Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_611.338938917450.0
YPL193W (RSA1)3812525501e-66
CAGL0G09218g3792744341e-49
AFL073W3351734005e-45
KLLA0E19437g3421533822e-42
Kwal_56.239673421603491e-37
Scas_653.30805173730.52
Sklu_2120.347459682.3
YKR074W15548642.9
Sklu_2342.556396655.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_611.3
         (389 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_611.3                                                            676   0.0  
YPL193W (RSA1) [5254] chr16 (181402..182547) Nucleoplasmic prote...   216   1e-66
CAGL0G09218g 880312..881451 similar to sp|Q08932 Saccharomyces c...   171   1e-49
AFL073W [3120] [Homologous to ScYPL193W (RSA1) - SH] complement(...   158   5e-45
KLLA0E19437g complement(1721747..1722775) some similarities with...   151   2e-42
Kwal_56.23967                                                         139   1e-37
Scas_653.30                                                            33   0.52 
Sklu_2120.3 YNL239W, Contig c2120 4275-5699 reverse complement         31   2.3  
YKR074W (YKR074W) [3324] chr11 (578851..579318) Protein of unkno...    29   2.9  
Sklu_2342.5 YMR291W, Contig c2342 6908-8599 reverse complement         30   5.6  

>Scas_611.3
          Length = 389

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/389 (89%), Positives = 350/389 (89%)

Query: 1   MNYNGQQDQPHYAPNGPPQAHLPKPTFSGTLGQDSSENGQTMSNHNDNLRASXXXXXXXX 60
           MNYNGQQDQPHYAPNGPPQAHLPKPTFSGTLGQDSSENGQTMSNHNDNLRAS        
Sbjct: 1   MNYNGQQDQPHYAPNGPPQAHLPKPTFSGTLGQDSSENGQTMSNHNDNLRASQSYPQYPP 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNSNQWAQPQQSPSNDWNNRGTTPMRTYT 120
                                          MNSNQWAQPQQSPSNDWNNRGTTPMRTYT
Sbjct: 61  QQGYPYYPVPKYQAPYQQPGYHQQQRQYQPYMNSNQWAQPQQSPSNDWNNRGTTPMRTYT 120

Query: 121 PISYEDISTGPSTSARNVSSKRKKQTIVTKDDTTPVSQPDKLMVEQTNDSEGNSADETPE 180
           PISYEDISTGPSTSARNVSSKRKKQTIVTKDDTTPVSQPDKLMVEQTNDSEGNSADETPE
Sbjct: 121 PISYEDISTGPSTSARNVSSKRKKQTIVTKDDTTPVSQPDKLMVEQTNDSEGNSADETPE 180

Query: 181 MHTTKRRKVNNDISLPVLDSDSDEETNIEDDKKPIVVPGTSISLVTDEDIIKWREERRKM 240
           MHTTKRRKVNNDISLPVLDSDSDEETNIEDDKKPIVVPGTSISLVTDEDIIKWREERRKM
Sbjct: 181 MHTTKRRKVNNDISLPVLDSDSDEETNIEDDKKPIVVPGTSISLVTDEDIIKWREERRKM 240

Query: 241 WLLKISNNKQKHMEEMGLKEEDVKKQKSVLVESRKQNQFIQSIQNQVNRFNPKANLNLKL 300
           WLLKISNNKQKHMEEMGLKEEDVKKQKSVLVESRKQNQFIQSIQNQVNRFNPKANLNLKL
Sbjct: 241 WLLKISNNKQKHMEEMGLKEEDVKKQKSVLVESRKQNQFIQSIQNQVNRFNPKANLNLKL 300

Query: 301 IQRGMVSDNSKLLDFITNLGDAGLLEYELTQDEKDKLFGGFGNHDDKNRNYRNFNNRSPQ 360
           IQRGMVSDNSKLLDFITNLGDAGLLEYELTQDEKDKLFGGFGNHDDKNRNYRNFNNRSPQ
Sbjct: 301 IQRGMVSDNSKLLDFITNLGDAGLLEYELTQDEKDKLFGGFGNHDDKNRNYRNFNNRSPQ 360

Query: 361 SSSSYRGRNPRFGNTNKRPSSVYNNRPKQ 389
           SSSSYRGRNPRFGNTNKRPSSVYNNRPKQ
Sbjct: 361 SSSSYRGRNPRFGNTNKRPSSVYNNRPKQ 389

