Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_611.164662931150.0
YMR008C (PLB1)66464624650.0
CAGL0J11770g65964123290.0
YOL011W (PLB3)68657322360.0
Sklu_1900.165856922040.0
Scas_685.367758321430.0
Kwal_56.2251064156421370.0
KLLA0C05940g64056821300.0
YMR006C (PLB2)70655821030.0
Scas_644.870458721010.0
CAGL0E02321g70458219400.0
CAGL0J11748g69556518160.0
Scas_92.0d2362238561e-111
Sklu_2442.195844345988e-69
Kwal_0.1735074175753e-66
AAL027W5924165585e-63
YNL012W (SPO1)6316465527e-62
KLLA0F12232g6804134686e-50
Scas_695.105533804424e-47
CAGL0H03575g5144024395e-47
Scas_690.1*63678780.26
Kwal_56.2413946378750.61
YPL217C (BMS1)118378721.4
KLLA0B02068g116778702.5
CAGL0E05874g117078702.6
Sklu_1884.254655692.7
Scas_660.851062674.9
YMR093W (UTP15)51366667.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_611.1
         (646 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_611.1                                                           1204   0.0  
YMR008C (PLB1) [3972] chr13 complement(280590..282584) Phospholi...   954   0.0  
CAGL0J11770g complement(1145135..1147114) highly similar to sp|P...   901   0.0  
YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B (ly...   865   0.0  
Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement        853   0.0  
Scas_685.3                                                            830   0.0  
Kwal_56.22510                                                         827   0.0  
KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromy...   825   0.0  
YMR006C (PLB2) [3971] chr13 complement(277561..279681) Phospholi...   814   0.0  
Scas_644.8                                                            813   0.0  
CAGL0E02321g 222466..224580 some similarities with sp|Q08108 Sac...   751   0.0  
CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674 S...   704   0.0  
Scas_92.0d                                                            334   e-111
Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement     234   8e-69
Kwal_0.173                                                            226   3e-66
AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH] complement(2...   219   5e-63
YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663) Meio...   217   7e-62
KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to ...   184   6e-50
Scas_695.10                                                           174   4e-47
CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces c...   173   5e-47
Scas_690.1*                                                            35   0.26 
Kwal_56.24139                                                          33   0.61 
YPL217C (BMS1) [5232] chr16 complement(139619..143170) Protein i...    32   1.4  
KLLA0B02068g complement(179493..182996) similar to sgd|S0006138 ...    32   2.5  
CAGL0E05874g 580520..584032 highly similar to tr|Q08965 Saccharo...    32   2.6  
Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement         31   2.7  
Scas_660.8                                                             30   4.9  
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    30   7.2  

>Scas_611.1
          Length = 646

 Score = 1204 bits (3115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/629 (94%), Positives = 592/629 (94%)

Query: 18  VGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNF 77
           VGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNF
Sbjct: 18  VGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNF 77

Query: 78  SDTSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQG 137
           SDTSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQG
Sbjct: 78  SDTSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQG 137

Query: 138 ATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNXXXXXXXXXXXXNPGGWNILETGERW 197
           ATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTN            NPGGWNILETGERW
Sbjct: 138 ATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNDDSIWDISHSIINPGGWNILETGERW 197

Query: 198 DHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPF 257
           DHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPF
Sbjct: 198 DHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPF 257

Query: 258 PISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKC 317
           PISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKC
Sbjct: 258 PISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKC 317

Query: 318 IAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYSPNPF 377
           IAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYSPNPF
Sbjct: 318 IAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYSPNPF 377

Query: 378 RDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTNQSW 437
           RDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTNQSW
Sbjct: 378 RDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTNQSW 437

Query: 438 PDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEYIPPL 497
           PDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEYIPPL
Sbjct: 438 PDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEYIPPL 497

Query: 498 VVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCAIMRR 557
           VVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCAIMRR
Sbjct: 498 VVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCAIMRR 557

Query: 558 KQQSMNATLPTECNQCFTNYCWNGTIDNTPAKDXXXXXXXXXXXXXXXXXXXXXXXXXNK 617
           KQQSMNATLPTECNQCFTNYCWNGTIDNTPAKD                         NK
Sbjct: 558 KQQSMNATLPTECNQCFTNYCWNGTIDNTPAKDSTNATTSATGSASIASASSTSSSSTNK 617

Query: 618 KNAGVALNVNDSNIFMFMFSIISVVFSLI 646
           KNAGVALNVNDSNIFMFMFSIISVVFSLI
Sbjct: 618 KNAGVALNVNDSNIFMFMFSIISVVFSLI 646

>YMR008C (PLB1) [3972] chr13 complement(280590..282584)
           Phospholipase B, preferentially deacylates
           phosphatidylcholine and phosphatidylethanolamine [1995
           bp, 664 aa]
          Length = 664

 Score =  954 bits (2465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/646 (72%), Positives = 527/646 (81%), Gaps = 18/646 (2%)

Query: 18  VGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNF 77
           V AWSP+NSYVPANVTCDD+INL+REA+ LSD+E  WL KRDA T EAL SFL R+TSNF
Sbjct: 20  VNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKRDAYTKEALHSFLNRATSNF 79

Query: 78  SDTSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQG 137
           SDTSL+S LF  NSS+ P+I VACSGGGYRAMLSGAGM+AAMDNRTDGANEHGLGGLLQG
Sbjct: 80  SDTSLLSTLFGSNSSNMPKIAVACSGGGYRAMLSGAGMLAAMDNRTDGANEHGLGGLLQG 139

Query: 138 ATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNXXXXXXXXXXXXNPGGWNILETGERW 197
           ATYLAGLSGGNWLTSTL WNNWTSVQAI++N T              P G NI +TG RW
Sbjct: 140 ATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILTPDGINIFKTGSRW 199

Query: 198 DHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPF 257
           D ISD VQ K+DAGFNISLADVWGRAL+YNF+PSL+RGG GYTWSTLR+ADVFKN EMPF
Sbjct: 200 DDISDDVQDKKDAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMPF 259

Query: 258 PISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKC 317
           PI+VADGRYPGTTVINLNAT+FEFNPFEMGSWDPTLN FTDVKYLGTNV+NGKP+ +G+C
Sbjct: 260 PITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQC 319

Query: 318 IAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYSPNPF 377
           IAGFDNTGFIT TSSTLFNQFLL +NST LPSFI  LA+ FL DLS + +DIAIY+PNPF
Sbjct: 320 IAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLATDFLEDLSDNSDDIAIYAPNPF 379

Query: 378 RDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTNQSW 437
           ++A+F+  N + SI++S+ LFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADT+  W
Sbjct: 380 KEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTDDYW 439

Query: 438 PDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEYIPPL 497
           PDGASLVNTY+RQFG QG  ++FPYVPD NTFVNLGLNK+PTFFGCDARNLTDLEYIPPL
Sbjct: 440 PDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDLEYIPPL 499

Query: 498 VVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCAIMRR 557
           +VYIPN+RHSFNGNQSTFKMSYS SER  MI+NGFE+AT GNFTDDSDFLGC+GCAI+RR
Sbjct: 500 IVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSDFLGCVGCAIIRR 559

Query: 558 KQQSMNATLPTECNQCFTNYCWNGTIDNTPAK-------------DXXXXXXXXXXXXXX 604
           KQQ++NATLP+EC+QCFTNYCWNGTID+                                
Sbjct: 560 KQQNLNATLPSECSQCFTNYCWNGTIDSRSVSGVGNDDYSSSASLSASAAAASASASASA 619

Query: 605 XXXXXXXXXXXNKKNAGVALNVNDSNI----FMFMFSIISVVFSLI 646
                      +KKNAG AL VN SN+    F+ + S+IS VF LI
Sbjct: 620 SASASASGSSTHKKNAGNAL-VNYSNLNTNTFIGVLSVISAVFGLI 664

>CAGL0J11770g complement(1145135..1147114) highly similar to
           sp|P39105 Saccharomyces cerevisiae YMR008c PLB1 or
           sp|Q08108 Saccharomyces cerevisiae YOL011w PLB3 or
           sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2, start
           by similarity
          Length = 659

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/641 (67%), Positives = 504/641 (78%), Gaps = 13/641 (2%)

Query: 18  VGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNF 77
           V AWSP+NSYVPANVTC ++INL+R A  LS  E  WL KRD  T EALESFLKR TSNF
Sbjct: 20  VEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKRDVNTREALESFLKRVTSNF 79

