), Gaps = 22/270 (8%)

Query: 7   FTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKTST-VSL 65
           F  K ++I GT  KILL+NE GP AL+A+ N+LL+SP  ++  Y L +L+   ++  VS 
Sbjct: 5   FQTKTVDINGTQHKILLENEQGPTALVALTNVLLLSPGLQQTAYELIQLVNNASNNFVSW 64

Query: 66  DEVNQVLANIALQSNTEMKGSNGADMDQXXXXXXXXXXXXNINPKFDGTFEDSNEMALFR 125
           +E+ QVL+ + LQ++  +   N    +Q            N+NP F+G+FED  EM+LFR
Sbjct: 65  NELLQVLSRVGLQNHNYVSNLNN---EQLVQYLPQLQSGLNVNPGFNGSFEDGIEMSLFR 121

Query: 126 MFKIPIVHGWVIE---------TLSKYSYESAQQVLLKXXXXXXXXXXX---------XT 167
           +F + IVHGW+I+          +++Y+YESAQ++L++                      
Sbjct: 122 LFNVGIVHGWIIDGDNDPVAYDHVARYTYESAQRLLVQSYDIKKNNLQVDNKDLILEDAN 181

Query: 168 LIQLFFDETGTQLTQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGYRR 227
            I+ F   + TQLT+ GL +L  IL E+GF VLFRN+ + T+YK N QLY+LVTDL +R 
Sbjct: 182 YIKSFLARSATQLTEYGLKHLKEILVERGFAVLFRNEVYVTLYKNNGQLYTLVTDLQHRN 241

Query: 228 RKDIVWENIKSIDGSEDTFCDGNLDTIDLK 257
             DI+W+++KS++G++D++  GN  +  L+
Sbjct: 242 DTDIIWQSLKSVNGTQDSYYTGNFISTSLE 271

>KLLA0E19371g 1718449..1719495 similar to sp|P53155 Saccharomyces
           cerevisiae YGL082w, start by similarity
          Length = 348

 Score =  186 bits (473), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 96/260 (36%), Positives = 151/260 (58%), Gaps = 23/260 (8%)

Query: 5   LQFTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKTSTVS 64
           ++F  K I++ G    ILLQNENGPCAL+A+ N+L++SPQHK     L +L+      V+
Sbjct: 1   MEFETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANELIQLI-NSNRKVT 59

Query: 65  LDEVNQVLANIALQSNTEMKGSNGADMDQXXXXXXXXXXXXNINPKFDGTFEDSNEMALF 124
           L+++   LANI +     M      D+++            N+NP F+GTF+D   +ALF
Sbjct: 60  LEDLITTLANIGVM----MDNGQSEDVNELLQLLPQLHTGLNVNPAFNGTFQDDQALALF 115

Query: 125 RMFKIPIVHGWVIE---------TLSKYSYESAQQVLLKXXXXXXXXXXXXTLIQL---- 171
           R+F++ +VHGW+++         ++S YSY+ AQ +L+                Q+    
Sbjct: 116 RLFQVSLVHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNNGLQVENSEQILQDA 175

Query: 172 -----FFDETGTQLTQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGYR 226
                F   + TQLT+ G+ +L  +L+E  + V FRNDHFSTI+K N  LY LVTDLG++
Sbjct: 176 QYLKSFLARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFK 235

Query: 227 RRKDIVWENIKSIDGSEDTF 246
           +  +IVW+++KS+ G++D+F
Sbjct: 236 KASNIVWQSLKSVKGNQDSF 255

>CAGL0H03289g 309091..310248 similar to sp|P53155 Saccharomyces
           cerevisiae YGL082w, start by similarity
          Length = 385

 Score =  151 bits (382), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 142/264 (53%), Gaps = 24/264 (9%)

Query: 7   FTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKTSTVSLD 66
           ++IK+IE KG   +ILL  +    AL+A+ N L++S  H R+   L  + +   + ++++
Sbjct: 5   YSIKSIEFKGYHCRILLDQDEDYSALVALTNALVLSQGHNRVTSQLKSIFDN-CNEIAVE 63

Query: 67  EVNQVLANIALQSNTEMKGSNGADMDQXXXXXXXXXXXXNINPKFDGTFEDSNEMALFRM 126
           ++   LANI LQ    +  + G D +Q            +INPKF+G+F DS E ++F  
Sbjct: 64  DLLDELANIGLQ--LGVMSNYGQDKEQLIATLKEFRKGLHINPKFNGSFTDSLETSVFSG 121

Query: 127 FKIPIVHGWVIE---------TLSKYSYESAQQVLLKX------------XXXXXXXXXX 165
           F + +VHGWV++          LSKYSYE AQ+VL++                       
Sbjct: 122 FNVALVHGWVVDGDRDPTSYYHLSKYSYEEAQRVLVQAYEIRKDQNGVALNTNAQQVLDD 181

Query: 166 XTLIQLFFDETGTQLTQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGY 225
              I+ F   + TQLT+ GL +L  IL EK F VLFRND + T+YK   +L+ LVT+   
Sbjct: 182 SAYIKSFLARSATQLTEYGLQHLKEILVEKSFAVLFRNDRYFTLYKNAGELFILVTNPSQ 241

Query: 226 RRRKDIVWENIKSIDGSEDTFCDG 249
            R  +IVW+++ S++G+ D + +G
Sbjct: 242 SRNNNIVWQSLHSVNGARDLYYNG 265

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 10/92 (10%)

Query: 177 GTQLTQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQ-----LYSLVTDL--GYRRRK 229
           G    +N +    TI++E+GF  L+R    +   +  NQ     +YS + +   GY  ++
Sbjct: 148 GAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQE 207

Query: 230 DI-VWEN--IKSIDGSEDTFCDGNLDTIDLKM 258
            +  WE   I  I G+   F +  LDTI  ++
Sbjct: 208 MLPSWETSLIGLISGAIGPFSNAPLDTIKTRL 239

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor,
           hypothetical start
          Length = 1372

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 188 LNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGYRRRKDIVWENIKSIDG 241
           L + L  +G V+LF N  F T+Y    QL  ++ +  ++ + +IV+  +   +G
Sbjct: 445 LQSSLPPRGIVILFVNKFFETLY----QLAPIIDETNFKNQLNIVFPELNIFEG 494

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,267,293
Number of extensions: 317689
Number of successful extensions: 820
Number of sequences better than 10.0: 11
Number of HSP's gapped: 796
Number of HSP's successfully gapped: 11
Length of query: 299
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 198
Effective length of database: 13,099,691
Effective search space: 2593738818
Effective search space used: 2593738818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)