Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_611.233633617000.0
YMR005W (TAF4)38828810001e-135
CAGL0J11726g3363439751e-132
ACL016C3612977981e-105
KLLA0C05962g3663697851e-103
Kwal_56.225054032587691e-100
ADL219C56269644.6
Kwal_56.2454044247637.1
YDR175C (RSM24)31963627.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_611.2
         (336 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_611.2                                                            659   0.0  
YMR005W (TAF4) [3970] chr13 (276045..277211) Component of RNA po...   389   e-135
CAGL0J11726g 1140123..1141133 similar to sp|P50105 Saccharomyces...   380   e-132
ACL016C [1033] [Homologous to ScYMR005W (MPT1) - SH] (331298..33...   311   e-105
KLLA0C05962g complement(527216..528316) similar to sp|P50105 Sac...   306   e-103
Kwal_56.22505                                                         300   e-100
ADL219C [1522] [Homologous to ScYNL039W (BDP1) - SH] (317734..31...    29   4.6  
Kwal_56.24540                                                          29   7.1  
YDR175C (RSM24) [1017] chr4 complement(813187..814146) Protein o...    28   7.9  

>Scas_611.2
          Length = 336

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/336 (96%), Positives = 323/336 (96%)

Query: 1   MASSPKRKQENDQSETNSKKVKTSNEGTNSNVPGGFSDLALPRSSTDLSSKSTVPLALPI 60
           MASSPKRKQENDQSETNSKKVKTSNEGTNSNVPGGFSDLALPRSSTDLSSKSTVPLALPI
Sbjct: 1   MASSPKRKQENDQSETNSKKVKTSNEGTNSNVPGGFSDLALPRSSTDLSSKSTVPLALPI 60

Query: 61  SKMSKQSKTAGNASTTNVSQQQKQSDPNKMQDVLFSAGVDIREEEALLNSSIIASKNKIN 120
           SKMSKQSKTAGNASTTNVSQQQKQSDPNKMQDVLFSAGVDIREEEALLNSSIIASKNKIN
Sbjct: 61  SKMSKQSKTAGNASTTNVSQQQKQSDPNKMQDVLFSAGVDIREEEALLNSSIIASKNKIN 120

Query: 121 TMDVRIPSHPPFLHPDQVARFMQRVAKEQQRRTRQDFSKYPELLSMMSTACETYMRDILT 180
           TMDVRIPSHPPFLHPDQVARFMQRVAKEQQRRTRQDFSKYPELLSMMSTACETYMRDILT
Sbjct: 121 TMDVRIPSHPPFLHPDQVARFMQRVAKEQQRRTRQDFSKYPELLSMMSTACETYMRDILT 180

Query: 181 NALVISRHRRRAIKLNAGRRSEISMILRNIALXXXXXXXXXXXXXIALGLEKEDLENKID 240
           NALVISRHRRRAIKLNAGRRSEISMILRNIAL             IALGLEKEDLENKID
Sbjct: 181 NALVISRHRRRAIKLNAGRRSEISMILRNIALKEKKDEEKRVKKRIALGLEKEDLENKID 240

Query: 241 SEETLHRASNVTAGLRAGSKKQYGWLTSSVSKPTNTSVKSAGKVASDIAARGETGLKFRE 300
           SEETLHRASNVTAGLRAGSKKQYGWLTSSVSKPTNTSVKSAGKVASDIAARGETGLKFRE
Sbjct: 241 SEETLHRASNVTAGLRAGSKKQYGWLTSSVSKPTNTSVKSAGKVASDIAARGETGLKFRE 300

Query: 301 AREEPGIVMRDLLYALENRRNGVHNVISKGYARIRD 336
           AREEPGIVMRDLLYALENRRNGVHNVISKGYARIRD
Sbjct: 301 AREEPGIVMRDLLYALENRRNGVHNVISKGYARIRD 336

>YMR005W (TAF4) [3970] chr13 (276045..277211) Component of RNA
           polymerase II general transcription factor TFIID [1167
           bp, 388 aa]
          Length = 388

 Score =  389 bits (1000), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 225/288 (78%), Gaps = 9/288 (3%)

Query: 56  LALPISK-------MSKQSKTAGNASTTNVSQQQKQSDPNKMQDVLFSAGVDIREEEALL 108
           LALP           SK     G AS ++    Q+QSDPNKMQDVLFSAG+D+REEEALL
Sbjct: 103 LALPKKDDKKKNKGTSKADSKDGKASNSSGQNAQQQSDPNKMQDVLFSAGIDVREEEALL 162