Query: 78  SDTS----LISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGG 133
           +  S    LI QLFS NSS+ P+IG+A SGGGYRAMLSGAGMV+AMDNRTDGANEHGLGG
Sbjct: 80  TSNSSASNLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAGMVSAMDNRTDGANEHGLGG 139

Query: 134 LLQGATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNXXXXXXXXXXXXNPGGWNILET 193
           LLQ ATYLAGLSGGNWLT+TL WNNWTSVQ I+++  N            +PGG NI +T
Sbjct: 140 LLQAATYLAGLSGGNWLTTTLSWNNWTSVQDIVDSQDNDSAIWDISHSIVSPGGINIFKT 199

Query: 194 GERWDHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNA 253
           G RWDHISDAV+ KQ AGFN+SLADVWGRALSY FFP+LYRGG  Y WS LR++DVFKNA
Sbjct: 200 GSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVAYLWSDLRESDVFKNA 259

Query: 254 EMPFPISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPIT 313
           EMP PISVADGRYPGT VI+LN+TVFE++PFE+GSWDP+L+ FTDV+YLGT VS+GKP  
Sbjct: 260 EMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSDGKPAE 319

Query: 314 EGKCIAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYS 373
           EGKCIAGFDN GF+ GTSSTLFNQFLL IN TS+P FI  LA+HFL DLS DY+DIA+Y+
Sbjct: 320 EGKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNLATHFLKDLSEDYDDIAVYA 379

Query: 374 PNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADT 433
           PNPFRDAD++ +N SKS+ +S+ LFLVDGGED QN+PLVPL+Q+ER+LD++FALDNSADT
Sbjct: 380 PNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQERDLDIVFALDNSADT 439

Query: 434 NQSWPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEY 493
            ++WPDGASL++TY RQFG QG G+ FP VP  +TFVNLGLNK+PTFFGCDARN+TDLEY
Sbjct: 440 EENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKPTFFGCDARNMTDLEY 499

Query: 494 IPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCA 553
           IPPL+VYIPN+RHS+NGN STFK+SYS  ER  +I+NGFE+AT  N T DS+F GCIGCA
Sbjct: 500 IPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATMNNLTADSNFAGCIGCA 559

Query: 554 IMRRKQQSMNATLPTECNQCFTNYCWNGTIDNTPAK--------DXXXXXXXXXXXXXXX 605
           IMRRKQQ++N TLP EC  CFTNYCWNGTIDNTPAK        D               
Sbjct: 560 IMRRKQQALNLTLPKECETCFTNYCWNGTIDNTPAKGVTASNDFDNASGSAAADMAEQDA 619

Query: 606 XXXXXXXXXXNKKNAGVALNVNDSNIFMFMFSIISVVFSLI 646
                      KKNA V+++VN   +F  + + ++ VF LI
Sbjct: 620 SGAASASSSSRKKNAAVSVDVNAKTLFA-IITAMTAVFQLI 659

>YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B
           (lysophospholipase) [2061 bp, 686 aa]
          Length = 686

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/573 (70%), Positives = 479/573 (83%), Gaps = 2/573 (0%)

Query: 20  AWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNFSD 79
           AWSP++SYVP  V+C D+INL+REA S+S +E +WL KR+ +TS AL+ FL R+T+NFSD
Sbjct: 26  AWSPTDSYVPGTVSCPDDINLVREATSISQNESAWLEKRNKVTSVALKDFLTRATANFSD 85

Query: 80  TS-LISQLFS-GNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQG 137
           +S ++S+LF+ GNS + P+I VA SGGGYR+ML+GAG++AAMDNRT+GA EHGLGGLLQ 
Sbjct: 86  SSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHGLGGLLQS 145

Query: 138 ATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNXXXXXXXXXXXXNPGGWNILETGERW 197
            TYL+G SGGNWL  TL  NNWTSVQ ILNNM N             PGG NI +T +RW
Sbjct: 146 TTYLSGASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDSIVTPGGINIFKTAKRW 205

Query: 198 DHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPF 257
           DHIS+AV++KQ+A +N SLAD+WGRAL+YNFFPSL RGG G TWS++RD  VF+NAEMPF
Sbjct: 206 DHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFPVFQNAEMPF 265

Query: 258 PISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKC 317
           PISVADGRYPGT VINLNATVFEFNPFEMGSWDP+LN+F +VKYLGTNVSNG P+  GKC
Sbjct: 266 PISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLERGKC 325

Query: 318 IAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYSPNPF 377
            AGFDN GFI GTSSTLFNQFLL INST LPSFIT+LA HFL DLS D+NDIA+YSPNPF
Sbjct: 326 TAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHFLKDLSQDFNDIAVYSPNPF 385

Query: 378 RDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTNQSW 437
           +D  F+ S+Y+ SIV S  LFLVDGGED++N+P++PL+QKER++D+IFA+DNSAD   +W
Sbjct: 386 KDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVDIIFAVDNSADMRLAW 445

Query: 438 PDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEYIPPL 497
           PDG+SLV+TYERQF  QG GM+FPYVPD NTFVNLGLNK+PTFFGCDA NLTDL+YIPPL
Sbjct: 446 PDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFFGCDANNLTDLQYIPPL 505

Query: 498 VVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCAIMRR 557
           VVY+PNA +SFN NQS FK+SYS S+R SMIQNGFE ATR NFTDD +F+GC+GCAI+RR
Sbjct: 506 VVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFTDDPEFMGCVGCAIIRR 565

Query: 558 KQQSMNATLPTECNQCFTNYCWNGTIDNTPAKD 590
           KQQ++N TLP EC  CF NYCWNGT+D TP  D
Sbjct: 566 KQQALNITLPPECETCFKNYCWNGTLDTTPLPD 598

>Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement
          Length = 658

 Score =  853 bits (2204), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/569 (71%), Positives = 464/569 (81%), Gaps = 8/569 (1%)

Query: 18  VGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNF 77
           VGAWSP+NSY P NVTCDD+INL+REA  LS DE  WL KR+  T+ ALE FL R+T NF
Sbjct: 14  VGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTNSALEDFLNRATENF 73

Query: 78  SDTSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQG 137
           +D S++  LF  NSSSAPRIGVACSGGGYRAMLSGAGM+AAMDNRT G+ EHGLGGLLQ 
Sbjct: 74  TDNSIVKTLF--NSSSAPRIGVACSGGGYRAMLSGAGMLAAMDNRTRGSVEHGLGGLLQS 131

Query: 138 ATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNXXXXXXXXXXXXNPGGWNILETGERW 197
            TYLAGLSGGNWL  TL WNNWTSVQ IL+ M              +PGG N+LET  RW
Sbjct: 132 TTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQDDDIWDISNSIISPGGTNVLETTSRW 191

Query: 198 DHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPF 257
           D ISDAV AKQDAGFN SL DVWGRALSY+FFP+L  GG  YTWSTLR+ADVFKNAEMPF
Sbjct: 192 DDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLREADVFKNAEMPF 251

Query: 258 PISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKC 317
           PISVADGRYPGT VINLNATVFEFNPFEMGSWD +L  FT+VKYLGT V+NG P T+G+C
Sbjct: 252 PISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPETKGQC 311

Query: 318 IAGFDNTGFITGTSSTLFNQFLLHINST------SLPSFITKLASHFLNDLSADYNDIAI 371
           IAGFDNTGFI GTSS+LFNQF L  NST      SLPS++ K A+ FL  LS DY+DIA+
Sbjct: 312 IAGFDNTGFIMGTSSSLFNQFSLQSNSTLMLLNASLPSYLYKFANKFLTGLSKDYDDIAL 371

Query: 372 YSPNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSA 431
           Y+PNPF+  +++  NY++SIV+S+ L+LVDGGED QNIPL+PLLQ+ERELDVIFALDNSA
Sbjct: 372 YAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERELDVIFALDNSA 431

Query: 432 DTNQSWPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDL 491
           DTNQ WP+G SL  TYERQF  QG+ +AFPYVPD +TFV LGLNKRPTFFGCDA NLTDL
Sbjct: 432 DTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTFFGCDATNLTDL 491

Query: 492 EYIPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIG 551
           +YIPPLVVY+PN + SFN NQSTFK+SYS+  R +MI+NGFE+ TR N TDDSDF+ C+ 
Sbjct: 492 DYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNLTDDSDFVSCVA 551

Query: 552 CAIMRRKQQSMNATLPTECNQCFTNYCWN 580
           CA++RRKQQSMNATLP EC +CFTNYCWN
Sbjct: 552 CAVIRRKQQSMNATLPEECEKCFTNYCWN 580

>Scas_685.3
          Length = 677

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/583 (67%), Positives = 472/583 (80%), Gaps = 24/583 (4%)

Query: 18  VGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNF 77
           V AWSPSN Y PANVTC D++NL+REA+ LS DE+ WL KR+ IT+E+L++FL RST NF
Sbjct: 17  VQAWSPSNGYAPANVTCADDVNLLREASDLSKDEQDWLKKRNTITAESLKTFLDRSTKNF 76

Query: 78  SDTS--LISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLL 135
           SD+S  L+++LF  +  + P+IG+A SGGGYRAML+GAGM+AAMDNRT GAN+HGLGGLL
Sbjct: 77  SDSSSSLLNKLFQ-DGDNVPKIGIAASGGGYRAMLAGAGMLAAMDNRTSGANDHGLGGLL 135

Query: 136 QGATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNXXXXXXXXXXXXNPGGWNI----- 190
           Q +TYLAGLSGGNWLT+TL WNNWTSVQ I++N+T                 W+I     
Sbjct: 136 QSSTYLAGLSGGNWLTTTLAWNNWTSVQDIIDNITVENSI------------WDIDNSLF 183

Query: 191 ----LETGERWDHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRD 246
               +     W  I++ V+AKQDAGFN++LAD+WGRAL+YNFFP LY GG GYTWSTLRD
Sbjct: 184 SISEMANSSIWTDIANDVKAKQDAGFNVTLADLWGRALAYNFFPDLYHGGAGYTWSTLRD 243

Query: 247 ADVFKNAEMPFPISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNV 306
           ++VFKNAEMPFPI+VADGRYPGTTVI+LNATVFEFNPFEMGSWDPTLN+FTDVKYLGTNV
Sbjct: 244 SEVFKNAEMPFPITVADGRYPGTTVISLNATVFEFNPFEMGSWDPTLNSFTDVKYLGTNV 303

Query: 307 SNGKPITEGKCIAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADY 366
           SNGKPI  G+C+AGFDN GF+ GTS+TLFN   L   S+ LP  ++ L  +F   L+  Y
Sbjct: 304 SNGKPIDAGQCVAGFDNAGFVLGTSATLFNLMPLPFTSSMLPKSLSVLGDNFTASLADTY 363

Query: 367 NDIAIYSPNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFA 426
           NDIAIYSPNPFRDAD + SN+SK+IV S DLFLVDGGED + IPLVPLLQ++R LDV+FA
Sbjct: 364 NDIAIYSPNPFRDADSVKSNFSKAIVDSDDLFLVDGGEDGEVIPLVPLLQEKRGLDVVFA 423

Query: 427 LDNSADTNQSWPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDAR 486
           LD ++DT  SWPDG+SLV TY+RQF  QG GM+FPYVPD  TF+  GLN +PTFFGCDA+
Sbjct: 424 LDFNSDTTTSWPDGSSLVATYQRQFEDQGEGMSFPYVPDTETFIKYGLNTKPTFFGCDAK 483

Query: 487 NLTDLEYIPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDF 546
           NLTDLEYIPPL+VYIPN+R+SFN N ST ++SY++S+R  MIQNGFESATRGNFTDD +F
Sbjct: 484 NLTDLEYIPPLIVYIPNSRYSFNSNTSTLQLSYNSSQRLGMIQNGFESATRGNFTDDPEF 543

Query: 547 LGCIGCAIMRRKQQSMNATLPTECNQCFTNYCWNGTIDNTPAK 589
           LGCIGCAIMRRKQQS+N TLP+EC QCFTNYCWNGT+  + AK
Sbjct: 544 LGCIGCAIMRRKQQSLNETLPSECEQCFTNYCWNGTLAGSVAK 586

>Kwal_56.22510
          Length = 641

 Score =  827 bits (2137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/564 (67%), Positives = 456/564 (80%), Gaps = 2/564 (0%)

Query: 18  VGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNF 77
           V AWSP++SYVP NV+C D+INL+R+A+SLS +E  WL KRDA T EAL +FL R+TSNF
Sbjct: 15  VQAWSPTDSYVPGNVSCADDINLVRKASSLSPNETEWLKKRDAYTKEALRTFLDRATSNF 74

Query: 78  SDTSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQG 137
           S++SL+  ++   S   PRI VACSGGGYRAMLSGAGM++AMDNRT+GA EHGLGGLLQ 
Sbjct: 75  SNSSLVDNVW--KSGKIPRIAVACSGGGYRAMLSGAGMLSAMDNRTNGATEHGLGGLLQS 132

Query: 138 ATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNXXXXXXXXXXXXNPGGWNILETGERW 197
            TYLAGLSGGNWL  +L WNNWTSVQ I++                NPGG NIL +  RW
Sbjct: 133 TTYLAGLSGGNWLVGSLAWNNWTSVQHIIDTRGTDDELWDISNSILNPGGVNILTSANRW 192

Query: 198 DHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPF 257
           D ISDAV+AK DAGFN SLADVWGRALSY+FFP+LY+GG GYTWSTLRDADVFKN EMPF
Sbjct: 193 DQISDAVEAKGDAGFNTSLADVWGRALSYDFFPTLYKGGLGYTWSTLRDADVFKNGEMPF 252

Query: 258 PISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKC 317
           PISVADGRYPGT +I+LN+T+FEFNPFEMGSWDP+LN FTDVKYLGT V NG P+T+G+C
Sbjct: 253 PISVADGRYPGTQIIDLNSTLFEFNPFEMGSWDPSLNAFTDVKYLGTEVKNGTPVTQGQC 312

Query: 318 IAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYSPNPF 377
           +AGFDNTGF+ GTSSTLFNQFLL +N+TS+ SF+      FL DLS D NDIAIY+PNPF
Sbjct: 313 VAGFDNTGFVMGTSSTLFNQFLLQLNTTSVSSFLKGFIQDFLQDLSEDSNDIAIYNPNPF 372

Query: 378 RDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTNQSW 437
           RD  ++  NY+  IV S++LFLVDGGED +NIPLVPL+Q++R++DVIFALDNSADT++ W
Sbjct: 373 RDTAYVDKNYTHGIVNSENLFLVDGGEDGENIPLVPLIQQDRDVDVIFALDNSADTDEYW 432

Query: 438 PDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEYIPPL 497
           P G SL++TYERQFG QG  +AFPYVPD +TFVN GLN +P FFGCDA N +DL Y PPL
Sbjct: 433 PAGLSLMHTYERQFGPQGKDIAFPYVPDVDTFVNEGLNTKPVFFGCDATNTSDLAYTPPL 492

Query: 498 VVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCAIMRR 557
           +VY+PN R S+N N STFKMSYS+S+R  M QNGFE+ TR N TDDS+F+GC+ CA++RR
Sbjct: 493 IVYMPNNRQSYNSNTSTFKMSYSSSQRMKMYQNGFEAITRNNLTDDSNFMGCVACAVLRR 552

Query: 558 KQQSMNATLPTECNQCFTNYCWNG 581
           KQ+S N T P EC +CF NYCW+G
Sbjct: 553 KQESQNMTFPEECTKCFQNYCWDG 576

>KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromyces
           lactis phospholipase B, start by similarity
          Length = 640

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/568 (69%), Positives = 453/568 (79%), Gaps = 2/568 (0%)

Query: 18  VGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNF 77
           V AWSP+N Y P  V CD+NINL+R+A+++SDDE  WL  R   T  AL+ FL+R    F
Sbjct: 23  VNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWLKVRHESTVPALKDFLQRGFKGF 82

Query: 78  S-DTSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQ 136
           + DTS+I +L +    +AP++ +ACSGGGYRAMLSGAGM++AMDNRTDGAN+HGLGGLLQ
Sbjct: 83  TNDTSIIDKLLA-TQDTAPKVAIACSGGGYRAMLSGAGMISAMDNRTDGANDHGLGGLLQ 141

Query: 137 GATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNXXXXXXXXXXXXNPGGWNILETGER 196
            +TYLAGLSGGNWL  TL +NNWTSVQAI+NNMT+            NPGG NI  +  R
Sbjct: 142 SSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNSIVNPGGINIFSSISR 201

Query: 197 WDHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMP 256
           WD ISDAV+ K+ AGFN S+ DVWGRALSYNFFPSL  GG GYTW+TLRD DVFKN EMP
Sbjct: 202 WDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNGEMP 261

Query: 257 FPISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGK 316
           FPISVA GRYPGT V+NLNATVFEFNPFEMGSWD TL+TFTDV+Y GTNV+NG P   GK
Sbjct: 262 FPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAGTNVTNGTPNVTGK 321

Query: 317 CIAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYSPNP 376
           C+AGFDNTGF+ GTSS+LFNQFLL +N+T LPSF+  L   FL D S DY+DI+I++PNP
Sbjct: 322 CVAGFDNTGFVMGTSSSLFNQFLLQLNTTDLPSFLYNLLHGFLTDASDDYDDISIWAPNP 381

Query: 377 FRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTNQS 436
           F +   I SNYS+SI +   L+LVDGGED QNIPL PLLQ ERE+DVIFALDNSADT+QS
Sbjct: 382 FYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDVIFALDNSADTDQS 441

Query: 437 WPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEYIPP 496
           WPDG SL  TY RQFG+QG G+AFPYVPD NTF NLGLN RPTFFGCDARNLTDLE IPP
Sbjct: 442 WPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGCDARNLTDLESIPP 501

Query: 497 LVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCAIMR 556
           LVVY+PN R SFN N STFKMSYSTSERF MIQNGFE+ T  N T D +F+GCI CAI+R
Sbjct: 502 LVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKDENFMGCISCAILR 561

Query: 557 RKQQSMNATLPTECNQCFTNYCWNGTID 584
           RKQ+S+N TLP+EC+ CF  YCWNGT+D
Sbjct: 562 RKQESLNYTLPSECDACFEKYCWNGTVD 589

>YMR006C (PLB2) [3971] chr13 complement(277561..279681)
           Phospholipase B2 (lysophospholipase), releases fatty
           acids from lysophospholipids [2121 bp, 706 aa]
          Length = 706

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/558 (67%), Positives = 452/558 (81%), Gaps = 1/558 (0%)

Query: 27  YVPANVTC-DDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNFSDTSLISQ 85
           Y P+ + C  D+ +L+R A+ LS  E  WL KRDA T EAL SFL R+TSNFSDTSL+S 
Sbjct: 30  YAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLSRATSNFSDTSLLST 89

Query: 86  LFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQGATYLAGLS 145
           LFS NSS+ P+IG+ACSGGGYRAML GAGM+AAMDNRTDGANEHGLGGLLQ +TYL+GLS
Sbjct: 90  LFSSNSSNVPKIGIACSGGGYRAMLGGAGMIAAMDNRTDGANEHGLGGLLQSSTYLSGLS 149

Query: 146 GGNWLTSTLGWNNWTSVQAILNNMTNXXXXXXXXXXXXNPGGWNILETGERWDHISDAVQ 205
           GGNWLT TL WNNWTSVQ I+++M+             NPGG N+  T ERW+ I   VQ
Sbjct: 150 GGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNLTYTIERWESIVQEVQ 209

Query: 206 AKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPFPISVADGR 265
           AK DAGFNISL+D+W RALSYNFFPSL   G   TWS+LRD DVFKN EMP PI+VADGR
Sbjct: 210 AKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITVADGR 269

Query: 266 YPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKCIAGFDNTG 325
           YPGTTVINLNAT+FEF PFEMGSWDP+LN FTDVKYLGTNV+NGKP+ + +C++G+DN G
Sbjct: 270 YPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSGYDNAG 329

Query: 326 FITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYSPNPFRDADFIAS 385
           F+  TS++LFN+F L  ++++    I   A+ ++N+LS D +DIAIY+ NPF+D +F+  
Sbjct: 330 FVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDDDDIAIYAANPFKDTEFVDR 389

Query: 386 NYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTNQSWPDGASLVN 445
           NY+ SIV + DLFLVDGGED QN+PLVPL++KER+LDV+FALD S +T++SWP G  + N
Sbjct: 390 NYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALDISDNTDESWPSGVCMTN 449

Query: 446 TYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEYIPPLVVYIPNAR 505
           TYERQ+  QG GMAFPYVPD NTF+NLGL  +PTFFGCDA+NLTDLEYIPPLVVYIPN +
Sbjct: 450 TYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNLTDLEYIPPLVVYIPNTK 509

Query: 506 HSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCAIMRRKQQSMNAT 565
           HSFNGNQST KM+Y+ +ER  MI+NGFE+AT GNFTDDS+FLGCIGCAI+RRKQ+S+NAT
Sbjct: 510 HSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCIGCAIIRRKQESLNAT 569

Query: 566 LPTECNQCFTNYCWNGTI 583
           LP EC +CF +YCWNGT+
Sbjct: 570 LPPECTKCFADYCWNGTL 587

>Scas_644.8
          Length = 704

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/587 (65%), Positives = 462/587 (78%), Gaps = 16/587 (2%)

Query: 20  AWSPSNSYVPANVTC--------DDNINLIREANSLSDDEKSWLTKRDAITSEALESFLK 71
           AW+PSNSY P+ + C        +++ +LIREA+S+S +E  WL KR   T E L  FL 
Sbjct: 22  AWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWLQKRMQNTREPLLQFLN 81

Query: 72  RSTSN------FSDTSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDG 125
           RS ++      F   +L+S L   +S+S P+IG+A SGGGYR+ML+GAG++AAMDNRT G
Sbjct: 82  RSLTSLNTSSSFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTGAGILAAMDNRTRG 141

Query: 126 ANEHGLGGLLQGATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNXXXXXXXXXXXXNP 185
           A  HGLGGLLQ  TYL+G SGGNWL  TL +NNWTSVQ+I++N               +P
Sbjct: 142 AQHHGLGGLLQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDNFNESDSIWDLSESIVSP 201

Query: 186 GGWNILETGERWDHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLR 245
           GG NI ++  RWDHISDA+Q KQ AGF+ SLADVWGRALSY FFPSLYRGG  YTWS+LR
Sbjct: 202 GGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSLYRGGVAYTWSSLR 261

Query: 246 DADVFKNAEMPFPISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTN 305
           D+ VF   +MPFPISVADGRYPG+ V+NLNATVFEFNPFEMGSWDP+LNTFTDVK+LGTN
Sbjct: 262 DSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTN 321

Query: 306 VSNGKPITEGKCIAGFDNTGFITGTSSTLFNQFLLHINSTS--LPSFITKLASHFLNDLS 363
           VS GKPI   +C+ GFDNT FI GTSSTLFNQFLL INST+  LP FITKLA+HFL D+S
Sbjct: 322 VSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLHLPGFITKLATHFLKDIS 381

Query: 364 ADYNDIAIYSPNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDV 423
            D+ND+A Y PNPF+DA+FI +NY+KSIV SK L+LVDGGED++NIPL+PL+Q+ER+LD+
Sbjct: 382 QDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLIQRERDLDI 441

Query: 424 IFALDNSADTNQSWPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGC 483
           +FA+DNS D   +WPDG+SLV+T+ERQF  QG GMAFPYVP  +TFVNLGLN++PTFFGC
Sbjct: 442 VFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFVNLGLNQKPTFFGC 501

Query: 484 DARNLTDLEYIPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDD 543
           DA NLTDLEYIPPLV+Y+PN ++SF  NQS FK+SY+  +R +MI NGFE ATR NFTDD
Sbjct: 502 DAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISNGFEIATRNNFTDD 561

Query: 544 SDFLGCIGCAIMRRKQQSMNATLPTECNQCFTNYCWNGTIDNTPAKD 590
            DFLGCIGCAI+RRKQQS+N TLP  CN CFTNYCWNGT+D TP  D
Sbjct: 562 PDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGTLDTTPLPD 608

>CAGL0E02321g 222466..224580 some similarities with sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3 phospholipase B,
           hypothetical start
          Length = 704

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/582 (59%), Positives = 448/582 (76%), Gaps = 17/582 (2%)

Query: 21  WSPSNSYVPANVTC-DDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNFSD 79
           +S ++ Y P    C  D+INL+REA+ LS +E  WL +RD  T EAL +FL+R+TS+  +
Sbjct: 20  YSVADQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSSQN 79

Query: 80  -TSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQGA 138
            T L  ++F  ++   PRIG+A SGGGYR+ML+GAG+++A DNRT GA +HGLGG+LQ  
Sbjct: 80  FTQLFHRIF--DAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQST 137

