Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_608.543143117540.0
YEL040W (UTR2)46733112311e-167
CAGL0C02211g48133212021e-163
KLLA0F16907g45231710411e-139
Kwal_27.1014646932810181e-135
Sklu_1954.15103525332e-62
Scas_674.154183445106e-60
Kwal_56.245184753205112e-59
KLLA0F04906g4962205052e-58
YLR213C (CRR1)4222044976e-58
ADR078C4503404874e-56
CAGL0J08910g4943124791e-54
YGR189C (CRH1)5071832702e-25
CAGL0G09449g4522242664e-25
KLLA0F22671g4662232631e-24
Scas_507.24311702621e-24
Scas_441.24251672532e-23
AGR318C4521442532e-23
Sklu_2390.24781612401e-21
Kwal_33.153934591472187e-19
Scas_720.27388155968e-04
Scas_630.3387147910.004
Scas_647.22386175900.005
Scas_721.134384175820.042
Scas_647.19d387172800.072
YGL184C (STR3)46567720.80
YNL238W (KEX2)81472664.6
Scas_710.2065950655.3
AAR103C87850656.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_608.5
         (431 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_608.5                                                            680   0.0  
YEL040W (UTR2) [1387] chr5 (78053..79456) Cell wall protein [140...   478   e-167
CAGL0C02211g 225012..226457 similar to sp|P32623 Saccharomyces c...   467   e-163
KLLA0F16907g 1555857..1557215 some similarities with sp|P32623 S...   405   e-139
Kwal_27.10146                                                         396   e-135
Sklu_1954.1 YLR213C, Contig c1954 323-1855 reverse complement         209   2e-62
Scas_674.15                                                           201   6e-60
Kwal_56.24518                                                         201   2e-59
KLLA0F04906g complement(482183..483673) some similarities with s...   199   2e-58
YLR213C (CRR1) [3614] chr12 complement(566656..567924) Sporulati...   196   6e-58
ADR078C [1819] [Homologous to ScYLR213C (CRR1) - SH] (847158..84...   192   4e-56
CAGL0J08910g complement(877143..878627) similar to tr|Q05790 Sac...   189   1e-54
YGR189C (CRH1) [2140] chr7 complement(876672..878195) Cell wall ...   108   2e-25
CAGL0G09449g 898735..900093 similar to sp|P53301 Saccharomyces c...   107   4e-25
KLLA0F22671g complement(2115530..2116930) some similarities with...   105   1e-24
Scas_507.2                                                            105   1e-24
Scas_441.2                                                            102   2e-23
AGR318C [4629] [Homologous to ScYGR189C (CRH1) - SH] (1325918..1...   102   2e-23
Sklu_2390.2 YGR189C, Contig c2390 9663-11099                           97   1e-21
Kwal_33.15393                                                          89   7e-19
Scas_720.27                                                            42   8e-04
Scas_630.3                                                             40   0.004
Scas_647.22                                                            39   0.005
Scas_721.134                                                           36   0.042
Scas_647.19d                                                           35   0.072
YGL184C (STR3) [1808] chr7 complement(154619..156016) Protein wi...    32   0.80 
YNL238W (KEX2) [4369] chr14 (202427..204871) Endoprotease (yscF)...    30   4.6  
Scas_710.20                                                            30   5.3  
AAR103C [289] [Homologous to ScYPR135W (CTF4) - SH] (527960..530...    30   6.7  

>Scas_608.5
          Length = 431

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/431 (81%), Positives = 351/431 (81%)

Query: 1   MASMQSFAYXXXXXXXXXKVNAVTICNATQSCPEDLPXXXXXXXXXXXXXXXXSCNPSFS 60
           MASMQSFAY         KVNAVTICNATQSCPEDLP                SCNPSFS
Sbjct: 1   MASMQSFAYLLTLLTFLLKVNAVTICNATQSCPEDLPCCSQGGQCGTGQYCLGSCNPSFS 60

Query: 61  FNIDSCMPLPICKDSSTKFDNYSSKILNEYTFLGNVSAADWLYSGNIIDYADENSLILAM 120
           FNIDSCMPLPICKDSSTKFDNYSSKILNEYTFLGNVSAADWLYSGNIIDYADENSLILAM
Sbjct: 61  FNIDSCMPLPICKDSSTKFDNYSSKILNEYTFLGNVSAADWLYSGNIIDYADENSLILAM 120

Query: 121 PKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQT 180
           PKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQT
Sbjct: 121 PKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQT 180

Query: 181 NYYWQGTLNYNHSTNITVDDVFDDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTD 240
           NYYWQGTLNYNHSTNITVDDVFDDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTD
Sbjct: 181 NYYWQGTLNYNHSTNITVDDVFDDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTD 240

Query: 241 TYRFPQTPSQVHLSIWPGGNATNAPGTIAWAGGEINWDAPDISDPGYYYAIVNEVNITCY 300
           TYRFPQTPSQVHLSIWPGGNATNAPGTIAWAGGEINWDAPDISDPGYYYAIVNEVNITCY
Sbjct: 241 TYRFPQTPSQVHLSIWPGGNATNAPGTIAWAGGEINWDAPDISDPGYYYAIVNEVNITCY 300

Query: 301 DPPIFAKKNGTKAYKYTNSDNFLEKSIMITDDEVMLGSDEATGNNITEGVXXXXXXXXXX 360
           DPPIFAKKNGTKAYKYTNSDNFLEKSIMITDDEVMLGSDEATGNNITEGV          
Sbjct: 301 DPPIFAKKNGTKAYKYTNSDNFLEKSIMITDDEVMLGSDEATGNNITEGVTTSSSSSSSS 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSKNDAPVLSNINIV 420
                                                        NSKNDAPVLSNINIV
Sbjct: 361 ASSSSSSSSSAKKTSSASTTGKTSSGSSGSSTSTSSSSSSSSSSTNSKNDAPVLSNINIV 420

Query: 421 TVFSFIFGLLI 431
           TVFSFIFGLLI
Sbjct: 421 TVFSFIFGLLI 431

>YEL040W (UTR2) [1387] chr5 (78053..79456) Cell wall protein [1404
           bp, 467 aa]
          Length = 467

 Score =  478 bits (1231), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 222/331 (67%), Positives = 266/331 (80%)

