Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_602.61461467741e-107
YPR017C (DSS4)1431423035e-36
CAGL0K02475g1501522699e-31
Kwal_14.21881371392089e-22
Sklu_1537.21311422035e-21
Kwal_27.1125327148641.2
Sklu_2235.295840613.1
YOR337W (TEA1)75947586.8
KLLA0F27005g53942586.8
Scas_606.177452588.0
KLLA0D08118g161745588.6
Scas_712.54108020579.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_602.6
         (146 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_602.6                                                            302   e-107
YPR017C (DSS4) [5451] chr16 complement(593481..593912) Guanine-n...   121   5e-36
CAGL0K02475g 224263..224715 similar to sp|P32601 Saccharomyces c...   108   9e-31
Kwal_14.2188                                                           85   9e-22
Sklu_1537.2 YPR017C, Contig c1537 1997-2392 reverse complement         83   5e-21
Kwal_27.11253                                                          29   1.2  
Sklu_2235.2 YOR127W, Contig c2235 3952-6828 reverse complement         28   3.1  
YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activa...    27   6.8  
KLLA0F27005g 2491505..2493124 some similarities with sp|P23748 S...    27   6.8  
Scas_606.1                                                             27   8.0  
KLLA0D08118g complement(691907..696760) weakly similar to sp|P53...    27   8.6  
Scas_712.54                                                            27   9.9  

>Scas_602.6
          Length = 146

 Score =  302 bits (774), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 146/146 (100%), Positives = 146/146 (100%)

Query: 1   MSKAICAFGNCGCSIINLNDDKIIQLPGTIFETLHLMQRKQSADIKEGSTTSFLITEDVW 60
           MSKAICAFGNCGCSIINLNDDKIIQLPGTIFETLHLMQRKQSADIKEGSTTSFLITEDVW
Sbjct: 1   MSKAICAFGNCGCSIINLNDDKIIQLPGTIFETLHLMQRKQSADIKEGSTTSFLITEDVW 60

Query: 61  DFDNIGVSKDLMPGISEELNSRANTNTEVSFQHDGNLWYIKKCEKYLICGDCDRGPIGMV 120
           DFDNIGVSKDLMPGISEELNSRANTNTEVSFQHDGNLWYIKKCEKYLICGDCDRGPIGMV
Sbjct: 61  DFDNIGVSKDLMPGISEELNSRANTNTEVSFQHDGNLWYIKKCEKYLICGDCDRGPIGMV 120

Query: 121 CMISQQDDQERRAYLLSLGSLLCKDK 146
           CMISQQDDQERRAYLLSLGSLLCKDK
Sbjct: 121 CMISQQDDQERRAYLLSLGSLLCKDK 146

>YPR017C (DSS4) [5451] chr16 complement(593481..593912)
           Guanine-nucleotide exchange factor for Sec4p [432 bp,
           143 aa]
          Length = 143

 Score =  121 bits (303), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 90/142 (63%), Gaps = 6/142 (4%)

Query: 1   MSKAICAFGNCGCSIINLNDDKIIQLPGTIFETLHLMQRKQSADIKEGSTTSFLITEDVW 60
           MSKA C+F  C  ++I +NDD II LP  +     L++ +   D    S ++FL+  DVW
Sbjct: 1   MSKATCSFEGCHSAVITINDDNIINLPEQVHSEFKLLENRTMRDATP-SESNFLVVPDVW 59

Query: 61  DFDNIGVSKDLMPGISEELNSRANTNTEVSFQHDGNLWYIKKCEKYLICGDCDRGPIGMV 120
           DFDN+GVS+++   I  +L+ +    ++  F++  + W IKKC KYLIC DCD+GPIG++
Sbjct: 60  DFDNVGVSREIPSSILGDLSDK----SDFVFEYGNSSWKIKKCLKYLICADCDKGPIGII 115