Query: 139 TYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNXXXXXXXXXXXXNP-----------GG 187
           TY+ G SGGNWL ++L WNNWTSVQ IL+   +            +P           GG
Sbjct: 138 TYMTGCSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPGG 197

Query: 188 WNILETGERWDHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDA 247
            NI++T  RWDHI++AV+AKQ+AGFN SLADVWGRALSY FFP+L RGG  YTWS+LRD+
Sbjct: 198 LNIIKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDS 257

Query: 248 DVFKNAEMPFPISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVS 307
            +F+  +MP PI+VADGRYPG+  I LNATVFEFNPFEMGSWDP+LN FTDVKYLGTNV+
Sbjct: 258 PIFQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVT 317

Query: 308 NGKPI--TEGKCIAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSAD 365
           NGKP+  T  KCI GFDNT FI GTSS LFNQFLL INST LP+F+TK A++ L   + +
Sbjct: 318 NGKPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHE 377

Query: 366 YNDIAIYSPNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIF 425
           +ND+A+Y+PNPF+D  ++  N+S SIV S+ L+LVDGGED++N+PL+PLLQ++R+LD+IF
Sbjct: 378 FNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIF 437

Query: 426 ALDNSADTNQSWPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDA 485
           A+DNSAD    WPDG+SLV+TYERQF +QG  +AFP++PD NTF+NLGLNKRPTFFGC+A
Sbjct: 438 AIDNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNA 497

Query: 486 RNLTDLEYIPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSD 545
            N+T L+YIPPLVVY PN+ +SFN NQS FK+SYS  +  +MI NGFE ATR NFTDD +
Sbjct: 498 TNMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPE 557

Query: 546 FLGCIGCAIMRRKQQSMNATLPTECNQCFTNYCWNGTIDNTP 587
           F+GCI CAIM+RKQ++++  LP+EC +C   YCW+GT+D+TP
Sbjct: 558 FIGCIACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTP 599

>CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674
           Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105
           Saccharomyces cerevisiae YMR008c PLB1 or sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3, start by
           similarity
          Length = 695

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/565 (59%), Positives = 423/565 (74%), Gaps = 4/565 (0%)

Query: 26  SYVPANVTCDDNINLIR-EANSLSDDEKSWLTKRDAITSEALESFLKRSTSNFSDTSLIS 84
           SY P NV+C DN N IR  A+ LS  EK WL KRD IT +AL++FL+R+ +N S T + S
Sbjct: 21  SYTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVS-TEITS 79

Query: 85  QLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQGATYLAGL 144
            LF+ ++ + P++G+A +GGGYRAM  GAG  AAMDNRTDGANEHGLGGLLQ ATY+AGL
Sbjct: 80  ALFN-DTENVPKLGIAVAGGGYRAMFVGAGAFAAMDNRTDGANEHGLGGLLQAATYMAGL 138

Query: 145 SGGNWLTSTLGWNNWTSVQAILNNMTNXXXXXXXXXXXXNPGGWNILETGERWDHISDAV 204
           SGGNWLT TL +NN+TSVQ IL                 NP   +  +T  RW  I   V
Sbjct: 139 SGGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQV 198

Query: 205 QAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPFPISVADG 264
           Q K+DAGFN+++ D+W RAL+Y +FP+L   G G TWS+LRD ++F N EMP PISVADG
Sbjct: 199 QGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADG 258

Query: 265 RYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKCIAGFDNT 324
           RYPGTTVINLNATVFE  PFE+GSWDP+LN F+D+KYLGT V++GKP TE +CI GFD+ 
Sbjct: 259 RYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKPETE-RCINGFDDA 317

Query: 325 GFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYSPNPFRDADFIA 384
            FI GTSS+LFN+F +  +S    +++  L+S  +  +  + NDIA+Y+PNPF+ + ++ 
Sbjct: 318 SFIMGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVD 377

Query: 385 SNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTNQSWPDGASLV 444
           SNY+ SIV S  LFLVDGGED Q IP VPLL++ER+LD+IFA+D   +T+ ++P G  ++
Sbjct: 378 SNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMM 437

Query: 445 NTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEYIPPLVVYIPNA 504
            TYERQF  QG GMAFPYVPD  TFVNLGL  +P+F+GCDA NLTDLEYIPPL+VYIPN+
Sbjct: 438 KTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNS 497

Query: 505 RHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCAIMRRKQQSMNA 564
            HSF  N STFK++Y+ SER  MI+N FE+ TR N T+D+D++ C+GCAI+RRKQQS+N 
Sbjct: 498 YHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNL 557

Query: 565 TLPTECNQCFTNYCWNGTIDNTPAK 589
           TLP  C++CFTNYCWNGTIDNTP K
Sbjct: 558 TLPDICDKCFTNYCWNGTIDNTPTK 582

>Scas_92.0d
          Length = 236

 Score =  334 bits (856), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/223 (72%), Positives = 186/223 (83%), Gaps = 1/223 (0%)

Query: 219 VWGRALSYNFFPSL-YRGGQGYTWSTLRDADVFKNAEMPFPISVADGRYPGTTVINLNAT 277
           ++G  L    F  L   GG  YTWSTLR+ADVFKNAEMPFPISVADGRYPGT VINLNAT
Sbjct: 2   MFGAVLYRMIFSQLCLNGGDAYTWSTLREADVFKNAEMPFPISVADGRYPGTQVINLNAT 61

Query: 278 VFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKCIAGFDNTGFITGTSSTLFNQ 337
           VFEFNPFEMGSWD +L  FT+VKYLGT V+NG P T+G+CIAGFDNTGFI GTSS+LFNQ
Sbjct: 62  VFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPETKGQCIAGFDNTGFIMGTSSSLFNQ 121

Query: 338 FLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYSPNPFRDADFIASNYSKSIVQSKDL 397
           FLL +N+T LPSFI KLA+ FL  LS DY+DIA+Y+PNPF+    +  NY++SIV+S+ L
Sbjct: 122 FLLQLNTTGLPSFIYKLANKFLTGLSDDYDDIALYAPNPFKGTGHVVENYTRSIVESEIL 181

Query: 398 FLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTNQSWPDG 440
           +LVDGGED QNIPLVPLLQ+ERELDVIFALDNSADTNQ WP+G
Sbjct: 182 YLVDGGEDGQNIPLVPLLQEERELDVIFALDNSADTNQYWPNG 224

>Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement
          Length = 584

 Score =  234 bits (598), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 148/434 (34%), Positives = 228/434 (52%), Gaps = 59/434 (13%)

Query: 189 NILETGERWDHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDAD 248
           N  +T E + ++   V+ K+  GF++S  D WGRAL       L           L +  
Sbjct: 168 NFRQTLEFYINLHFEVRPKKIKGFHLSFTDYWGRALMKKMSSHLSNSQSMSMSMLLENCR 227

Query: 249 VFKNAEMPFPISVADGR-YPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVS 307
            FK  ++PFPI V++ +  P  TV      VFEF PFE GSWD  LN F  +KYLG+ + 
Sbjct: 228 NFKEFKVPFPIIVSNCKNSPSKTV------VFEFTPFEFGSWDEYLNEFIKLKYLGSKIV 281

Query: 308 NGKPITEGKCIAGFDNTGFITGTSSTLFNQFLLHI-----NST-----SLPSFITKLASH 357
           +GK     +C  GFD+ GFI+ TSS++FN  L+++     NS+     ++ + ++     
Sbjct: 282 SGKTF---RCFNGFDDIGFISATSSSIFNNVLVYVWQMAANSSKETLKAIRAIMSTFGLR 338

Query: 358 FLNDLSAD--------YNDIAIYSPNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNI 409
            + D+ A           D A+Y PNPF    +     +  + +   L+LVDGGE+ +NI
Sbjct: 339 LVKDMGAKDVPNNPLTRPDYALYRPNPF----YKLLTVNNELTKENHLYLVDGGENGENI 394

Query: 410 PLVPLLQKERELDVIFALDNSADTNQSWPDGASLVNTYER-----------QFGMQGNGM 458
           P+ PLL  +R+LDVIFALD+S+D+N ++P+G  L N Y             + G+  N  
Sbjct: 395 PIRPLLLPQRKLDVIFALDSSSDSN-NYPNGTILRNLYNNFHNGQESLNITREGITSNID 453