Query: 109 NSSIIASKNKINTMDVRIPSHPPFLHPDQVARFMQRVAKEQQRRTRQDFSKYPELLSMMS 168
           NSSI ASK+++ T +V+IP+H PFLHP+QV+ +M++V KEQ        +K PE+L MMS
Sbjct: 163 NSSINASKSQVQTNNVKIPNHLPFLHPEQVSNYMRKVGKEQNFNLTP--TKNPEILDMMS 220

Query: 169 TACETYMRDILTNALVISRHRRRAIKLNAGRRSEISMILRNIALXXXXXXXXXXXXXIAL 228
           +ACE YMRDILTNA+VISRHRR+A+K+N+GRRSE+S  LR IAL             IAL
Sbjct: 221 SACENYMRDILTNAIVISRHRRKAVKINSGRRSEVSAALRAIALIQKKEEERRVKKRIAL 280

Query: 229 GLEKEDLENKIDSEETLHRASNVTAGLRAGSKKQYGWLTSSVSKPTNTSVKSAGKVASDI 288
           GLEKED ENKIDSEETLHRASNVTAGLRAGSKKQYGWLTSSV+KPT+   KS+GKVASDI
Sbjct: 281 GLEKEDYENKIDSEETLHRASNVTAGLRAGSKKQYGWLTSSVNKPTSLGAKSSGKVASDI 340

Query: 289 AARGETGLKFREAREEPGIVMRDLLYALENRRNGVHNVISKGYARIRD 336
            ARGE+GLKFREAREEPGIVMRDLL+ALENRRN V  +ISKGYA+IRD
Sbjct: 341 TARGESGLKFREAREEPGIVMRDLLFALENRRNSVQTIISKGYAKIRD 388

>CAGL0J11726g 1140123..1141133 similar to sp|P50105 Saccharomyces
           cerevisiae YMR005w MPT1 required for protein synthesis,
           hypothetical start
          Length = 336

 Score =  380 bits (975), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 200/343 (58%), Positives = 250/343 (72%), Gaps = 17/343 (4%)

Query: 3   SSPKRKQENDQSETNSKKVKTSNEGTNSNVPGGFSDLALPRSSTDLSSKSTVPLALPI-- 60
           SS KR  E + + + +KKVK     T S +    S+LALP+ +   ++ + VPLALP   
Sbjct: 2   SSQKRPSE-ESTGSGTKKVKLEETKTPS-LKSEASNLALPKMNDSSNNINAVPLALPKGG 59

Query: 61  -------SKMSKQSKTAGNASTTNVSQQQKQSDPNKMQDVLFSAGVDIREEEALLNSSII 113
                  SK ++  K  G    T   Q+QK +DPNKMQDVL SAGVD++EEEALL+S++ 
Sbjct: 60  DKKKKANSKTAQSGKNGGKEDGT--GQKQKATDPNKMQDVLISAGVDLKEEEALLSSTVN 117

Query: 114 ASKNKINTMDVRIPSHPPFLHPDQVARFMQRVAKEQQRRTRQDFSKYPELLSMMSTACET 173
            SK + N   V IP HPPFLHPDQV+ FM++VAK Q       F+K  E+L MMS+ACE+
Sbjct: 118 VSKTQQNA--VVIPPHPPFLHPDQVSNFMKKVAKTQNFNL--SFTKNTEILDMMSSACES 173

Query: 174 YMRDILTNALVISRHRRRAIKLNAGRRSEISMILRNIALXXXXXXXXXXXXXIALGLEKE 233
           Y+RDI+TN +V+SRHRR+ +K+N GRRS+++  LR+IA+             IALGLEKE
Sbjct: 174 YLRDIITNTIVVSRHRRKGVKVNYGRRSQVAAALRSIAINQKKEEERRMKKRIALGLEKE 233

Query: 234 DLENKIDSEETLHRASNVTAGLRAGSKKQYGWLTSSVSKPTNTSVKSAGKVASDIAARGE 293
           D ENK+DSEETLHRASNVTA LRAGSKKQYGWLTSS++KP +  VKSAGKVA++IAARGE
Sbjct: 234 DYENKMDSEETLHRASNVTATLRAGSKKQYGWLTSSINKPASIGVKSAGKVATEIAARGE 293

Query: 294 TGLKFREAREEPGIVMRDLLYALENRRNGVHNVISKGYARIRD 336
           +GLKFREAREEPGIVMRDLL+ALE+RR GVHN+ISKGYARIRD
Sbjct: 294 SGLKFREAREEPGIVMRDLLFALEHRRIGVHNIISKGYARIRD 336

>ACL016C [1033] [Homologous to ScYMR005W (MPT1) - SH]
           (331298..332383) [1086 bp, 361 aa]
          Length = 361

 Score =  311 bits (798), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 163/297 (54%), Positives = 206/297 (69%), Gaps = 12/297 (4%)