Query: 19  KVNAVTICNATQSCPEDLPXXXXXXXXXXXXXXXXSCNPSFSFNIDSCMPLPICKDSSTK 78
           +V A T CNATQ+CPED P                +C+  +SF+ DSCMP+PICK SSTK
Sbjct: 20  RVEAATFCNATQACPEDKPCCSQYGECGTGQYCLNNCDVRYSFSHDSCMPVPICKSSSTK 79

Query: 79  FDNYSSKILNEYTFLGNVSAADWLYSGNIIDYADENSLILAMPKNSGGTVLTSTRAVWYG 138
           F +YSSK+ N  TFLGNVS ADWLY+G+++DY DE SLILAMPKNSGGTVL+STRAVWYG
Sbjct: 80  FKDYSSKLGNANTFLGNVSEADWLYTGDVLDYDDEESLILAMPKNSGGTVLSSTRAVWYG 139

Query: 139 KITARMKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQTNYYWQGTLNYNHSTNITV 198
           K++AR+K SHL GV+T FIL+SG  DE+D+EFVGAD+E  QTN+YW+  LNY +S NI+ 
Sbjct: 140 KVSARIKTSHLAGVVTGFILYSGAGDELDYEFVGADLETAQTNFYWESVLNYTNSANIST 199

Query: 199 DDVFDDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPG 258
            D F++YHTYELDWHEDY+TWS+DG +GRTLYKNETYN+TT  Y++PQTPS+V +SIWPG
Sbjct: 200 TDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYNATTQKYQYPQTPSKVDISIWPG 259

Query: 259 GNATNAPGTIAWAGGEINWDAPDISDPGYYYAIVNEVNITCYDPPIFAKKNGTKAYKYTN 318
           GN+TNAPGTIAW+GGEINWDA DIS+PGYYYAIVNEVNITCYDPP   KKNGT AY YT+
Sbjct: 260 GNSTNAPGTIAWSGGEINWDASDISNPGYYYAIVNEVNITCYDPPSDTKKNGTSAYVYTS 319

Query: 319 SDNFLEKSIMITDDEVMLGSDEATGNNITEG 349
           S  FL K I ITDDEVM+ SDE +G +  +G
Sbjct: 320 SSEFLAKDIAITDDEVMMDSDEGSGLDPHKG 350

>CAGL0C02211g 225012..226457 similar to sp|P32623 Saccharomyces
           cerevisiae YEL040w UTR2 cell wall protein, hypothetical
           start
          Length = 481

 Score =  467 bits (1202), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 208/332 (62%), Positives = 263/332 (79%)

Query: 19  KVNAVTICNATQSCPEDLPXXXXXXXXXXXXXXXXSCNPSFSFNIDSCMPLPICKDSSTK 78
           ++ A   CNAT  CPE+ P                +CNP FSF+IDSC+P+P+CKDSSTK
Sbjct: 21  ELTAPIYCNATSQCPEEFPCCSQFGQCGTGQYCINNCNPKFSFSIDSCVPMPVCKDSSTK 80

Query: 79  FDNYSSKILNEYTFLGNVSAADWLYSGNIIDYADENSLILAMPKNSGGTVLTSTRAVWYG 138
           FD+YSSK+LN  T+L N SAADW YSG ++DY DE+S+ILAMPKNSGG+VL++TR +WYG
Sbjct: 81  FDDYSSKVLNADTYLNNASAADWTYSGYLVDYPDEDSMILAMPKNSGGSVLSTTRYMWYG 140

Query: 139 KITARMKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQTNYYWQGTLNYNHSTNITV 198
           K++AR+K+SHLGGV+++ ILFS +QDEID EF+GAD+  VQTN+YW+GTLNY +S N+T 
Sbjct: 141 KVSARLKSSHLGGVVSSMILFSNVQDEIDIEFIGADLNTVQTNFYWEGTLNYTNSANMTT 200

Query: 199 DDVFDDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPG 258
            + F++YH YE+DWHEDYITWS+DG +GRTLYKN+TYN TT  Y FPQTPS++ +SIWPG
Sbjct: 201 SNTFENYHDYEIDWHEDYITWSIDGVVGRTLYKNQTYNETTGIYEFPQTPSRIQISIWPG 260

Query: 259 GNATNAPGTIAWAGGEINWDAPDISDPGYYYAIVNEVNITCYDPPIFAKKNGTKAYKYTN 318
           GNAT+APGTIAWAGG INWDAPDI DPGYYY +V E NITCYDPP   KKNGTK+Y YT+
Sbjct: 261 GNATSAPGTIAWAGGAINWDAPDIQDPGYYYMMVQEANITCYDPPANVKKNGTKSYIYTS 320

Query: 319 SDNFLEKSIMITDDEVMLGSDEATGNNITEGV 350
           + +F + SIMI+D + +L +   TG N+TEG 
Sbjct: 321 NKDFTQDSIMISDKDFVLENSAWTGLNLTEGA 352

>KLLA0F16907g 1555857..1557215 some similarities with sp|P32623
           Saccharomyces cerevisiae YEL040w UTR2 cell wall protein,
           hypothetical start
          Length = 452

 Score =  405 bits (1041), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 186/317 (58%), Positives = 233/317 (73%)

Query: 20  VNAVTICNATQSCPEDLPXXXXXXXXXXXXXXXXSCNPSFSFNIDSCMPLPICKDSSTKF 79
            +  T C+    CPED P                 CNP FS+  ++CMPLP+C+D+ T F
Sbjct: 21  ADETTTCSEDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKFSYKKEACMPLPVCRDTITIF 80

Query: 80  DNYSSKILNEYTFLGNVSAADWLYSGNIIDYADENSLILAMPKNSGGTVLTSTRAVWYGK 139
           DNY+SK+ N YT+LG+ S A+W Y G  IDY DEN+LI+AMPKNSGGTVL+ST  +WYG 
Sbjct: 81  DNYTSKMANLYTYLGDASKANWTYEGYPIDYEDENALIMAMPKNSGGTVLSSTHYMWYGN 140

Query: 140 ITARMKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQTNYYWQGTLNYNHSTNITVD 199
           I  RMKASH  GV++A ILFS +QDEID+E+VGAD+EKVQTN+YWQG LNY +S N+T  
Sbjct: 141 IKTRMKASHGAGVVSAMILFSSVQDEIDYEWVGADLEKVQTNWYWQGALNYTNSKNLTAT 200