>YPL193W (RSA1) [5254] chr16 (181402..182547) Nucleoplasmic protein
           involved in assembly of 60S ribosomal subunits [1146 bp,
           381 aa]
          Length = 381

 Score =  216 bits (550), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 162/252 (64%), Gaps = 13/252 (5%)

Query: 120 TPISYEDISTGPSTSARNVSSKRKKQTIVTKDDTTPVSQPDKLMVEQTNDSEGNSADETP 179
           T ISYED++       + +   R K T + +    P S+ D+   E T     +     P
Sbjct: 140 TSISYEDVAIPTVKEIQLIEKNRGKDTFMNEISPVPSSK-DQASAEPTEIPRKD-----P 193

Query: 180 EMHTTKRRKVNNDISLPVLDSDSDEETNIEDDKKPIVVPGTSISLVTDEDIIKWREERRK 239
           E+  +     +N++ L   D D DE+   E   K ++VPGTSI+L+TDED+ KWREER+K
Sbjct: 194 ELANSNAEDDHNNLGLE--DDDRDEQLESEGLGKVVLVPGTSIALITDEDVKKWREERKK 251

Query: 240 MWLLKISNNKQKHMEEMGLKEEDVKKQKSVLVESRKQNQFIQSIQNQVNRFNPKANLNLK 299
           MWLLKISNNKQKHM+EMG+KE+++K Q S+  ESRK+ QFIQSIQNQV R NPK +LNLK
Sbjct: 252 MWLLKISNNKQKHMQEMGIKEDELKSQPSIFKESRKEKQFIQSIQNQVQRGNPKIDLNLK 311

Query: 300 LIQRGMVSDNSKLLDFITNLGDAGLLEYELTQDEKDKLFGGFGNHDDKNRNYR--NFNNR 357
           LIQR   ++NS+LLDFI  LGD GLLEYEL+Q EKD LFG     +D N+N+   N+ NR
Sbjct: 312 LIQREFANENSQLLDFIRELGDVGLLEYELSQQEKDVLFGS---SEDNNKNHYKPNYKNR 368

Query: 358 SPQSSSSYRGRN 369
            P  S +   RN
Sbjct: 369 KPNLSRANFTRN 380

>CAGL0G09218g 880312..881451 similar to sp|Q08932 Saccharomyces
           cerevisiae YPL193w RSA1, start by similarity
          Length = 379

 Score =  171 bits (434), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 169/274 (61%), Gaps = 15/274 (5%)

Query: 97  WAQPQ---QSPSNDWNNRGTTPMRTYTPISYEDIST-GPSTSARNVSSKRKKQTIVTKDD 152
           + QPQ    + +N W+NR     + Y P     IS   P  +  N  + +     ++++ 
Sbjct: 71  YQQPQGVYMATNNQWDNRYPMTWQQYMPAQSNSISMHTPDINYTNYHTPQPVAPYISENS 130

Query: 153 TTPVSQ--PDKL-----MVEQTNDSEGNSADETPEMHTTKRRKVNNDISLPVLDSDSDEE 205
              + +  PDK      +V+  +   G +  E P+ H   +   N D        D D+E
Sbjct: 131 RGFLERQDPDKTSTSNSIVKSEDLVRGKNTSEIPDKHKPVKLANNKDRDKTGNKDDDDDE 190

Query: 206 TNI--EDDKKPIVVPGTSISLVTDEDIIKWREERRKMWLLKISNNKQKHMEEMGLKEEDV 263
            +I   ++   +++PGTSISL T+EDI KW++ERRKMWLL+ISNNK++HME+MG K+ED+
Sbjct: 191 LSIPKSEEGAKVLIPGTSISLETEEDIKKWKDERRKMWLLRISNNKKEHMEKMGYKDEDL 250

Query: 264 KKQKSVLVESRKQNQFIQSIQNQVNRFNPKANLNLKLIQRGMVSDNSKLLDFITNLGDAG 323
           KK+ +VL ESRK   FI++IQ+Q++R NP  NLN +L+QRGM  +N+KLLDFI  LG+ G
Sbjct: 251 KKETNVLKESRKDKNFIKNIQSQISRANPNVNLNTRLVQRGMAEENAKLLDFIVELGECG 310

