Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_611.3d1291296601e-90
YPL192C (PRM3)133361136e-08
CAGL0G09229g11123690.083
KLLA0E00550g56367650.77
KLLA0F24420g57822594.2
YOL053W39586585.2
ABL013C69894586.0
CAGL0M03113g62350577.0
YOR003W (YSP3)47890577.8
Kwal_47.1886582893578.1
KLLA0C12749g55453578.5
KLLA0B01914g78968578.6
Kwal_0.3029340569.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_611.3d
         (129 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_611.3d                                                           258   1e-90
YPL192C (PRM3) [5255] chr16 complement(182654..183055) Nuclear m...    48   6e-08
CAGL0G09229g complement(881448..881783) some similarities with s...    31   0.083
KLLA0E00550g 53103..54794 gi|33302360|gb|AAQ01788.1 Kluyveromyce...    30   0.77 
KLLA0F24420g 2275736..2277472 some similarities with sp|P38830 S...    27   4.2  
YOL053W (YOL053W) [4766] chr15 (230083..231270) Protein of unkno...    27   5.2  
ABL013C [579] [Homologous to ScYMR232W (FUS2) - SH] (372925..375...    27   6.0  
CAGL0M03113g 352552..354423 highly similar to sp|P19658 Saccharo...    27   7.0  
YOR003W (YSP3) [4818] chr15 (331455..332891) Subtilisin-like pro...    27   7.8  
Kwal_47.18865                                                          27   8.1  
KLLA0C12749g 1079939..1081603 weakly similar to sp|Q05040 Saccha...    27   8.5  
KLLA0B01914g 166552..168921 similar to sgd|S0006142 Saccharomyce...    27   8.6  
Kwal_0.30                                                              26   9.9  

>Scas_611.3d
          Length = 129

 Score =  258 bits (660), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 129/129 (100%), Positives = 129/129 (100%)

Query: 1   MSNLIDKETDSTQVPLIIIKTPPTTERTDLKDHVKKLEIGNNNNERVKHVRKTKTSSERQ 60
           MSNLIDKETDSTQVPLIIIKTPPTTERTDLKDHVKKLEIGNNNNERVKHVRKTKTSSERQ
Sbjct: 1   MSNLIDKETDSTQVPLIIIKTPPTTERTDLKDHVKKLEIGNNNNERVKHVRKTKTSSERQ 60

Query: 61  LRNEKKNTGKITKPHIKENEKTTNLALKKQRNIAQKDSDAFYHGALFGSFLGATLSTVVT 120
           LRNEKKNTGKITKPHIKENEKTTNLALKKQRNIAQKDSDAFYHGALFGSFLGATLSTVVT
Sbjct: 61  LRNEKKNTGKITKPHIKENEKTTNLALKKQRNIAQKDSDAFYHGALFGSFLGATLSTVVT 120

Query: 121 NLIVKSLEK 129
           NLIVKSLEK
Sbjct: 121 NLIVKSLEK 129

>YPL192C (PRM3) [5255] chr16 complement(182654..183055) Nuclear
           membrane protein involved in karyogamy [402 bp, 133 aa]
          Length = 133

 Score = 48.1 bits (113), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 30/36 (83%)

Query: 93  IAQKDSDAFYHGALFGSFLGATLSTVVTNLIVKSLE 128
           + +++  +FY GA+FGSFLGA ++TV++NL VK+L+
Sbjct: 97  VQRENKGSFYQGAIFGSFLGAAVTTVLSNLAVKALQ 132

>CAGL0G09229g complement(881448..881783) some similarities with
           sp|Q08931 Saccharomyces cerevisiae YPL192c PRM3,
           hypothetical start
          Length = 111

 Score = 31.2 bits (69), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 18/23 (78%)

Query: 101 FYHGALFGSFLGATLSTVVTNLI 123
           ++ G L GSFLGA ++++++ +I
Sbjct: 84  YFEGMLVGSFLGAAITSMISKII 106

>KLLA0E00550g 53103..54794 gi|33302360|gb|AAQ01788.1 Kluyveromyces
           lactis FPS1p, start by similarity
          Length = 563

 Score = 29.6 bits (65), Expect = 0.77,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 29/67 (43%), Gaps = 10/67 (14%)

Query: 39  IGNNNNERVKHVRKTKTSSERQ------LRNEKKNTGKITKPHIKENEKTTNLALKKQRN 92
           IG NN        +++TS  +Q      LRN K        P I E+E+TT      + N
Sbjct: 498 IGTNNTTSNVESHRSQTSENKQVHFKSVLRNSKTRNPSTGIPTIFESEETT----YSRPN 553

Query: 93  IAQKDSD 99
             QK SD
Sbjct: 554 FIQKHSD 560

>KLLA0F24420g 2275736..2277472 some similarities with sp|P38830
           Saccharomyces cerevisiae YHR124w NDT80 meiosis-specific
           protein singleton, hypothetical start
          Length = 578

 Score = 27.3 bits (59), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 16/22 (72%)

Query: 6   DKETDSTQVPLIIIKTPPTTER 27
           D+ETD T VP+++ KTPP   R
Sbjct: 292 DEETDMTFVPILMEKTPPLIIR 313

>YOL053W (YOL053W) [4766] chr15 (230083..231270) Protein of unknown
           function [1188 bp, 395 aa]
          Length = 395

 Score = 26.9 bits (58), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 4/86 (4%)

Query: 41  NNNNERVKHVRKTKTSSERQLRNEKKNTGKITK---PHIK-ENEKTTNLALKKQRNIAQK 96
           N+  E  +HV   K       + ++   G+I +   P+IK E+ ++   A+  QRN  +K
Sbjct: 96  NSLTESKRHVHDGKHFFTTPHQQQQTKLGEIEEGHSPNIKGEDLRSIGQAITHQRNKRRK 155