Query: 200 DVFDDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGG 259
           +  +DYH YE+DW ED ITWSVDG +GRTL+KNETYNST+  Y +PQTPS+V LS+WPGG
Sbjct: 201 NNDEDYHIYEIDWKEDVITWSVDGEVGRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGG 260

Query: 260 NATNAPGTIAWAGGEINWDAPDISDPGYYYAIVNEVNITCYDPPIFAKKNGTKAYKYTNS 319
           NATN  GTI WAGGEI+WD+ DI D GYYYA++  VNITCYDPP    KNG++ Y+Y+  
Sbjct: 261 NATNEQGTINWAGGEIDWDSDDIKDYGYYYAVLESVNITCYDPPSGTTKNGSEVYQYSGE 320

Query: 320 DNFLEKSIMITDDEVML 336
           DN+L+K + ITD   +L
Sbjct: 321 DNWLQKGVFITDGNTIL 337

>Kwal_27.10146
          Length = 469

 Score =  396 bits (1018), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 237/328 (72%), Gaps = 2/328 (0%)

Query: 23  VTICNAT-QSCPEDLPXXXXXXXXXXXXXXXXSCNPSFSFNIDSCMPLPICKDSSTKFDN 81
           V  CN T  SCPED P                 CNP +S+N+ +CMP+P+CKDS T F+N
Sbjct: 24  VIYCNGTIGSCPEDKPCCSQYGTCGTGLTCLGGCNPMYSYNLSACMPVPVCKDSKTIFNN 83

Query: 82  YSSKILNEYTFLGNVSAADWLYSGNIIDYADENSLILAMPKNSGGTVLTSTRAVWYGKIT 141
           YSS+++  Y++LG+    DW Y G++ D  DE +L++AMPK SGGTVL+STR +WYGK+ 
Sbjct: 84  YSSEVVPRYSYLGDADKHDWTYEGSLAD-LDEEALVMAMPKYSGGTVLSSTRYMWYGKVG 142

Query: 142 ARMKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQTNYYWQGTLNYNHSTNITVDDV 201
           ARMK SH  GV+TAFI+FS + DE+DFEF+GA++   QTNYY++G LN+ +S NI+  D 
Sbjct: 143 ARMKTSHRAGVVTAFIMFSSVMDEMDFEFIGANLTTAQTNYYFEGALNWTNSKNISTSDT 202

Query: 202 FDDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGNA 261
           +++YH YE+DWHED+I W VDG +GRTLYKN+TYN+TT  Y FPQTP+++ LSIWPGGNA
Sbjct: 203 YENYHLYEVDWHEDHIDWLVDGEVGRTLYKNKTYNATTGDYMFPQTPARIQLSIWPGGNA 262

Query: 262 TNAPGTIAWAGGEINWDAPDISDPGYYYAIVNEVNITCYDPPIFAKKNGTKAYKYTNSDN 321
           T   GT  WAGG+I+WDA DI D GYYYA++  VNITCYDPP    +NGT AY+Y NS N
Sbjct: 263 TQPIGTRQWAGGDIDWDADDIVDNGYYYALLESVNITCYDPPAGTMQNGTNAYRYINSKN 322

Query: 322 FLEKSIMITDDEVMLGSDEATGNNITEG 349
           F +  I IT+D  +LGSDE +G N  +G
Sbjct: 323 FTQAGIAITNDTTILGSDEDSGFNANDG 350

>Sklu_1954.1 YLR213C, Contig c1954 323-1855 reverse complement
          Length = 510

 Score =  209 bits (533), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 122/352 (34%), Positives = 179/352 (50%), Gaps = 52/352 (14%)

Query: 1   MASMQSFAYXXXXXXXXXKVNAVTICNATQSCPEDLPXXXXXXXXXXXXXXXXSCNPSFS 60
           +  + +  Y         K N    C+AT  CP + P                 CNP FS
Sbjct: 7   LLPIMTIVYAASELSEPYKSNPAISCSATSKCPPEWPCCSQYGLCGSGPLCIGGCNPKFS 66

Query: 61  FNIDSC--MP--LPICKDSSTKFDNY---SSKILN-EYTFLGNVSAADW-LYSGNIIDYA 111
           FN+ SC  MP  LP  + S  K +     S +IL+ E T L +    D+ L  G  +  A
Sbjct: 67  FNVHSCVAMPALLPPVQASYGKQNKQTIQSVQILDDEPTLLTDFRPRDFSLMEGEKVTEA 126

Query: 112 DENS-----------------------------------------LILAMPKNSGGTVLT 130
           D NS                                         +IL MP  + G++++
Sbjct: 127 DLNSRGLMHFSKYLITPDKSIGKQMLENYEFTYSGYMDLDSKSNDIILGMPNRTTGSLIS 186

Query: 131 STRAVWYGKITARMKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQTNYYWQGTLNY 190
           STR+  YGK    MK +   GVI+A +LFS ++DEIDFEF+G+++ + QTNYY QG L +
Sbjct: 187 STRSFLYGKAAVTMKTARSRGVISAIMLFSAVRDEIDFEFLGSELTEAQTNYYHQGELVH 246

Query: 191 NHSTNITV-DDVFDDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTDTYRFPQTPS 249
                  +  D F +YHTYELDW+E+ I W +DG + RTL+K +T++     +++PQTP 
Sbjct: 247 TRMQRFPIPSDSFHNYHTYELDWNEERIHWLIDGVVVRTLFKRDTWDPELKIFKYPQTPM 306

Query: 250 QVHLSIWPGGNATNAPGTIAWAGGEINWD-APDISDPGYYYAIVNEVNITCY 300
           ++ +S+WPGG   N PGTI+WAGG I+W+ +PDI +   +Y++V +V IT Y
Sbjct: 307 KLEVSLWPGGMEGNDPGTISWAGGLIDWENSPDIIEKKQFYSMVKQVTITPY 358

>Scas_674.15
          Length = 418

 Score =  201 bits (510), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 168/344 (48%), Gaps = 53/344 (15%)

Query: 19  KVNAVTICNATQSCPEDLPXXXXXXXXXXXXXXXXSCNPSFSFNIDSCMPLPICKDSSTK 78
           K N    C+    CP D P                 CNP  SF   +C PLPI    +T+
Sbjct: 25  KPNTRIACSKESHCPPDWPCCSPYGDCGSGPVCLGGCNPKLSFEDTACAPLPILYSPATE 84