Query: 324 LLEYELTQDEKDKLFGGFGNHDDKNRNYRNFNNR 357
            LEYELT++EK+KLFGG+ N+   NR  +N++ R
Sbjct: 311 FLEYELTEEEKEKLFGGYSNNFSNNR--KNYHGR 342

 Score = 29.3 bits (64), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 10/15 (66%), Positives = 13/15 (86%)

Query: 22 LPKPTFSGTLGQDSS 36
          LPKPTFSG +G D++
Sbjct: 17 LPKPTFSGVIGDDTA 31

>AFL073W [3120] [Homologous to ScYPL193W (RSA1) - SH]
           complement(298718..299725) [1008 bp, 335 aa]
          Length = 335

 Score =  158 bits (400), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 83/173 (47%), Positives = 109/173 (63%), Gaps = 8/173 (4%)

Query: 201 DSDEETNIEDDKKPIV---VPGTSISLVTDEDIIKWREERRKMWLLKISNNKQKHMEEMG 257
           + DE+     +  P V   + GTSI L T EDI KWR ERRKMWLLKISN K+KHMEE+G
Sbjct: 158 EGDEQAETGSEAGPTVDGAIAGTSIVLSTTEDIEKWRSERRKMWLLKISNQKEKHMEELG 217

Query: 258 LKEEDVKKQKSVLVESRKQNQFIQSIQNQVNRFNPKANLNLKLIQRGMVSDNSKLLDFIT 317
           + E++++   S LV+ RK  +FI  IQ+ V RF  K NL++ L+QR M ++N+K+L FI 
Sbjct: 218 VSEQELRC--SPLVQGRKDKKFISGIQSHVMRFTSKQNLSVGLVQRTMAAENAKILGFIK 275

Query: 318 NLGDAGLLEYELTQDEKDKLFGGFGNHDDKNRNYRNFNNRSPQSSSSYRGRNP 370
            LGDA LLE+ LT+ EK+ L   FG       N + F  RS  S +  RGR P
Sbjct: 276 ELGDANLLEHVLTEKEKEAL---FGKAMRAAENRKQFAGRSFTSQNDGRGRPP 325

>KLLA0E19437g complement(1721747..1722775) some similarities with
           sp|Q08932 Saccharomyces cerevisiae YPL193w RSA1
           nucleoplasmic protein involved in assembly of 60S
           ribosomal subunits singleton, hypothetical start
          Length = 342

 Score =  151 bits (382), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 79/153 (51%), Positives = 109/153 (71%), Gaps = 3/153 (1%)

Query: 215 IVVPGTSISLVTDEDIIKWREERRKMWLLKISNNKQKHMEEMGLKEEDVKKQKSVLVESR 274
           + +PGTSI L T+EDI KW+EERRKMWL+KISN K+ + E+  +K+ED+ +  + L ESR
Sbjct: 181 LYIPGTSIVLKTEEDIAKWKEERRKMWLIKISNKKEMYREKFNVKDEDLNR--NPLQESR 238

Query: 275 KQNQFIQSIQNQVNRFNPKANLNLKLIQRGMVSDNSKLLDFITNLGDAGLLEYELTQDEK 334
           K+  FIQ+IQNQV RFN K NL + L QR +  +N K+LDFI  LGDA  L+YELT++EK
Sbjct: 239 KERYFIQNIQNQVKRFNYKPNLTIGLHQRILKEENGKILDFIKELGDANYLKYELTEEEK 298

Query: 335 DKLFGGFGNHDDKNRNY-RNFNNRSPQSSSSYR 366
           + LFGG  + +D+NR   R ++ +  Q  + YR
Sbjct: 299 EVLFGGKDHKNDQNRRSNRRYDRQLNQRDTQYR 331

>Kwal_56.23967
          Length = 342

 Score =  139 bits (349), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/160 (50%), Positives = 112/160 (70%), Gaps = 7/160 (4%)

Query: 203 DEETNIEDDKKP---IVVPGTSISLVTDEDIIKWREERRKMWLLKISNNKQKHMEEMGLK 259
           D E  ++ DKK    + +PGTSI+L ++EDI KWREERRKMWL+KISN ++KH +E+G++
Sbjct: 163 DAEGALQSDKKEKKVVAIPGTSITLESEEDIKKWREERRKMWLVKISNQREKHRQELGVE 222