Query: 459 AFPYVPDKNTFVNLGLNKRPTFFGCD----------ARNLTDLEYIPPLVVYIPNARHSF 508
             PY+P+  +FV   L  RP  FGC               T+   +PP+V+Y  N  HS+
Sbjct: 454 LLPYIPNSKSFVEQQLFSRPVAFGCHLSSYHVREQYVNKTTESTNLPPIVIYYANYHHSY 513

Query: 509 NGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCAIMRRK--QQSMNATL 566
           + N STFK SY++SE   M++NG +      F  ++ +  C+GC I++R+  ++   A L
Sbjct: 514 SSNTSTFKQSYNSSEIEGMLRNGQDIF---GFDANNTYHKCLGCIIIKREYDRRQTTAEL 570

Query: 567 PTECNQCFTNYCWN 580
           P  C+QC+ +YC+N
Sbjct: 571 PEFCHQCYQDYCFN 584

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 12/58 (20%)

Query: 109 MLSGAGMVAAMDNRTDGANEHGLGGLLQGATYLAGLSGGNWLTSTLGWN--NWTSVQA 164
           ML+G+G +  M+            GLL    Y++GLSGG+W+ ++L  +  N+ S+Q 
Sbjct: 1   MLTGSGFITKMEEY----------GLLDCLAYISGLSGGSWILTSLILHDFNFKSLQK 48

>Kwal_0.173
          Length = 507

 Score =  226 bits (575), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 150/417 (35%), Positives = 209/417 (50%), Gaps = 62/417 (14%)

Query: 204 VQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRD-ADVFKNAEMPFPISVA 262
           V++K+ +GF IS  D WG AL  +  P+   G    + S   D +  F+  E+P PI VA
Sbjct: 113 VKSKKLSGFPISFTDYWGEALVTSIAPTHTTG----SISAFADKSQRFQRYEVPLPIFVA 168

Query: 263 DGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKCIAGFD 322
           + +       NL   VFEF PFE GSW   +  F  ++YLG+ ++ G P    KCI GFD
Sbjct: 169 NCKND-----NLRNAVFEFTPFEFGSWT-NMRLFIPLRYLGSQITAGTP---QKCIIGFD 219

Query: 323 NTGFITGTSSTLFNQFLLHINSTSLPSFITK-----------LASHFLNDLSA------D 365
             GF+T TSS+LFN  L+++     PS  T+           L  H    +S        
Sbjct: 220 EVGFVTATSSSLFNSVLMYVWHLVAPSLDTRKAVRAIFSTFGLGIHKTTTVSKGEANIMS 279

Query: 366 YNDIAIYSPNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIF 425
           + + AIY PNPF    +     S  + +   L+LVDGGED +NIP+ PLL  ER+LDVIF
Sbjct: 280 HPEYAIYQPNPF----YKHPATSDVLAKHNQLYLVDGGEDGENIPIGPLLIPERKLDVIF 335

Query: 426 ALDNSADTNQSWPDGASLVNTYERQFGMQGNGMAFPY-----VPDKNTFVNLGLNKRPTF 480
           ALD+S+D   S+P+G  L N Y+  +G   +    PY     +P    FV   L  RP  
Sbjct: 336 ALDSSSDVC-SFPNGTMLWNFYQNNYGHSSSKSNTPYQLLPLIPSSEEFVARRLLSRPVA 394

Query: 481 FGCD------------ARNLTDLEYIPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSMI 528
           FGC              RN + LE +PP+++Y  NA HSF  N STFK+ YS  E   M+
Sbjct: 395 FGCHMESYPTLNSTNWVRNSSHLE-LPPILIYHANANHSFASNLSTFKLKYSKIEVEQML 453

Query: 529 QNGFESATRGNFTDDSDFLGCIGCAIMRRKQQS-----MNATLPTECNQCFTNYCWN 580
           +NG    +   F D   +  C+ C +++R             LP  C+ CF+ YC+N
Sbjct: 454 RNGKHIFS---FDDRPKYKRCLACLLVKRNYDRSIILGEEVRLPFFCDVCFSEYCYN 507

>AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH]
           complement(295617..297395) [1779 bp, 592 aa]
          Length = 592

 Score =  219 bits (558), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 145/416 (34%), Positives = 208/416 (50%), Gaps = 53/416 (12%)

Query: 200 ISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPFPI 259
           +   V+ K+  GF +S  D WGRAL    +  +              +++  N E P PI
Sbjct: 195 LHSEVRPKKIMGFPVSFTDYWGRALWKKIY--VNESMISSMSELFARSEITNNYEAPLPI 252

Query: 260 SVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKCIA 319
            +A+ +     ++N    VFEF PFE GSW+  L  F ++KYLG+N + G       C+ 
Sbjct: 253 IIANCK--NEDLVN---AVFEFTPFEFGSWNRLLGLFVNLKYLGSNFTEG---VAQSCVQ 304

Query: 320 GFDNTGFITGTSSTLFNQFLLHI----NSTSLPSF--ITKLASHFLNDLSADYN------ 367
           GFD+ GFIT TSS+LFN  L++     + +SL +   I  L S F  +L    N      
Sbjct: 305 GFDDIGFITATSSSLFNNVLIYAWKLASESSLKTMKAIRALFSTFGVNLKNKPNSFFGTR 364

Query: 368 -DIAIYSPNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFA 426
            D A++ PNPF     + S     +  S  L+LVDGGED +NIPL P LQ ER++D+IFA
Sbjct: 365 SDFALFQPNPFYRYPGVDS----PLTNSDKLYLVDGGEDGENIPLRPFLQPERQVDLIFA 420

Query: 427 LDNSADTNQSWPDGASLVNTYERQFGMQGNGMA------------FPYVPDKNTFVNLGL 474
           LD+S+    ++P G  L N Y+      G                 PY+P    F   GL
Sbjct: 421 LDSSSG-RINYPTGGILRNLYDNLHATDGAAAVVQTGDVQSVTDLLPYIPSAEEFEAKGL 479

Query: 475 NKRPTFFGC-----DARNLTDLE---YIPPLVVYIPNARHSFNGNQSTFKMSYSTSERFS 526
            KRP  FGC       RN +       +PP+V Y  N   ++N N STFK+ Y+ SE   
Sbjct: 480 LKRPVAFGCYPESYHIRNASATAAPGKLPPIVFYHANRNSTYNSNTSTFKLRYNHSEVQG 539

Query: 527 MIQNGFESATRGNFTDDSDFLGCIGCAIMRRKQQSMNAT--LPTECNQCFTNYCWN 580
           M++NG    T  N   ++ +  C+GC +++R   ++NA+  LP  C QCF  YC+N
Sbjct: 540 MLENGASLFTHDN---NTAYFQCVGCLVVKRAYDNVNASAKLPPTCQQCFRRYCYN 592

>YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663)
           Meiosis-specific protein with similarity to
           phospholipase B enzymes [1896 bp, 631 aa]
          Length = 631

 Score =  217 bits (552), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 180/646 (27%), Positives = 285/646 (44%), Gaps = 128/646 (19%)

Query: 29  PANVTCDDNINLIREA-NSLSDDEKSWLTKRDAITSEALESFLKRSTSNFSDTSLISQLF 87
           P  V C  +  LIREA + L  +E  +L K+   T   L  FLK    + ++    S+ +
Sbjct: 20  PFQVQCPSS-PLIREAKHELCPEETLYLKKKKIKTKNKLIQFLK----SLTEAKFSSKFY 74

Query: 88  SGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQGATYLAGL--- 144
                  P+IG+A SGGGYR+ML G G ++ M++         + GL  G+  L  L   
Sbjct: 75  KRVLKDPPKIGIAISGGGYRSMLVGTGFISQMNDYGLFEYSDYIAGLSGGSWILMDLVVQ 134

Query: 145 -------------------------------------------------SGGNWLTSTLG 155
                                                             GG+ +TS+  
Sbjct: 135 NFEVKSLLQEWDLEEDLLLGIPEFDISEEEIVTNAKKEYNDNDLKMKKRQGGSLITSS-- 192

Query: 156 WNNWTSVQAILNNMTNXXXXXXXXXXXXNP---------------GGWNILETGER---- 196
            N +  ++ I+N++              NP               G    +ET ++    
Sbjct: 193 SNFYEQIEEIMNSIEEIPEDYMITKRNLNPLARLKKIFFPNNTFTGTDAKIETFKKVLDF 252