Query: 79  F------------DNYSSKILNEY-----------TFLGN-------------------- 95
                        D    +++NE+             L N                    
Sbjct: 85  LRYDRSIPPSSSKDEVFQQMINEHYPQEAPSNFEKEILQNNKLHLNSRGIIHFTDYLMTD 144

Query: 96  --------VSAADWLYSGNIIDYADENSLILAMPKNSGGTVLTSTRAVWYGKITARMKAS 147
                   +S   +LYSG I      N + L MPK S G+++TS +   YGK+  R++A+
Sbjct: 145 SVDKAKDMLSKYQFLYSGPINIDPQTNDIQLNMPKQSSGSLITSAKYFLYGKLHVRLRAA 204

Query: 148 HLGGVITAFILFSGIQDEIDFEFVGADIEKVQTNYYWQGTLNYNHSTNITVD-DVFDDYH 206
              GV+T  +L S + DEIDFEF+GA++  VQTNYY QG L + +     +  +++  YH
Sbjct: 205 RSIGVVTGLVLISQVGDEIDFEFLGAELNFVQTNYYSQGELIHTNMQKYHIPTNIWATYH 264

Query: 207 TYELDWHEDYITWSVDGTIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGNATNAPG 266
           TY +DW+ D I W V+G I RTL+K +T++  +  +++P+TP ++ ++IWPGG ATN PG
Sbjct: 265 TYSIDWNPDRILWMVEGQIIRTLFKRDTWDPVSKRFKYPETPMRLEIAIWPGGAATNPPG 324

Query: 267 TIAWAGGEINWD-APDISDPGYYYAIVNEVNITCYDPPIFAKKN 309
           TI+WAGG INWD APDI + G +   V   NI  Y  P   +K 
Sbjct: 325 TISWAGGLINWDTAPDILEKGQFSVYVQHANIVPYINPKITEKQ 368

>Kwal_56.24518
          Length = 475

 Score =  201 bits (511), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 171/320 (53%), Gaps = 46/320 (14%)

Query: 26  CNATQSCPEDLPXXXXXXXXXXXXXXXXSCNPSFSFNIDSCMPLPIC---KDSSTKFDNY 82
           C+  +SCP++ P                 C+P FS +  SC  +P      DS+ +    
Sbjct: 32  CSKDKSCPQEWPCCSQYGQCGKGPICVGGCDPRFSHSALSCAAIPALVPSLDSTYQSLQD 91

Query: 83  SSKILNEY-------TFLG-------------------------------NVSAADWLYS 104
           S K++++        TF G                                +S AD+ YS
Sbjct: 92  SEKLIDQLQVSPVVNTFFGAESIIPAAGFNYISTLSSKRLLHFSRSDSPTELSEADFTYS 151

Query: 105 GNIIDYADENS--LILAMPKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILFSGI 162
           G  +++ D  S  LILAMP  + G++L+S ++  YGK    MK++   GV++A +L S +
Sbjct: 152 G-YLEFEDSPSSDLILAMPPGTTGSLLSSAKSFLYGKAEVTMKSARGAGVVSAMVLMSAV 210

Query: 163 QDEIDFEFVGADIEKVQTNYYWQGTLNYNHSTNITVD-DVFDDYHTYELDWHEDYITWSV 221
           +DE+DFE +G  ++  Q NYY+QG L +   T  +V  D + +YHTY  DW+E+ I W V
Sbjct: 211 KDEVDFELLGGSLDSAQANYYYQGELIHTRMTQSSVKPDTYSEYHTYAFDWNEERIKWLV 270

Query: 222 DGTIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGNATNAPGTIAWAGGEINWD-AP 280
           DG + RT+Y+ +TY+  TDT+++PQTP ++ L+IWPGG   N+PGT+ WAGG I+W+ + 
Sbjct: 271 DGAVVRTVYRADTYDPVTDTFKYPQTPMRLELAIWPGGLPANSPGTVMWAGGLIDWENSA 330

Query: 281 DISDPGYYYAIVNEVNITCY 300
           DI + G +   V  V+IT Y
Sbjct: 331 DILENGQFQLAVKHVSITPY 350

>KLLA0F04906g complement(482183..483673) some similarities with
           sgd|S0004203 Saccharomyces cerevisiae YLR213c CRR1,
           hypothetical start
          Length = 496

 Score =  199 bits (505), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 94/220 (42%), Positives = 137/220 (62%), Gaps = 12/220 (5%)

Query: 84  SKILNEYTFLGNVSAADWLYSGNIIDYADENSLILAMPKNSGGTVLTSTRAVWYGKITAR 143
            K+L +Y F          YSG  + Y     L LAMPK++ G++++STR+  YG+ T +
Sbjct: 143 KKMLRDYHFT---------YSG-FVKYDAPGQLTLAMPKHTSGSLISSTRSFLYGRATVK 192

Query: 144 MKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQTNYYWQGTLNYNHSTNITVD-DVF 202
           MK +   GV+TA +L S + DEIDFEF+G ++   Q+NYY QG LN+     + +  D F
Sbjct: 193 MKTARGRGVVTAVVLISTVGDEIDFEFIGGELHHAQSNYYHQGELNHTRMEKLELSSDSF 252

Query: 203 DDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGNAT 262
           ++ H YE+DW +D I W VDG + RTLYK +T+N     Y +PQTP ++ +S+WPGG   
Sbjct: 253 ENTHIYEVDWDQDRINWIVDGVVARTLYKEDTWNEEKQRYEYPQTPMRLQVSVWPGGRED 312

Query: 263 NAPGTIAWAGGEINWD-APDISDPGYYYAIVNEVNITCYD 301
             PGTI WAGG I+W+ +PDI + G +YA V  + +T Y+
Sbjct: 313 ADPGTIMWAGGLIDWENSPDILEKGQFYATVESIAVTPYE 352

>YLR213C (CRR1) [3614] chr12 complement(566656..567924) Sporulation
           specific protein with similarity to Crh1p cell wall
           protein [1269 bp, 422 aa]
          Length = 422

 Score =  196 bits (497), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 134/204 (65%), Gaps = 2/204 (0%)

Query: 100 DWLYSGNIIDYADENSLILAMPKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILF 159
           D+ +SG     A   +++LAMPK + G+++TSTR+  YGK + RMK +   GV+TAF L 
Sbjct: 152 DFTHSGYTSIEASSGNIVLAMPKKTTGSLITSTRSFLYGKASVRMKTARSRGVVTAFDLT 211