Query: 260 EEDVKKQKSVLVESRKQNQFIQSIQNQVNRFNPKANLNLKLIQRGMVSDNSKLLDFITNL 319
           E++         + +K  QFIQSIQNQ+NR NP  NL+L+L+QR M  +N  LL+FI  L
Sbjct: 223 EKE-PTNAGAFQQVKKDKQFIQSIQNQINRVNPNPNLSLRLMQRTMAEENINLLNFIQEL 281

Query: 320 GDAGLLEYELTQDEKDKLFGGFGNHDDKNRNYRNFNNRSP 359
           GDA LLEYELT++EK+ L   FGN   +N+   +FN + P
Sbjct: 282 GDAKLLEYELTEEEKNVL---FGNTFKRNKPRADFNRKRP 318

>Scas_653.30
          Length = 805

 Score = 32.7 bits (73), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 83/173 (47%), Gaps = 24/173 (13%)

Query: 106 NDWNNRGTTPMRTYTPISYEDISTGPSTSARNVSSKRKKQTIVTKDDTTPVSQPDKLMVE 165
           +D+ N+      T++  + +D+    S    N  SK   Q ++TK   T VS  D +   
Sbjct: 545 DDYTNQVQYKRDTHSMFTKDDLLNYYSDPGSNKYSKIGSQLLLTK--PTHVSTSDLI--- 599

Query: 166 QTNDSEGNSADETPEMHTTKRRKVNNDISLPVLDSDSDEETN---IEDDKKPIVVPGTSI 222
             +D++G +   TP+++  K    N  +S  ++ + +D++ N    +DD+ P +   TSI
Sbjct: 600 --SDTQGRTI--TPDVYGAKSIS-NGFLSEAMVKTRNDDKANNNITDDDQTPALATKTSI 654

Query: 223 SLVTDEDIIKWREERR---KMWLLKISNNKQKHMEE--------MGLKEEDVK 264
             +  +DI  WR  +    K+  LK + +++KH +E        +GL  + VK
Sbjct: 655 YRMVSDDIKSWRSMKSRTPKISDLKKAASRKKHSKEHTDKDTSHLGLGSQSVK 707

>Sklu_2120.3 YNL239W, Contig c2120 4275-5699 reverse complement
          Length = 474

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%)

Query: 103 SPSNDWNNRGTTPMRTYTPISYEDISTGPSTSARNVSSKRKKQTIVTKDDTTPVSQPDK 161
           + S  WN   TT +R +  +  E ++ G   S   +S KR+   I+T     P  +PD+
Sbjct: 195 TSSRKWNQLLTTKLREFAEVLREALTDGKDISELKLSMKREIFKIMTMFMDLPPVKPDQ 253

>YKR074W (YKR074W) [3324] chr11 (578851..579318) Protein of unknown
           function, has high similarity to uncharacterized C.
           albicans Orf6.1502p [468 bp, 155 aa]
          Length = 155

 Score = 29.3 bits (64), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query: 198 LDSDSDEETNIEDDKKPIVVPG----TSISLVTDEDIIKWREERRKMW 241
            D D D   +IE+DKK +   G    T ISL   ED ++++E   + W
Sbjct: 108 FDHDDDWTLDIENDKKKLFEYGIENETEISLFNKEDYLRFKENPEEKW 155

>Sklu_2342.5 YMR291W, Contig c2342 6908-8599 reverse complement
          Length = 563

 Score = 29.6 bits (65), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 5/96 (5%)

Query: 120 TPISYEDISTGPSTSARNVSSKRKKQTIVTKDDT-TPVSQPDKLMVEQTNDSEGNSADET 178
           TP S  + +  P+ S RN S+   KQ++ TKD + T ++    L     N+S  ++    
Sbjct: 463 TPESRSNFNVSPAMS-RNSSTNNVKQSLTTKDTSLTSLTTNSTLSDRTMNNSWSSAVTSA 521

Query: 179 PEMHTTKRRKVNNDISLPVLDSDSDEETNIEDDKKP 214
           P   +T+  K    +SLP  D +SD E  +ED  KP
Sbjct: 522 PAEASTELIKPTAILSLPT-DEESDVE--LEDADKP 554

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.125    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,224,390
Number of extensions: 697329
Number of successful extensions: 4013
Number of sequences better than 10.0: 277
Number of HSP's gapped: 3895
Number of HSP's successfully gapped: 299
Length of query: 389
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 285
Effective length of database: 12,995,837
Effective search space: 3703813545
Effective search space used: 3703813545
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 62 (28.5 bits)