Query: 49  SSKSTVPLALPIS--------KMSKQSKTAGNASTTNVSQQQKQSDPNKMQDVLFSAGVD 100
           S +    LALP          K  ++ + AG          ++QSDP+K+ D L SAGVD
Sbjct: 68  SGQPATTLALPAGGAGSGAGRKSPQKMQRAGMRRAAGAGAPKQQSDPDKLSDALLSAGVD 127

Query: 101 IREEEALLNSSIIASKNKINTMDVRIPSHPPFLHPDQVARFMQRVAKEQQRRTRQDFSKY 160
           I+EEEALL+S++   K+     + +IP HPPFLHP  VA  M++VA EQ     QDFSK 
Sbjct: 128 IKEEEALLSSTVTTMKSNSQVSNSQIPLHPPFLHPSHVASMMKKVAAEQN--FNQDFSKS 185

Query: 161 PELLSMMSTACETYMRDILTNALVISRHRRRAIKLNAGRRSEISMILRNIALXXXXXXXX 220
            ELLS+MSTACE Y+RDI+TN+++ISRHRR+A+KLN+GRRSE + +LR++AL        
Sbjct: 186 SELLSLMSTACELYIRDIITNSIIISRHRRKAVKLNSGRRSETTRVLRDLALKQREQEER 245

Query: 221 XXXXXIALGLEKEDLENKIDSEETLHRASNVTAGLR-AGSKKQYGWLTSSVSKPTNTSVK 279
                IALGLEKE  + K+DS ETLHRASN TA +  AG KK+Y WLTS  SK   T +K
Sbjct: 246 RVKRRIALGLEKEITDTKLDSGETLHRASNATANMMIAGGKKKYSWLTSG-SKVNATDLK 304

Query: 280 SAGKVASDIAARGETGLKFREAREEPGIVMRDLLYALENRRNGVHNVISKGYARIRD 336
           + GKV+S +AARG+ G+KFREAREEPGIVMRDLL+ALENRR GV+N I+KGYARIRD
Sbjct: 305 NPGKVSSAVAARGDLGIKFREAREEPGIVMRDLLHALENRRVGVNNTIAKGYARIRD 361

>KLLA0C05962g complement(527216..528316) similar to sp|P50105
           Saccharomyces cerevisiae YMR005w MPT1 required for
           protein synthesis singleton, start by similarity
          Length = 366

 Score =  306 bits (785), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/369 (47%), Positives = 241/369 (65%), Gaps = 36/369 (9%)

Query: 1   MASSPKRKQENDQSETNSKKVKTSNEGT------------NSNVPGGFSD------LALP 42
           MA SPKRK    +  +++K+ K+   G              S++P  F        LALP
Sbjct: 1   MAKSPKRKNSEPEDLSSNKRSKSFEFGKVENGLEPSGSDFGSDLPTPFDTMVTEQPLALP 60

Query: 43  RSS---TDLSS--KSTVPLALPISKMSKQSKTA--------GNASTTNVSQQQKQSDPNK 89
           ++S   T+L+S   S+ P     S  SKQS+ A           STT  + + +QSDP+K
Sbjct: 61  KASSPTTNLASPRNSSTPNLKTTSTTSKQSQKAEQKKNAGGSTGSTTASTTKPQQSDPDK 120

Query: 90  MQDVLFSAGVDIREEEALLNSSIIASKNKINTMDVRIPSHPPFLHPDQVARFMQRVAKEQ 149
           + D L SAGVDIREEEALL+S++  +K    + + ++PSHPPFLHP  ++ FM+R+A EQ
Sbjct: 121 LSDALLSAGVDIREEEALLSSTVARTKATGISANNQVPSHPPFLHPKNISDFMKRIASEQ 180

Query: 150 QRRTRQDFSKYPELLSMMSTACETYMRDILTNALVISRHRRRAIKLNAGRRSEISMILRN 209
                QDF+K  ++L +MSTACE YMRD++TN+L++S HRR+ +KLN GRRSE+S  LR+
Sbjct: 181 N--FHQDFNKNTDILGLMSTACELYMRDVITNSLILSIHRRKGVKLNTGRRSEVSRSLRD 238

Query: 210 IALXXXXXXXXXXXXXIALGLEKEDLENKIDSEETLHRASNVTAGLR--AGSKKQYGWLT 267
           +AL             IALGLEK+  + ++D+EET +RASN TA L    G+KK+Y WLT
Sbjct: 239 LALRQKTQEERRVQRRIALGLEKQTTDARLDTEETQYRASNATANLMIAGGNKKKYSWLT 298