Query: 160 SGIQDEIDFEFVGADIEKVQTNYYWQGTLNYNHSTNITVD-DVFDDYHTYELDWHEDYIT 218
           S I DEIDFE++G D+   Q+NYY QG L+Y       V  D +  YHTYE+DW  D I 
Sbjct: 212 SAIGDEIDFEWLGGDLMTAQSNYYSQGHLDYTRMQRFPVGADTWATYHTYEIDWDPDRII 271

Query: 219 WSVDGTIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGNATNAPGTIAWAGGEINWD 278
           W VDG I RT+ K +T++  +  YR+PQTP ++ +++WPGG+ TN PGTI WAGG I+W+
Sbjct: 272 WYVDGKIARTVLKKDTWDPISKEYRYPQTPMRLEIAVWPGGSETNGPGTINWAGGLIDWE 331

Query: 279 -APDISDPGYYYAIVNEVNITCYD 301
            +PDI + G + A V ++ +T Y 
Sbjct: 332 NSPDIIEKGQFTAHVEQITVTPYQ 355

>ADR078C [1819] [Homologous to ScYLR213C (CRR1) - SH]
           (847158..848510) [1353 bp, 450 aa]
          Length = 450

 Score =  192 bits (487), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 114/340 (33%), Positives = 160/340 (47%), Gaps = 57/340 (16%)

Query: 19  KVNAVTICNATQSCPEDLPXXXXXXXXXXXXXXXXSCNPSFSFNIDSCMPLP-------- 70
           K N    C+    CP++ P                 CNP FS + +SC+P+P        
Sbjct: 24  KSNPYIACSEASHCPKEWPCCSQYGQCGSGPLCISGCNPKFSHSPESCVPVPALLPQLEI 83

Query: 71  ICKDSS-------------TKFDNYSSKILNE---------------------------Y 90
           +  D               TKF   SS  L E                           Y
Sbjct: 84  VASDDKGVYLEMSGQPALVTKFQRKSSAQLLEVHHEEQQYGVSALEQDLNSRGLIHFPDY 143

Query: 91  TFLGNVSAA-------DWLYSGNIIDYADENSLILAMPKNSGGTVLTSTRAVWYGKITAR 143
                   A       D+++SG I       SLIL MPK + G++++S++   YG+    
Sbjct: 144 MITSKPKVAREMLEQYDFIHSGFISVDGKSESLILGMPKKTTGSLISSSKVFLYGRAAVT 203

Query: 144 MKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQTNYYWQGTLNYNHSTNITV-DDVF 202
           MK S   GVITA +  S  QDEID+EFVG+++  VQTNYY+QG LN++     ++  +  
Sbjct: 204 MKTSRGPGVITAIVFMSSTQDEIDYEFVGSELHTVQTNYYYQGELNHSRMRRHSLPSNSH 263

Query: 203 DDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGNAT 262
           ++YH YE+DW  + I W VDG I RTLYK +T++     Y++PQTP  + +S+WP G   
Sbjct: 264 EEYHIYEVDWDAERIHWMVDGEIVRTLYKRDTWDPVHKIYKYPQTPMMLQISLWPAGTPD 323

Query: 263 NAPGTIAWAGGEINWD-APDISDPGYYYAIVNEVNITCYD 301
              GTI WAGG I+W+ APDI   G   A +  V IT Y+
Sbjct: 324 APQGTIEWAGGLIDWENAPDIKAHGQLAAQIQRVAITPYN 363

>CAGL0J08910g complement(877143..878627) similar to tr|Q05790
           Saccharomyces cerevisiae YLR213c CRR1, hypothetical
           start
          Length = 494

 Score =  189 bits (479), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 159/312 (50%), Gaps = 45/312 (14%)

Query: 31  SCPEDLPXXXXXXXXXXXXXXXXSCNPSFSFNIDSCMPLPI------------------- 71
           SCP + P                 CNP +SF  DSC+P P+                   
Sbjct: 40  SCPAEWPCCSPYGVCGSGPTCIGGCNPQYSFREDSCVPSPVLIPYNAIEFSTEGTKLIRI 99

Query: 72  ---------------CKDSSTKFDNYSSKILNEYTFLGNVSAA---------DWLYSGNI 107
                           +    + +   +K+++   FL    A          D++YSG  
Sbjct: 100 ASGNLQKGDAFLKKGARMKEREMELKRNKMIHFSDFLITEDATEANKMLMDYDFIYSGMT 159

Query: 108 IDYADENSLILAMPKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILFSGIQDEID 167
                 + + L MPK S G+++ S R+  YGK++  MK +  GGVITA +L S + DE+D
Sbjct: 160 QMDPTTSEIQLTMPKRSTGSLVASVRSFLYGKVSVTMKTARSGGVITALVLMSAVGDELD 219

Query: 168 FEFVGADIEKVQTNYYWQGTLNYNHSTNITV-DDVFDDYHTYELDWHEDYITWSVDGTIG 226
           FEFVG+++ +VQTN+Y+QG L++       + D+ + +YH +E+ W ED + W +DG + 
Sbjct: 220 FEFVGSELNQVQTNHYYQGELDFTKMKKHEIKDNTWLNYHNFEIFWTEDKVDWVIDGVVV 279

Query: 227 RTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGNATNAPGTIAWAGGEINWD-APDISDP 285
           RTLYK +T++     Y+FP +P ++ ++IWPGG+  N  GTI WAGG ++WD  PD+ + 
Sbjct: 280 RTLYKKDTWDPNAKVYKFPDSPMRLEIAIWPGGSEKNEIGTIMWAGGLVDWDNPPDMLEK 339

Query: 286 GYYYAIVNEVNI 297
           GY+ A V  + I
Sbjct: 340 GYFSANVKVIRI 351

>YGR189C (CRH1) [2140] chr7 complement(876672..878195) Cell wall
           protein [1524 bp, 507 aa]
          Length = 507

 Score =  108 bits (270), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 99/183 (54%), Gaps = 11/183 (6%)

Query: 100 DWLYSGNIIDYADENSLILAMPKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILF 159
           D  ++G I   +D  S+ LA  K      L S   + YGK+   +KA++  G++++F L 
Sbjct: 71  DLKHAGEIKYGSDGLSMTLA--KRYDNPSLKSNFYIMYGKLEVILKAANGTGIVSSFYLQ 128

