Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_611.0d1531536459e-88
CAGL0J11792g510681771e-15
YML043C (RRN11)507731331e-09
ACL020W539511286e-09
KLLA0C05852g482511119e-07
Kwal_56.2252748148985e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_611.0d
         (153 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_611.0d                                                           253   9e-88
CAGL0J11792g complement(1148628..1150160) similar to sp|Q04712 S...    73   1e-15
YML043C (RRN11) [3925] chr13 complement(190244..191767) Componen...    56   1e-09
ACL020W [1029] [Homologous to ScYML043C (RRN11) - NSH] complemen...    54   6e-09
KLLA0C05852g 518508..519956 weakly similar to sp|Q04712 Saccharo...    47   9e-07
Kwal_56.22527                                                          42   5e-05

>Scas_611.0d
          Length = 153

 Score =  253 bits (645), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 126/153 (82%)

Query: 1   HMVKADXXXXXXXXXXXXGSARDIARNEVIQNIQLVKTFLQTAMSKGHFEYPERFITRQL 60
           HMVKAD            GSARDIARNEVIQNIQLVKTFLQTAMSKGHFEYPERFITRQL
Sbjct: 1   HMVKADQLSLNFNLNQSNGSARDIARNEVIQNIQLVKTFLQTAMSKGHFEYPERFITRQL 60

Query: 61  NTFEERLYSKDETXXXXXXXXXXXXXXXMDNGNIQLVPETNPIPPAEDEYVFSDFSFTNA 120
           NTFEERLYSKDET               MDNGNIQLVPETNPIPPAEDEYVFSDFSFTNA
Sbjct: 61  NTFEERLYSKDETNSKDKDNNESDNGSSMDNGNIQLVPETNPIPPAEDEYVFSDFSFTNA 120

Query: 121 AHDLDTQALEPMIHEEDLMEEDPFSQIQSDSSE 153
           AHDLDTQALEPMIHEEDLMEEDPFSQIQSDSSE
Sbjct: 121 AHDLDTQALEPMIHEEDLMEEDPFSQIQSDSSE 153

>CAGL0J11792g complement(1148628..1150160) similar to sp|Q04712
           Saccharomyces cerevisiae YML043c RRN11 RNA polymerase I
           specific transcription initiation factor, hypothetical
           start
          Length = 510

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%)

Query: 1   HMVKADXXXXXXXXXXXXGSARDIARNEVIQNIQLVKTFLQTAMSKGHFEYPERFITRQL 60
           HMV AD            GS RDIARN+V Q+I  VKT+LQ    KG+FEYP++FI  +L
Sbjct: 367 HMVHADYLSGKFNCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQKGNFEYPKQFIQSRL 426

Query: 61  NTFEERLY 68
             FE+R+Y
Sbjct: 427 EEFEKRMY 434

>YML043C (RRN11) [3925] chr13 complement(190244..191767) Component
           of RNA polymerase I core transcription factor (CF) along
           with Rrn6p and Rrn7p [1524 bp, 507 aa]
          Length = 507

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 1   HMVKADXXXXX----XXXXXXXGSARDIARNEVIQNIQLVKTFLQTAMSKGHFEYPERFI 56
           H++KAD                G  RDI  N+VI++I  V+TFL+  + KG F  P R I
Sbjct: 372 HLLKADTLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHYVRTFLKICLDKGGFAVPSRLI 431

Query: 57  TRQLNTFEERLYS 69
             QL +FE RLY 
Sbjct: 432 ENQLKSFESRLYG 444

>ACL020W [1029] [Homologous to ScYML043C (RRN11) - NSH]
           complement(326268..327887) [1620 bp, 539 aa]
          Length = 539

 Score = 53.9 bits (128), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 32/51 (62%)

Query: 19  GSARDIARNEVIQNIQLVKTFLQTAMSKGHFEYPERFITRQLNTFEERLYS 69
           GS  DIA+ +V Q I  VK  L++   KG+F YPER I  QL  FE RLY+
Sbjct: 418 GSKLDIAKTQVTQYICSVKNCLESCREKGNFTYPERIIQEQLLEFERRLYA 468

>KLLA0C05852g 518508..519956 weakly similar to sp|Q04712
           Saccharomyces cerevisiae YML043c RRN11 RNA polymerase I
           specific transcription initiation factor singleton,
           start by similarity
          Length = 482

 Score = 47.4 bits (111), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%)

Query: 19  GSARDIARNEVIQNIQLVKTFLQTAMSKGHFEYPERFITRQLNTFEERLYS 69
           GS  DIARN+VIQ+I   K  LQ   +  ++E+PE  I  QL   E  LY+
Sbjct: 363 GSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLVQLERSLYT 413

>Kwal_56.22527
          Length = 481

 Score = 42.4 bits (98), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 22  RDIARNEVIQNIQLVKTFLQTAMSKG-HFEYPERFITRQLNTFEERLY 68
           RDI+RN+V Q+I      ++T  +KG  F +P R I  QL  FE RLY
Sbjct: 374 RDISRNQVTQHITNAHNCIRTCEAKGDDFFFPRRIIEEQLAFFERRLY 421

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,148,965
Number of extensions: 154909
Number of successful extensions: 276
Number of sequences better than 10.0: 11
Number of HSP's gapped: 275
Number of HSP's successfully gapped: 11
Length of query: 153
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 60
Effective length of database: 13,376,635
Effective search space: 802598100
Effective search space used: 802598100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 57 (26.6 bits)