Query: 121 CMIS-QQDDQERRAYLLSLGSL 141
           C +  Q  ++ER  +LLSL SL
Sbjct: 116 CKVQDQTKNEERVLHLLSLRSL 137

>CAGL0K02475g 224263..224715 similar to sp|P32601 Saccharomyces
           cerevisiae YPR017c exchange factor for SEC4P,
           hypothetical start
          Length = 150

 Score =  108 bits (269), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 88/152 (57%), Gaps = 16/152 (10%)

Query: 1   MSKAICAFGNCGCSIINL------NDDKIIQLPGTIFETLHLMQRKQSADIKEGSTTSFL 54
           + KA C F  C  S+I++        D++I  PG I E   +M+ ++ AD ++     FL
Sbjct: 7   VRKARCQFTECASSLISVPAVDSKTTDRLIYFPGAIMEKYKIMETREGADAQK--EYEFL 64

Query: 55  ITEDVWDFDNIGVSKDLMPGISEELNSRANTNTEVSFQHDGNLWYIKKCEKYLICGDCDR 114
           +  + WDFDNIGVS+DL   ++E+ +     N E  F+ DG+ W +  C++YL C +CDR
Sbjct: 65  VVPEFWDFDNIGVSRDLCQ-VTEDRD-----NAEFKFEWDGHTWELIHCQRYLACAECDR 118

Query: 115 GPIGMVCMISQQDDQE--RRAYLLSLGSLLCK 144
           GPIG++C +   +D    R+  LLS+ S+ CK
Sbjct: 119 GPIGLLCEVQDANDHSSTRKICLLSIASVDCK 150

>Kwal_14.2188
          Length = 137

 Score = 84.7 bits (208), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 74/139 (53%), Gaps = 9/139 (6%)

Query: 3   KAICAFGNCGCSIINLNDDKIIQLPGTIFETLHLMQRKQSADIKEGSTTSFLITEDVWDF 62
           K  C +  C   I++ +D +  +LP  ++ET  L       +    +   FL+ ED+WDF
Sbjct: 4   KLRCPYTECDSCIVSFDDKRKTKLPLEVYETTKLAIPAGGGE----ANGEFLVFEDIWDF 59

Query: 63  DNIGVSKDLMPGISEELNSRANTNTEVSFQHDGNLWYIKKCEKYLICGDCDRGPIGMVCM 122
           DNIG+S+     I EEL S       +SF  + + + ++K  +Y+IC +CD+GP+G+VC 
Sbjct: 60  DNIGMSRP----IPEELIS-GQEEPPISFSWEQHEYKLRKLLRYIICAECDKGPLGIVCE 114

Query: 123 ISQQDDQERRAYLLSLGSL 141
           +   +       LLSL S+
Sbjct: 115 VENDEGNSMNVNLLSLASV 133

>Sklu_1537.2 YPR017C, Contig c1537 1997-2392 reverse complement
          Length = 131

 Score = 82.8 bits (203), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 74/142 (52%), Gaps = 14/142 (9%)

Query: 1   MSKAICAFGNCGCSIINLNDDKIIQLPGTIFETLHLMQRKQSADIKEGSTTSFLITEDVW 60
           MSK IC F  C C II L     + LP  +++ L+++   +    +      FLI  DVW
Sbjct: 1   MSKLICPFDQCKCCIIPLEKGTQVTLPLQVYKDLNILLPTK----EHCPQGKFLIVNDVW 56

Query: 61  DFDNIGVSKDLMPGISEELNSRANTNTEVSFQHDGNLWYIKKCEKYLICGDCDRGPIGMV 120
           DFDNIGVS+++      E++      T         ++ I +  KYLIC DCD+GP+G+V
Sbjct: 57  DFDNIGVSRNIPDLKGFEMSVSCEEET---------VFTINRVIKYLICADCDKGPLGIV 107

Query: 121 CMISQQDDQERRAY-LLSLGSL 141
           C    +D  + +   LLSL S+
Sbjct: 108 CEARSKDGLDTKVINLLSLESV 129

>Kwal_27.11253
          Length = 271

 Score = 29.3 bits (64), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 3/48 (6%)