Query: 160 SGIQDEIDFEFVGADIEKVQTNYYWQG-TLNYNHSTNITVDDVFDDYHTYELDWHEDYIT 218
           S   DEID E+VG D  + Q+N++ +G T  Y+      VD   D +H Y LDW  D  T
Sbjct: 129 SDDLDEIDIEWVGGDNTQFQSNFFSKGDTTTYDRGEFHGVDTPTDKFHNYTLDWAMDKTT 188

Query: 219 WSVDGTIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGNATNAPGTIAWAGGEINW- 277
           W +DG   R L       S T +  +PQ+P  + + IW GG+  NA GTI WAGGE N+ 
Sbjct: 189 WYLDGESVRVL-------SNTSSEGYPQSPMYLMMGIWAGGDPDNAAGTIEWAGGETNYN 241

Query: 278 DAP 280
           DAP
Sbjct: 242 DAP 244

>CAGL0G09449g 898735..900093 similar to sp|P53301 Saccharomyces
           cerevisiae YGR189c CRH1, hypothetical start
          Length = 452

 Score =  107 bits (266), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/224 (32%), Positives = 115/224 (51%), Gaps = 31/224 (13%)

Query: 64  DSCMPL-----PICKDSSTKF-DNYSSKILNEYTFLGNVSAADWLYSGN---IIDYADEN 114
           DSC PL     P  K  +T F +N++S+             + W  + +    I+Y  + 
Sbjct: 21  DSCDPLKQTNCPADKALATSFSENFTSE-------------SKWFTAEDNPGKIEYTSDG 67

Query: 115 SLILAMPKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILFSGIQDEIDFEFVGAD 174
            L +++ K      L S   + YGK     KA    G++++F L S   DEID E++G+D
Sbjct: 68  -LAMSLTKRFDNPSLKSNFYIMYGKTEVIFKAGDGRGIVSSFFLQSDDLDEIDLEWIGSD 126

Query: 175 IEKVQTNYYWQG-TLNYNHSTNITVDDVFDDYHTYELDWHEDYITWSVDGTIGRTLYKNE 233
             + Q+NY+ +G T  Y+      V+    ++H Y +DW  + +TW +DG + R L    
Sbjct: 127 DTQFQSNYFSKGNTATYDRGEFHGVNQPQKEFHNYTIDWTMEQLTWYLDGQVVRVLP--- 183

Query: 234 TYNSTTDTYRFPQTPSQVHLSIWPGGNATNAPGTIAWAGGEINW 277
             N+T+  Y  PQTP  + + IW GG+ +NAPGTI WAGGE ++
Sbjct: 184 --NTTSQGY--PQTPMYIKMGIWAGGDPSNAPGTIEWAGGETDY 223

>KLLA0F22671g complement(2115530..2116930) some similarities with
           sp|P53301 Saccharomyces cerevisiae YGR189c CRH1 family
           of putative glycosidases might exert a common role in
           cell wall organization, hypothetical start
          Length = 466

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 110/223 (49%), Gaps = 28/223 (12%)

Query: 54  SCNPSFSFNIDSCMPLP-ICKDSSTKFDNYSSKILNEYTFLGNVSAADWLYSGNIIDYAD 112
           +CNP       +C P P + K  S  FD  SS     Y   GNVS  D            
Sbjct: 23  ACNP---LTASTCSPDPALGKSISVPFDEESS-YFERYATNGNVSYGD------------ 66

Query: 113 ENSLILAMPKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILFSGIQDEIDFEFVG 172
            + + + + K      L S   + +GK+ A  KA+   G+I++F L S   DEID E+ G
Sbjct: 67  -DGVEMTINKRLDNPSLVSEFYIMFGKVQAIAKAAGGQGIISSFYLQSDDLDEIDIEWTG 125

Query: 173 ADIEKVQTNYYWQG-TLNYNHSTNITVDDVFDDYHTYELDWHEDYITWSVDGTIGRTLYK 231
            D  +VQ+N++ +G T  ++     +VDD    YH Y +DW +D I   VD  + RT+  
Sbjct: 126 TDTTQVQSNFFSKGETTTFDRGAFHSVDDPQGSYHNYTIDWTKDEINIYVDSALVRTI-- 183

Query: 232 NETYNSTTDTYR-FPQTPSQVHLSIWPGGNATNAPGTIAWAGG 273
                 T+D  + +P++P ++   IW GG++ N PGTI WAGG
Sbjct: 184 ------TSDNGQGYPESPMRIFTGIWAGGDSQNEPGTIEWAGG 220

>Scas_507.2
          Length = 431

 Score =  105 bits (262), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 91/170 (53%), Gaps = 10/170 (5%)

Query: 105 GNIIDYADENSLILAMPKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILFSGIQD 164
           GNI   +D   L L + K      L ST  + YGK+ A  +A+   G+I++  L S   D
Sbjct: 60  GNITYGSD--GLTLTLEKRLDNPSLHSTFYIMYGKVEAIAQAAPGQGMISSVFLQSDDLD 117

Query: 165 EIDFEFVGADIEKVQTNYYWQG-TLNYNHSTNITVDDVFDDYHTYELDWHEDYITWSVDG 223
           EID E+ G D  +VQ+NY+ +G T  Y+      VD     YH Y +DW +D +TW +DG
Sbjct: 118 EIDIEWTGGDTTQVQSNYFSKGQTTTYDRGEFHPVDSPQTTYHNYTVDWTKDAVTWYIDG 177

Query: 224 TIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGNATNAPGTIAWAGG 273
              R L  +           FP++P  +++ IW GG++ NAPGTI WAGG
Sbjct: 178 VSVRVLPSDAPEG-------FPESPMALNIGIWAGGDSGNAPGTIEWAGG 220

>Scas_441.2
          Length = 425

 Score =  102 bits (253), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 90/167 (53%), Gaps = 9/167 (5%)

Query: 108 IDYADENSLILAMPKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILFSGIQDEID 167
           I Y+D+  + L + K      L S   + YGK+   +KA    G+I++F L S   DEID
Sbjct: 66  ITYSDDG-VALTLAKRFDNPALKSDFYIMYGKLEVILKAGSGTGIISSFYLQSDDLDEID 124