Query: 97  DSDAFYHGALFGSFLGATLSTVVTNL 122
              +   G +FG  LG +L   V  L
Sbjct: 156 QIWSAIFGGIFGVILGYSLIYRVIYL 181

>ABL013C [579] [Homologous to ScYMR232W (FUS2) - SH]
           (372925..375021) [2097 bp, 698 aa]
          Length = 698

 Score = 26.9 bits (58), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 45/94 (47%), Gaps = 1/94 (1%)

Query: 19  IKTPPTTERTDLKDHVKKLEIGNNNNERVKHVRKTKTSSERQLRNEKKNTGKITKPHIKE 78
           +  P T E T ++D+  + ++ N N ++ K  R   + S  +   E K T +     ++ 
Sbjct: 54  LAYPATGEMTPIRDYAAECQLQNRNLQQGKVRRNPYSESLWEALGENKRTIQRINTQVRN 113

Query: 79  NEKTTNLALKKQRNI-AQKDSDAFYHGALFGSFL 111
             +  +L L+++ +I  +K  D+  +   FG ++
Sbjct: 114 RHRPRSLKLEQEADIPVRKKVDSPLNLRTFGDYM 147

>CAGL0M03113g 352552..354423 highly similar to sp|P19658
           Saccharomyces cerevisiae YJL085w EXO70 exocyst component
           protein, hypothetical start
          Length = 623

 Score = 26.6 bits (57), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 7/50 (14%)

Query: 22  PPTTERTDLKDHVKKLEIGNNNNER-------VKHVRKTKTSSERQLRNE 64
           P T E   L+D  + + +GN+ +         +KH+++  TSSE QL  E
Sbjct: 98  PFTVELHKLEDMYQDMSVGNSRHTENAEFHGILKHLKEMITSSEEQLELE 147

>YOR003W (YSP3) [4818] chr15 (331455..332891) Subtilisin-like
           protease III [1437 bp, 478 aa]
          Length = 478

 Score = 26.6 bits (57), Expect = 7.8,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 39/90 (43%), Gaps = 15/90 (16%)

Query: 22  PPTTERTDLKDH-------VKKLEIGNNNNERVKHVRKTKTSSERQLRNEKKNTGKITKP 74
           P   E +DL  H       +     G   N ++  V+  +++ E  + +  K    +TK 
Sbjct: 234 PANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKE 293

Query: 75  HIKENEK--------TTNLALKKQRNIAQK 96
           HI+ ++K        T NL+L   +++A +
Sbjct: 294 HIESSKKKNKEFKGSTANLSLGSSKSLAME 323

>Kwal_47.18865
          Length = 828

 Score = 26.6 bits (57), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 14  VPLIIIKTPPTTERTDLKDHVKKLEIGNNNNERVKHVRKTKTSSERQLRNEKKNTGKITK 73
           VPL+I+   PT + T LK  +  L  G        H+ +  TS  R  ++  +     + 
Sbjct: 390 VPLMILCGKPTGKNTILK-VLMDLHAG--------HIFEVNTSGNRSKKDFVERVLDFST 440

Query: 74  PHIKENEKTTNLALKKQRNIAQKDSDAFYHGAL 106
            H  +++ +  + L    ++  K+ D F+ GA+
Sbjct: 441 THYVKDKGSKGIILFDDVDVLFKERDKFFWGAI 473

>KLLA0C12749g 1079939..1081603 weakly similar to sp|Q05040
           Saccharomyces cerevisiae YMR029c singleton, hypothetical
           start
          Length = 554

 Score = 26.6 bits (57), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 18  IIKTPPTTER----TDLKDHVKKLEIGNNNNERVKHVRKTKTSSERQLRNEKK 66
           ++K+PP T++     D  D VKKLE  N  N     + K  T +  +++NE K
Sbjct: 112 LLKSPPVTDQLESLNDKDDSVKKLESLNLFNVNNSSILKNGTDNRTEVKNEHK 164

>KLLA0B01914g 166552..168921 similar to sgd|S0006142 Saccharomyces
           cerevisiae YPL221w BOP1, start by similarity
          Length = 789

 Score = 26.6 bits (57), Expect = 8.6,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 29/68 (42%)

Query: 5   IDKETDSTQVPLIIIKTPPTTERTDLKDHVKKLEIGNNNNERVKHVRKTKTSSERQLRNE 64
           + KE D     +++ +    TE +    + +KLE     N   KH  K K   +  LR  
Sbjct: 619 VAKEHDGDWQEMLVTQGQQNTESSTDNLNDEKLEAAEEANISRKHSFKDKILRKMSLRRN 678

Query: 65  KKNTGKIT 72
           K  + ++T
Sbjct: 679 KSTSSRLT 686

>Kwal_0.30
          Length = 293

 Score = 26.2 bits (56), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query: 43  NNERVKHVRKTKTSSERQLRNEKKNTGKITKPHIKENEKT 82
             E +K  +        +LR+EK+  G   KPH++  EKT
Sbjct: 239 GQETIKEFKTFYDDGSVKLRSEKQLQGSDGKPHVESFEKT 278

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.126    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,425,926
Number of extensions: 195293
Number of successful extensions: 1196
Number of sequences better than 10.0: 127
Number of HSP's gapped: 1186
Number of HSP's successfully gapped: 131
Length of query: 129
Length of database: 16,596,109
Length adjustment: 90
Effective length of query: 39
Effective length of database: 13,480,489
Effective search space: 525739071
Effective search space used: 525739071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 55 (25.8 bits)