Query: 197 WDHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRG-GQGYTWSTLRDA-DVFKNAE 254
           +  +   ++ K+  GF IS  D WG+A+      +        +++S L ++   FK   
Sbjct: 253 YKSLHLKIKPKKMEGFQISFTDYWGKAIVQRLKKNFDDDPNHSFSFSKLVNSSKKFKECS 312

Query: 255 MPFPISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITE 314
           +P PI VA+ +  G     L+  +FEF PFE GSW+  L  F  + YLG+ + +GK    
Sbjct: 313 VPIPIFVANCK-NGL----LSNVIFEFTPFEFGSWENILRLFVKLPYLGSKIVSGKA--- 364

Query: 315 GKCIAGFDNTGFITGTSSTLFNQFLLHI------------NSTSLPSFITKLASHFLNDL 362
            KCI  FD+ GFIT TSS++FN  L+ I             + ++   I  L    +  +
Sbjct: 365 EKCINNFDDLGFITATSSSIFNNVLIFIWNLASQSSREAMKALNMVMGIFGLGKEEIFSI 424

Query: 363 SADYN----DIAIYSPNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKE 418
           S D +    D A+Y PNPF    ++       +     L+LVDGGED +NIPL  L+  E
Sbjct: 425 SKDSSRLETDYAVYQPNPF----YLYPEKDNVLTNKNHLYLVDGGEDGENIPLRTLVIPE 480

Query: 419 RELDVIFALDNSADTNQSWPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRP 478
           RELDVIF LD+S+D + ++P+G+ L   +E+   +    + + +  +  TF +      P
Sbjct: 481 RELDVIFVLDSSSDID-NYPNGSKLKRIFEK---LDEENVHYQFPNNVKTFTH------P 530

Query: 479 TFFGCDARNLTDLEYIPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRG 538
              GC+A   T  +   P+++Y  NA H    N STFK++Y+ SE  SM+  G     RG
Sbjct: 531 IVIGCNATKRTGHDSFLPIIIYHANANHGNASNTSTFKITYNQSEVSSMLPTG-----RG 585

Query: 539 NFTDDSD--FLGCIGCAIMRRKQQSM--NATLPTECNQCFTNYCWN 580
            F++D D  +  C+GC + +R    +         C QCF +YC++
Sbjct: 586 VFSNDYDLYYKNCLGCILTKRTMDRLPRKKKFSPFCLQCFKDYCYS 631

>KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to
           sp|P53541 Saccharomyces cerevisiae YNL012w SPO1
           transcriptional regulator involved in sporulation, start
           by similarity
          Length = 680

 Score =  184 bits (468), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 135/413 (32%), Positives = 198/413 (47%), Gaps = 55/413 (13%)

Query: 204 VQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPFPISVAD 263
           V+ K++AGF ISL D  G+AL  +  P+  +       S    ++ FK  + P P+ VA+
Sbjct: 287 VRQKKEAGFPISLTDYLGQAL-LDRLPA-QKQDHLKQLSNFVQSESFKKFDAPIPVFVAN 344

Query: 264 GRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKCIAGFDN 323
            +        L+  VFEF PFE GSW   ++ F   KYLG+    GK     KC+ GFDN
Sbjct: 345 AKTSKGP--ELHNVVFEFTPFEFGSWHLNVSKFISTKYLGSTALKGKLT---KCVNGFDN 399

Query: 324 TGFITGTSSTLFNQFLLHI--------NSTSLPSFITKLASHFLNDLSADYNDIAIYSPN 375
            GFIT TSS+LFN  L +I         S      I  +   F    +A  +D AIY PN
Sbjct: 400 LGFITATSSSLFNNALFYIWKTVTTNIESNEKLKAIKTIFGVFGVGFNAIRSDYAIYQPN 459

Query: 376 PF-RDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTN 434
           PF +D + +       I  +  LFLVDGGED +NIPL  L    R+ DVIF +D+S+D  
Sbjct: 460 PFYKDPEVL-----NLISDTSQLFLVDGGEDGENIPLRSLFISGRQNDVIFIVDSSSD-K 513

Query: 435 QSWPDGASLVNTYERQFGMQGNGMA------------FPYVPDKNTFV--NLGLNKRPTF 480
           ++ PD   L +TY+    ++                  PY+P     +  N  L+  P  
Sbjct: 514 ENLPDMTKLRDTYDDIIHVEEQKRIVALKNEIWEMDLMPYIPTSEELLAANFSLST-PIA 572

Query: 481 FGC-----DARNLTDL--------EYIPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSM 527
           FGC     + + LTD           +PP+++Y  N   +F  N STFK++Y+  E   M
Sbjct: 573 FGCHLQSYNTKRLTDTLITKETSSASLPPILIYHGNIPITFQSNTSTFKLNYTKDEYNGM 632

Query: 528 IQNGFESATRGNFTDDSDFLGCIGCAIMRRKQQSMNATLPTECNQCFTNYCWN 580
           + NG       N     ++L C+GC ++ R+ Q + ++    C+ C    C+N
Sbjct: 633 LNNGHH--LFNNDDTQGEYLQCLGCVMLLRQNQELVSSF---CDACIRKVCYN 680

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 60/124 (48%), Gaps = 20/124 (16%)

Query: 27  YVPANVTCDDNINLIREANS-LSDDEKSWLTKRDAITSEALESFLKRSTSNFSDTSLISQ 85
           Y P NV C  +++L    N  LS  E  +L+KR  +     E F       + D ++   
Sbjct: 21  YAPVNVDCPKDLSLRAAKNEKLSALEFDYLSKRTEVIKGKFEKF-------YEDLAIPG- 72

Query: 86  LFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQGATYLAGLS 145
             + +S   PRI VA SGGG+R+ML  +G V  M             GL +  +Y+AG+S
Sbjct: 73  -INVDSLQFPRIAVAISGGGFRSMLISSGFVLGMQQH----------GLWECTSYVAGIS 121

Query: 146 GGNW 149
           GG+W
Sbjct: 122 GGSW 125

>Scas_695.10
          Length = 553

 Score =  174 bits (442), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 126/380 (33%), Positives = 186/380 (48%), Gaps = 59/380 (15%)

Query: 204 VQAKQDAGFNISLADVWGRALSY---NFFPSLYRGGQGYTWSTLRDADV-FKNAEMPFPI 259
           V+ K+  GF +S  D WG AL     N            ++S L ++++ F   E P PI
Sbjct: 184 VRTKKIQGFFVSFTDYWGEALLKRLNNKDKKFSAFANTVSFSKLIESNLKFSKFEAPIPI 243

Query: 260 SVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKCIA 319
            VA+ R        L   +FEF+PFE GSW+  L  F  + YLG+ + NG   T   C  
Sbjct: 244 FVANNRNG-----RLKNVIFEFSPFEFGSWEKMLRLFVKLPYLGSKIVNG---TAKICYK 295

Query: 320 GFDNTGFITGTSSTLFNQFLLHI----NSTSLPSFITKLASHFL---------------- 359
            FD+ GFIT TSS++FN  L+ I    + +SL +  +  A   L                
Sbjct: 296 EFDDIGFITATSSSIFNNVLIFIWQKMSRSSLEAMKSVKAVMGLFGLIGTKDSTKPLTLS 355

Query: 360 NDLSADYNDIAIYSPNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKER 419
           N   A   D A+Y  NPF    F   N   ++ +   L+LVDGGED +NIPL  L+  ER
Sbjct: 356 NTAIAPETDYAVYYHNPF----FRYPNIDNALTKDDHLYLVDGGEDGENIPLRSLIIPER 411

Query: 420 ELDVIFALDNSADTNQSWPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPT 479
           ++DVIFA+D+S+D N ++ +G  L+ T  R     G     P +  K           P 
Sbjct: 412 KVDVIFAIDSSSDVN-NYANGTKLI-TILRHLEKLGYHYKIPKISKKRI-------NHPL 462

Query: 480 FFGCDARNLTDLEYIPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGN 539
            FGC+A +L       P+++Y  N  HS+  N STFK++Y+ +E  +M+QNG +      
Sbjct: 463 IFGCNAPSL-------PIIIYHANTEHSYPSNTSTFKVTYNETEVGAMLQNGMDI----- 510

Query: 540 FTDDSD--FLGCIGCAIMRR 557
           F D+ +  +  C+GC + +R
Sbjct: 511 FNDNENIYYQNCLGCILSKR 530

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 43/76 (56%), Gaps = 10/76 (13%)