Query: 168 FEFVGADIEKVQTNYYWQGTL-NYNHSTNITVDDVFDDYHTYELDWHEDYITWSVDGTIG 226
            E+VG D  + Q+NY+ +G +  Y+      V+    +YH Y LDW  D  TW +DG   
Sbjct: 125 IEWVGGDTTQFQSNYFSKGNVTTYDRGEFHIVESPQTEYHNYTLDWAMDKTTWYLDGQAV 184

Query: 227 RTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGNATNAPGTIAWAGG 273
           R L      N+T++ Y  PQ+P  + + IW GG+  NA GTI WAGG
Sbjct: 185 RVL-----PNTTSEGY--PQSPMYIMMGIWAGGDPDNAAGTIEWAGG 224

>AGR318C [4629] [Homologous to ScYGR189C (CRH1) - SH]
           (1325918..1327276) [1359 bp, 452 aa]
          Length = 452

 Score =  102 bits (253), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 85/144 (59%), Gaps = 8/144 (5%)

Query: 135 VWYGKITARMKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQTNYYWQGTL-NYNHS 193
           + YGK+    KA+   G++++F L S  +DEID E++G D  + QTN++ +G +  Y   
Sbjct: 89  LMYGKVEVTFKAAPGKGIVSSFYLQSDARDEIDLEWLGGDTAQFQTNFFCKGNVTTYTRG 148

Query: 194 TNITVDDVFDDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTDTYRFPQTPSQVHL 253
               V    +++HTY +DW  D + + +DG   R + KN+T         +PQ+P ++++
Sbjct: 149 AFHNVSRPQEEFHTYTIDWKMDELVFYLDGKPIRRV-KNDTSEG------YPQSPMRLYM 201

Query: 254 SIWPGGNATNAPGTIAWAGGEINW 277
            +W GG+ TN PGT+ WAGG+ ++
Sbjct: 202 GVWAGGDPTNHPGTVEWAGGQTDY 225

>Sklu_2390.2 YGR189C, Contig c2390 9663-11099
          Length = 478

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 87/161 (54%), Gaps = 8/161 (4%)

Query: 114 NSLILAMPKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILFSGIQDEIDFEFVGA 173
           + L L + +      L S   + YGK+   +KA++  GV+T+F L S   DEID E++G 
Sbjct: 76  DGLALTLKERFDNPGLKSDFYIMYGKVEVILKAANGTGVVTSFYLQSDDLDEIDLEWLGG 135

Query: 174 DIEKVQTNYYWQGTLN-YNHSTNITVDDVFDDYHTYELDWHEDYITWSVDGTIGRTLYKN 232
           D  + Q+N++ +G +  Y+      V     D+H Y +DW  D   W +DG   RTL   
Sbjct: 136 DTTEFQSNFFSKGNVETYDRGAFHGVYQPQIDFHNYTIDWGMDKTVWYLDGQPVRTL--- 192

Query: 233 ETYNSTTDTYRFPQTPSQVHLSIWPGGNATNAPGTIAWAGG 273
              N+T++ Y  PQ+P  V +  W GG+ +N PGTI WAGG
Sbjct: 193 --ENTTSEGY--PQSPMYVMMGTWAGGDPSNEPGTIEWAGG 229

>Kwal_33.15393
          Length = 459

 Score = 88.6 bits (218), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 79/147 (53%), Gaps = 8/147 (5%)

Query: 128 VLTSTRAVWYGKITARMKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQTNYYWQG- 186
           +L S   + +GK+    KA+   G+I++F L S   DEID E+ G D  + QTNY+ +G 
Sbjct: 83  ILKSDFYLMFGKVEVEFKAAAGQGIISSFYLQSDDLDEIDLEWTGGDTTEFQTNYFSKGN 142

Query: 187 TLNYNHSTNITVDDVFDDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTDTYRFPQ 246
           T  ++      V    + +HTY +DW ++   + +DG + R+L  + +         +PQ
Sbjct: 143 TTTWDRGAFHGVYTPQEKFHTYTIDWTKEKTDFLLDGALVRSLASDASGG-------YPQ 195

Query: 247 TPSQVHLSIWPGGNATNAPGTIAWAGG 273
           +P  + +  W GG+  N PGTI WAGG
Sbjct: 196 SPMYLIMGCWAGGDPDNQPGTIEWAGG 222

>Scas_720.27
          Length = 388

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 69/155 (44%), Gaps = 15/155 (9%)

Query: 114 NSLILAMPKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAF-ILFSGIQD---EIDFE 169
           + L L + +   GT L S   + YG+I A MKA +   + +    L SG +    E D  
Sbjct: 56  DGLTLTIAERGDGTNLLSNFYILYGRIEAIMKAGNAKSISSEISFLASGTRRDGTEADLF 115

Query: 170 FVG-ADIEKVQTNYYWQGTLNYNHSTNITVDDVFD---DYHTYELDWHEDYITWSVDGTI 225
            +G  D E  +   +     + N +      DV     +YH Y +DW +D +T+ VDG +
Sbjct: 116 TLGWDDGEGDEFETFSTSGGSGNSTDQWETHDVKSPQTEYHNYTIDWTKDKLTFYVDGRV 175

Query: 226 GRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGN 260
            R +        +TD+  FP  P ++ ++    GN
Sbjct: 176 LRVV-------PSTDSAEFPNFPVRIAITHSDDGN 203

>Scas_630.3
          Length = 387

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 66/147 (44%), Gaps = 17/147 (11%)

Query: 114 NSLILAMPKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILFSG---IQDEIDFEF 170
           + L L + ++   T L+S   ++YG+I A +KA +   + +     SG   + D+     
Sbjct: 59  DGLTLTIAESGDSTDLSSDFYIFYGRIEAFVKAGNARSISSEIAFVSGSGAMNDDWRRTL 118

Query: 171 VGADIEKVQTNYYWQGTLNYNHSTNIT-------VDDVFDDYHTYELDWHEDYITWSVDG 223
              D +  + + ++  +   N   N T       V     +YH Y +DW ++ +T+ VDG
Sbjct: 119 FAIDWDDGEGDEFYTFSTAMNSHKNSTAQWETHYVKSPQTEYHNYTIDWTKEKLTFYVDG 178

Query: 224 TIGRTLYKNETYNSTTDTYRFPQTPSQ 250
            + R +        +T T  FP +P++
Sbjct: 179 RVVRVV-------PSTATADFPNSPAR 198