Query: 88  EVSFQHDGNLWYIKKCEKYLICGDCDRGPIGMVCMISQQDDQERRAYL 135
           E+ F+   N +  K C  +L  G C   P G  C     +DQ+ + YL
Sbjct: 196 ELKFKERSNKFRTKPCVNWLKTGSC---PYGQRCCFKHGNDQDIKVYL 240

>Sklu_2235.2 YOR127W, Contig c2235 3952-6828 reverse complement
          Length = 958

 Score = 28.1 bits (61), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 57  EDVWDFDNIGVSKDLMPGISEELNSRANTNTEVSFQHDGN 96
           +D+ D D +G+S D MP ++    S+ NT+      HDGN
Sbjct: 383 DDIDDEDTLGISYDSMPIVNN--TSKDNTSNYTDDNHDGN 420

>YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activator
           of the Gal4p-type family of DNA-binding proteins [2280
           bp, 759 aa]
          Length = 759

 Score = 26.9 bits (58), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 5/47 (10%)

Query: 101 KKCEKYLICGDCDRGPIGMVCMISQQDDQERR---AYLLSLGSLLCK 144
           KKC+    CG+C R  + +VC ++ +D +++R    Y+ SL S + +
Sbjct: 78  KKCDLGFPCGNCSR--LELVCNVNDEDLRKKRYTNKYVKSLESHIAQ 122

>KLLA0F27005g 2491505..2493124 some similarities with sp|P23748
           Saccharomyces cerevisiae YMR036c MIH1 M-phase inducing
           protein tyrosine phosphatase singleton, hypothetical
           start
          Length = 539

 Score = 26.9 bits (58), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 22/42 (52%)

Query: 9   GNCGCSIINLNDDKIIQLPGTIFETLHLMQRKQSADIKEGST 50
           G C  S+ ++N+D  I LP  +    H +  +Q+ D  E ++
Sbjct: 400 GTCPVSLSDVNNDYNIPLPNKVTTEEHQLTNEQNIDYDEEAS 441

>Scas_606.1
          Length = 774

 Score = 26.9 bits (58), Expect = 8.0,   Method: Composition-based stats.
 Identities = 11/52 (21%), Positives = 30/52 (57%)

Query: 32  ETLHLMQRKQSADIKEGSTTSFLITEDVWDFDNIGVSKDLMPGISEELNSRA 83
           E ++L+++++  ++    +   L  ED++  DN G ++  +P +  E N+++
Sbjct: 194 EDINLIEKEKEINVSSDESLFNLNDEDLFFIDNEGATESTIPTVHVEENTKS 245

>KLLA0D08118g complement(691907..696760) weakly similar to sp|P53886
           Saccharomyces cerevisiae YNL172w APC1 subunit of
           anaphase-promoting complex (cyclosome) singleton, start
           by similarity
          Length = 1617

 Score = 26.9 bits (58), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 21  DKIIQLPGTIFETLHLMQRKQSADIKEGSTTSFLITEDVWDFDNI 65
           D+ I  P +IF+TL+  +++    +    T S LI +D  D D+I
Sbjct: 619 DQPIDEPPSIFKTLYSARQQSHVPLTPFITLSRLINDDSCDIDDI 663

>Scas_712.54
          Length = 1080

 Score = 26.6 bits (57), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 62  FDNIGVSKDLMPGISEELNS 81
           FD + V KD+   ISE+LNS
Sbjct: 676 FDKVSVKKDVKEAISEQLNS 695

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,023,074
Number of extensions: 203314
Number of successful extensions: 514
Number of sequences better than 10.0: 20
Number of HSP's gapped: 507
Number of HSP's successfully gapped: 20
Length of query: 146
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 54
Effective length of database: 13,411,253
Effective search space: 724207662
Effective search space used: 724207662
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 56 (26.2 bits)