Query: 92  SSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQGATYLAGLSGGNWLT 151
           S+ P IGVA SGGGYR+ML+G G +  M  +          GL    +YL+GLSGG+W+ 
Sbjct: 6   SNPPNIGVALSGGGYRSMLTGTGFILGMQEK----------GLWDCVSYLSGLSGGSWVL 55

Query: 152 STLGWNNWTSVQAILN 167
             L  NN+   + I N
Sbjct: 56  MDLIVNNFNITKMINN 71

>CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces
           cerevisiae YNL012w SPO1, start by similarity
          Length = 514

 Score =  173 bits (439), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 124/402 (30%), Positives = 201/402 (50%), Gaps = 59/402 (14%)

Query: 204 VQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGY-TWS-TLRDADVFKNAEMPFPISV 261
           +++K+  GF IS  D W +AL  N     YR    + T+S ++R ++ FKN  +P PI V
Sbjct: 143 IRSKRINGFPISFTDYWAQALVQNI---KYRQLPTHLTYSKSVRTSNYFKNYLVPIPIIV 199

Query: 262 ADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKCIAGF 321
           A+ R        L   +FEF P+E GSW+  L  F +++YLG+ + NG      +C  G 
Sbjct: 200 ANCRNGF-----LKNVIFEFTPWEFGSWEQVLGLFVNIEYLGSRIING---VSHQCYKGL 251

Query: 322 DNTGFITGTSSTLFNQFLLHI-------NSTSLPSFITKLA----------------SHF 358
           D+ GFI  TSS++FN  L+++       +  ++ +  T LA                S  
Sbjct: 252 DDLGFIAATSSSIFNNALIYVWKLASKSSKDAIAAVKTVLAVFGLGTTKFESALQTSSQI 311

Query: 359 LNDLSADYNDIAIYSPNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKE 418
              L  DY   A+Y  NPF    +  SN    + Q+  L+LVDGGED +NIP+  L+   
Sbjct: 312 TAALDTDY---AVYRHNPF----YKYSNIKNELAQNDYLYLVDGGEDGENIPIRTLV--P 362

Query: 419 RELDVIFALDNSADTNQSWPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRP 478
           R +D+I  +D+S+D  +++ +G  L     +    +  G+ + Y P K     +   KRP
Sbjct: 363 RNVDMIMIMDSSSD-KKNYANGDKLKIVLNQM--KEKEGIYYRY-PTK----IVTSQKRP 414

Query: 479 TFFGCDARNLTDLEYIPPLVVYIPNARHSFNG--NQSTFKMSYSTSERFSMIQNGFESAT 536
           T  GC     +D + + P++VY PN+  S     N STFKM Y++ E+  +I +G+   T
Sbjct: 415 TIIGCKPPRTSDTK-LAPILVYYPNSERSSTQVTNTSTFKMIYTSEEQQLLIDHGYTLVT 473

Query: 537 RGNFTDDSDFLGCIGCAIMRRKQQSMNATLPTECNQCFTNYC 578
                 + D+  C+ C +++R     +   P +C+ C++ YC
Sbjct: 474 GHG---EHDYQKCMACILVKRSYDQASIIPPKQCSICYSKYC 512

>Scas_690.1*
          Length = 636

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 248 DVFKNAEMPFPISVADGRYPGTTVINLNA--TVFEFNPFEMGSWDPTL--NTFTDVKYLG 303
           +V++ A++ +   V +GRYP   ++NL+   +V +F P +  +  P L  +  TD+ +  
Sbjct: 197 EVYQGAKLFYLSGVINGRYPDREILNLSRFISVMKFRPLKWRNEHPYLLADRITDLTHPE 256

Query: 304 TNVSNGKPITEGKCIAGF 321
              + GK I     I G+
Sbjct: 257 LIETQGKQIDRKVAIYGY 274

>Kwal_56.24139
          Length = 463

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 248 DVFKNAEMPFPISVADGRYPGTTVINLNA--TVFEFNPFEMGSWDPTL--NTFTDVKYLG 303
           +V++ A++ +   V +GRYP   ++NL+   +V +F P +  +  P L  +  TD+ +  
Sbjct: 197 EVYQGAKLFYLSGVINGRYPDREILNLSRFISVMKFRPLKWRNEHPYLLADRITDITHPE 256

Query: 304 TNVSNGKPITEGKCIAGF 321
              + GK I     + G+
Sbjct: 257 LLETQGKQIDRKVALYGY 274

>YPL217C (BMS1) [5232] chr16 complement(139619..143170) Protein
           involved rRNA processing and 40S ribosomal subunit
           biogenesis, contains a GTP-binding domain, and interacts
           genetically with BMH1 [3552 bp, 1183 aa]
          Length = 1183

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 248 DVFKNAEMPFPISVADGRYPGTTVINLNA--TVFEFNPFEMGSWDPTL--NTFTDVKYLG 303
           +V++ A++ +   V +GRYP   ++NL+   +V +F P +  +  P +  + FTD+ +  
Sbjct: 197 EVYQGAKLFYLSGVINGRYPDREILNLSRFISVMKFRPLKWRNEHPYMLADRFTDLTHPE 256

Query: 304 TNVSNGKPITEGKCIAGF 321
              + G  I     I G+
Sbjct: 257 LIETQGLQIDRKVAIYGY 274

>KLLA0B02068g complement(179493..182996) similar to sgd|S0006138
           Saccharomyces cerevisiae YPL217c BMS1, start by
           similarity
          Length = 1167

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 248 DVFKNAEMPFPISVADGRYPGTTVINLNA--TVFEFNPFEMGSWDPTL--NTFTDVKYLG 303
           +V++ A++ +   V +GRYP   ++NL+   +V +F P +  +  P L  +  +D+ +  
Sbjct: 197 EVYQGAKLFYLSGVINGRYPDREILNLSRFISVMKFRPLQWRNEHPYLLADRISDLTHPE 256

Query: 304 TNVSNGKPITEGKCIAGF 321
              S G  I     I G+
Sbjct: 257 LLQSKGMHIDRKVAIYGY 274

>CAGL0E05874g 580520..584032 highly similar to tr|Q08965
           Saccharomyces cerevisiae YPL217c BMS1, start by
           similarity
          Length = 1170

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 248 DVFKNAEMPFPISVADGRYPGTTVINLNA--TVFEFNPFEMGSWDPTL--NTFTDVKYLG 303
           +V++ A++ +   V +GRYP   ++NL+   +V +F P +  +  P +  +  TD+ +  
Sbjct: 197 EVYQGAKLFYLSGVLNGRYPDREILNLSRFISVMKFRPLKWRNEHPYMLADRITDLTHPD 256

Query: 304 TNVSNGKPITEGKCIAGF 321
                GK +     + G+
Sbjct: 257 LIERKGKKVDRKVALYGY 274

>Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement
          Length = 546

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 445 NTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEYIPPLVV 499
           ++++  FG++      PY+   N+F   G    P+  G  ARNL DLE+   L+V
Sbjct: 234 SSFQGLFGLRPTHGRLPYLKVDNSFE--GQELIPSVIGPLARNLEDLEFFMELIV 286

>Scas_660.8
          Length = 510

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 6/62 (9%)

Query: 292 TLNTFTDVKYLGTNVSNGKPITEGKCIAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFI 351
           T + F DV Y  +  S+GK +  G      D TG ++   S      LL IN+++ P+ +
Sbjct: 76  TFSRFKDVVYSASFRSDGKLLVAG------DATGLVSVYDSYNPRTILLSINASTHPTHV 129

Query: 352 TK 353
           TK
Sbjct: 130 TK 131

>YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component of
           U3 snoRNP (renamed small subunit processome) which is
           required for 18S biogenesis, has WD (WD-40) repeats
           [1542 bp, 513 aa]
          Length = 513

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 6/66 (9%)

Query: 292 TLNTFTDVKYLGTNVSNGKPITEGKCIAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFI 351
           T + F DV Y  +  S+GK +  G      D TG ++   S      LL IN+++ P+ +
Sbjct: 76  TFSRFKDVVYSASFRSDGKLLCAG------DATGLVSVYDSYNPRTILLSINASTHPTHV 129

Query: 352 TKLASH 357
           TK  + 
Sbjct: 130 TKFHTQ 135

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,804,603
Number of extensions: 928411
Number of successful extensions: 2552
Number of sequences better than 10.0: 36
Number of HSP's gapped: 2548
Number of HSP's successfully gapped: 40
Length of query: 646
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 538
Effective length of database: 12,857,365
Effective search space: 6917262370
Effective search space used: 6917262370
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)