>Scas_647.22
          Length = 386

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 77/175 (44%), Gaps = 18/175 (10%)

Query: 114 NSLILAMPKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILFSG---IQDEIDFEF 170
           + L L + ++   T L S   + YG+I A MKA +   + +     SG   ++D +    
Sbjct: 59  DGLTLTIAESGDSTTLWSNFYILYGRIEAIMKAGNARSISSEIAFESGAGSLRDGMRRSL 118

Query: 171 VGADIEKVQTNYYWQGTLNYNHSTNIT-------VDDVFDDYHTYELDWHEDYITWSVDG 223
              D +  + + ++  + + N   N T       V     +YH Y +DW ++ +T+ VDG
Sbjct: 119 FAIDWDDDEGDGFYTFSTSLNSHRNSTAQWEAHYVKSPQTEYHNYTIDWTKEKLTFYVDG 178

Query: 224 TIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGNATNAPGT-IAWAGGEINW 277
              R +        +T    FP +P++ +++    G+  N+    +   GGE ++
Sbjct: 179 QEVRVV-------PSTAIADFPNSPARFYITHTDDGDLENSDEEYVDMHGGETDY 226

>Scas_721.134
          Length = 384

 Score = 36.2 bits (82), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 78/175 (44%), Gaps = 18/175 (10%)

Query: 114 NSLILAMPKNSGGTVLTSTRAVWYGKITARMKASHLGGVITAFILFSG---IQDEIDFEF 170
           + L L + ++   T L S   + YG+I A +KA +   + ++   FS    I+D      
Sbjct: 56  DGLTLTIAESGDSTDLFSEFYILYGRIEAIVKAGNARSISSSIQFFSAPGTIRDGTSQGL 115

Query: 171 VGADIEKVQTNYYWQGTLNYNHSTNIT-------VDDVFDDYHTYELDWHEDYITWSVDG 223
              D +  + + ++  +   N + NI+       V     +YH Y +DW ++ +T+ VDG
Sbjct: 116 FAIDWDDGEGDEFYTFSTAMNSNKNISTQWETHYVKSPQTEYHNYTIDWTKEKLTFYVDG 175

Query: 224 TIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGNATNAPGT-IAWAGGEINW 277
            + R +        +T T  FP +P +  ++    G+  NA    I   GGE ++
Sbjct: 176 RVVRVV-------PSTATADFPNSPVKFFITHSDDGDPENASAEYIDMHGGETDY 223

>Scas_647.19d
          Length = 387

 Score = 35.4 bits (80), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 79/172 (45%), Gaps = 24/172 (13%)

Query: 109 DYADENSLI-----LAMPKNSGGTV--LTSTRAVWYGKITARMKASHLGGVITAFILFS- 160
           D +D+N++      L M  +  G    L+S   + YG+I A +KA +   + +A   FS 
Sbjct: 47  DESDDNAMTYGSDGLTMTISESGNTRDLSSKFYILYGRIEAIVKAGNARSISSAINFFSP 106

Query: 161 -GIQDEIDFEFVGA-DIEKVQTNYYWQGTLNYNHSTNIT-------VDDVFDDYHTYELD 211
            G +D+   + + A D +  + + ++  + + N   N T       V     +YH Y +D
Sbjct: 107 DGTKDDGSGQGLFAIDWDDGEGDEFYTFSTSVNSHNNSTAQWEAHYVKSPQTEYHNYTID 166

Query: 212 WHEDYITWSVDGTIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGNATN 263
           W ++ +T+ VDG   R +        +T T  FP +P++  ++    G+  N
Sbjct: 167 WTKEKLTFYVDGQEVRVV-------PSTATADFPNSPARFFITHSDQGDLEN 211

>YGL184C (STR3) [1808] chr7 complement(154619..156016) Protein with
           strong similarity to cystathionine beta-lyase,
           transcription is induced by the drug FK506 in a
           GCN4-dependent manner [1398 bp, 465 aa]
          Length = 465

 Score = 32.3 bits (72), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 158 LFSGIQDEIDFE------FVGADIEKVQTN-YYWQGTLNYNHSTNITVDDVFDDYHTYEL 210
           L  GI++ +D +       V ADI +V+ N  Y    LN N + N T+DD+      YE 
Sbjct: 386 LCCGIENIVDLKKDLLAAMVDADIIEVRENGKYLFNKLNKNLAVNTTIDDLHKPLSIYEE 445

Query: 211 DWHEDYI 217
            +++D I
Sbjct: 446 FYNQDLI 452

>YNL238W (KEX2) [4369] chr14 (202427..204871) Endoprotease (yscF) of
           late Golgi compartment involved in processing of
           alpha-factor, cleaves C-terminal to a dibasic sequence
           [2445 bp, 814 aa]
          Length = 814

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 17/72 (23%)

Query: 135 VWYGKITARMKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQTNYYWQGTLNYNHST 194
           +WY  IT         GV+ A +      D +D+E      E ++ N+  +G+ ++N +T
Sbjct: 159 LWYNNITG-------AGVVAAIV-----DDGLDYEN-----EDLKDNFCAEGSWDFNDNT 201

Query: 195 NITVDDVFDDYH 206
           N+    + DDYH
Sbjct: 202 NLPKPRLSDDYH 213

>Scas_710.20
          Length = 659

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 5/50 (10%)

Query: 192 HSTNITVDDVFDDYHT---YELDWHEDYITWSVDGTIGRTLYKNETYNST 238
           H  N+T + +FD  H     EL W+ D++ W +D T  + + KNE +  T
Sbjct: 81  HLPNLT-NVIFDGDHIKAPMELPWYPDHLAWQID-TSKKVIRKNEQFAKT 128

>AAR103C [289] [Homologous to ScYPR135W (CTF4) - SH]
           (527960..530596) [2637 bp, 878 aa]
          Length = 878

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%)

Query: 202 FDDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTDTYRFPQTPSQV 251
           F+D   Y+L    D  T+      G  LY+  ++N T  T R P  PS++
Sbjct: 493 FEDLFGYDLCSLTDEGTFFGQSKTGELLYRVHSFNGTKWTKRIPLAPSEI 542

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,780,135
Number of extensions: 567886
Number of successful extensions: 1525
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1514
Number of HSP's successfully gapped: 40
Length of query: 431
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 327
Effective length of database: 12,995,837
Effective search space: 4249638699
Effective search space used: 4249638699
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)