Query: 268 SSVSKPTNTSVKSAGKVASDIAARGETGLKFREAREEPGIVMRDLLYALENRRNGVHNVI 327
           +  SK ++T +K+ G V+S +AARGE G+K+REAREEPGIVMRDLL ALENRR GV+NVI
Sbjct: 299 AG-SKSSSTDLKNQGNVSSAVAARGEMGIKYREAREEPGIVMRDLLLALENRRVGVNNVI 357

Query: 328 SKGYARIRD 336
           +KGYARIRD
Sbjct: 358 TKGYARIRD 366

>Kwal_56.22505
          Length = 403

 Score =  300 bits (769), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 151/258 (58%), Positives = 191/258 (74%), Gaps = 8/258 (3%)

Query: 84  QSDPNKMQDVLFSAGVDIREEEALLNSSIIASKNKINT----MDVRIPSHPPFLHPDQVA 139
           Q+DP+K+ D LFSAGVDIREEEALLNSS+  +K+        ++ +IP  PP LHP  +A
Sbjct: 149 QTDPDKLSDALFSAGVDIREEEALLNSSMNITKSSAQAGAQAINNQIPPQPPLLHPTHIA 208

Query: 140 RFMQRVAKEQQRRTRQDFSKYPELLSMMSTACETYMRDILTNALVISRHRRRAIKLNAGR 199
            FM++V  EQ     QDFSK  ++LS+MSTACE +M DI+TN+LVISRHRRR+IKLN+GR
Sbjct: 209 SFMKKVGSEQN--FNQDFSKAHDVLSLMSTACEFFMTDIITNSLVISRHRRRSIKLNSGR 266

Query: 200 RSEISMILRNIALXXXXXXXXXXXXXIALGLEKEDLENKIDSEETLHRASNVTAGLR-AG 258
           RSE+S  LR++A+             I++GLEKE  E K++++ETLHRASN TA +  AG
Sbjct: 267 RSEVSRALRDLAIQQKEQEERRVKRRISMGLEKETAEAKMETDETLHRASNATANMMIAG 326

Query: 259 SKKQYGWLTSSVSKPTNTSVKSAGKVASDIAARGETGLKFREAREEPGIVMRDLLYALEN 318
            KK+Y WL +  +K  N SVK  GKV+SD+AARGE G+++REAREEPGIVMRDLL ALEN
Sbjct: 327 GKKKYSWLNAG-AKANNNSVKVLGKVSSDVAARGEIGIRYREAREEPGIVMRDLLNALEN 385

Query: 319 RRNGVHNVISKGYARIRD 336
           RR GV+ VI KGYARIRD
Sbjct: 386 RRVGVNKVIPKGYARIRD 403

>ADL219C [1522] [Homologous to ScYNL039W (BDP1) - SH]
           (317734..319422) [1689 bp, 562 aa]
          Length = 562

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 14  SETNSKKVKTSNEGTNSNVPGGFSDLAL-----PRSSTDLSSK---STVPLALPISKMSK 65
           SE    +  TS EG + + P G  D +L     P S T L+     S +   LP++ MS 
Sbjct: 40  SEPQPTRADTSEEGGDGDEPAGPKDPSLVEDDDPLSHTQLTKDLKASQMSTQLPVATMSP 99

Query: 66  QSKTAGNAS 74
           Q +  G +S
Sbjct: 100 QPEAHGRSS 108

>Kwal_56.24540
          Length = 442

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 27/47 (57%)

Query: 153 TRQDFSKYPELLSMMSTACETYMRDILTNALVISRHRRRAIKLNAGR 199
           TR + S+  ELL +  +  ET++ D++   ++ ++  R A  +N GR
Sbjct: 354 TRINLSRLNELLDLTESETETFISDLVNLGVIYAKINRPAKIVNFGR 400

>YDR175C (RSM24) [1017] chr4 complement(813187..814146) Protein of
           the mitochondrial ribosomal small subunit [960 bp, 319
           aa]
          Length = 319

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 4/63 (6%)

Query: 103 EEEALLNSSIIASKNKINTMDVRIPSHPPFLHPDQVARF----MQRVAKEQQRRTRQDFS 158
           EE++L    I+A     +T D+   S   F H  Q AR+    +QR+  E +  T  DFS
Sbjct: 212 EEKSLHKFRILARSRYDHTTDIFKMSSDKFEHASQNARYLHDILQRLLAESKDLTEDDFS 271

Query: 159 KYP 161
             P
Sbjct: 272 DVP 274

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.125    0.333 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,496,660
Number of extensions: 363211
Number of successful extensions: 1857
Number of sequences better than 10.0: 92
Number of HSP's gapped: 1835
Number of HSP's successfully gapped: 97
Length of query: 336
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 234
Effective length of database: 13,065,073
Effective search space: 3057227082
Effective search space used: 3057227082
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 62 (28.5 bits)