Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_602.4d25625612251e-172
CAGL0L05786g348733051e-32
YPR013C317613012e-32
Scas_602.4266652748e-29
YPR015C247672684e-28
CAGL0J01595g344752726e-28
Scas_707.46338592673e-27
AEL077W336782122e-19
ADL040W330562122e-19
Scas_710.9505662142e-19
ADR308C278532074e-19
KLLA0A04609g423612115e-19
Scas_656.1*102541931e-18
KLLA0F20636g285522032e-18
Sklu_2398.2288561901e-16
ADL042W281641831e-15
Kwal_26.8011190591729e-15
KLLA0F11682g374511781e-14
Scas_718.36d330531752e-14
Kwal_14.2206254571722e-14
Scas_717.18354581743e-14
Scas_717.17d350511682e-13
AGL207W277531662e-13
ADL050W146551602e-13
CAGL0M01870g315511629e-13
ADL051W173551561e-12
KLLA0F22319g203481571e-12
AGR186C287741601e-12
Sklu_2244.3271541547e-12
Kwal_27.10467302511531e-11
CAGL0E01331g689691302e-08
CAGL0M04323g703671284e-08
AGL197W844651275e-08
CAGL0L03916g642691251e-07
Scas_697.35839721222e-07
CAGL0M06831g645551222e-07
KLLA0B00605g239581184e-07
ACR264W769691204e-07
AEL174W661591195e-07
Kwal_56.23925745651195e-07
AFR471C389601185e-07
YOR113W (AZF1)914551196e-07
Kwal_14.2543711541187e-07
YER028C394591177e-07
Sklu_2389.2767551179e-07
YNL027W (CRZ1)678551171e-06
Scas_711.56832551171e-06
YGL209W (MIG2)382601151e-06
CAGL0A01628g424511132e-06
Scas_687.33288521123e-06
Kwal_47.17888786691143e-06
Kwal_47.19045266621113e-06
Scas_713.52620511133e-06
KLLA0F23782g782721125e-06
CAGL0K12078g463541116e-06
YGL035C (MIG1)504511107e-06
ABR089C571601108e-06
YJL056C (ZAP1)880551091e-05
Kwal_14.2278463511081e-05
YDR146C (SWI5)709651091e-05
Sklu_2351.6548511081e-05
ADL198W547551081e-05
Scas_712.42*290521061e-05
KLLA0E10989g474521071e-05
Scas_695.2571551072e-05
CAGL0J05060g713551072e-05
Scas_693.31635651053e-05
Scas_709.32822601053e-05
CAGL0C02519g318521043e-05
KLLA0A10373g206571024e-05
KLLA0D16456g854511054e-05
YLR131C (ACE2)770581044e-05
KLLA0F01463g781551035e-05
Kwal_27.11460531551035e-05
Scas_575.3455511026e-05
Kwal_23.5400429541018e-05
CAGL0F05995g597541011e-04
CAGL0M13189g541551001e-04
Scas_712.232756991e-04
Scas_569.229370991e-04
CAGL0K09372g39652991e-04
Kwal_26.8351698581002e-04
CAGL0I02816g29148982e-04
Sklu_2289.129152982e-04
KLLA0E08679g59655973e-04
YMR037C (MSN2)70471973e-04
CAGL0K02145g31752963e-04
YKL062W (MSN4)63055974e-04
CAGL0H07557g47653964e-04
Scas_649.2873055964e-04
Kwal_47.1724140352955e-04
CAGL0L07480g31455945e-04
KLLA0F26961g69455956e-04
YGL254W (FZF1)29953928e-04
YDR043C (NRG1)23154919e-04
KLLA0F18524g35766920.001
Scas_718.4426667900.001
CAGL0M00594g102061920.002
Scas_602.954752910.002
YPR186C (PZF1)42952900.002
CAGL0G10021g39478880.003
KLLA0E18645g43150890.003
AGL071C39655880.003
AER159C119147890.003
Scas_707.3128955870.004
KLLA0B04477g133247880.005
Sklu_2443.2221347850.005
Kwal_27.1092526454860.005
Kwal_26.802150750860.008
AGR031W14054810.010
CAGL0H04213g132147840.012
Sklu_2181.141052830.014
KLLA0B03454g47248830.015
ACL057W52052830.016
KLLA0F07073g55867820.020
YER130C44352810.024
KLLA0C17072g47452810.026
Kwal_47.16621117847820.027
Scas_631.743346810.029
Scas_721.92115266810.030
Sklu_2357.715751780.031
CAGL0K03003g64751810.031
Scas_703.23134161810.033
Kwal_27.1016728553790.040
YDR216W (ADR1)132347790.053
Scas_717.1752554790.054
YBR066C (NRG2)22060770.056
CAGL0L06072g30053770.066
AEL278W47673760.11
CAGL0E06116g61357760.11
YMR070W (MOT3)49050750.14
YML081W125147760.14
Sklu_2206.235860750.15
CAGL0K02343g116259750.16
CAGL0K04697g51560740.19
Scas_670.243564740.20
CAGL0E03762g58475740.23
YPR022C113362730.29
Scas_378.120850710.31
KLLA0B07909g92261730.32
YDL048C (STP4)49060720.41
Kwal_47.1657788135720.42
YJR127C (ZMS1)138047700.64
KLLA0E00726g51778700.65
Scas_683.2587956700.71
YMR182C (RGM1)21146680.72
CAGL0H04873g45162690.80
KLLA0F13046g137947700.83
Scas_683.3047863690.86
CAGL0K04631g101353690.92
Scas_627.6120762691.0
Scas_719.68135053681.3
YPL230W39130671.3
Kwal_55.2063441975661.7
Sklu_2126.544824661.7
AFR580C83860661.9
Sklu_2359.572262661.9
Scas_641.2453235662.3
KLLA0C16005g33146652.4
YGR067C79453643.6
YHL027W (RIM101)62575643.9
Scas_720.3331656626.2
Kwal_26.930030461617.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_602.4d
         (256 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_602.4d                                                           476   e-172
CAGL0L05786g complement(636176..637222) some similarities with t...   122   1e-32
YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putati...   120   2e-32
Scas_602.4                                                            110   8e-29
YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protei...   107   4e-28
CAGL0J01595g 151584..152618 some similarities with tr|Q12531 Sac...   109   6e-28
Scas_707.46                                                           107   3e-27
AEL077W [2429] [Homologous to NOHBY] complement(483028..484038) ...    86   2e-19
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    86   2e-19
Scas_710.9                                                             87   2e-19
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    84   4e-19
KLLA0A04609g complement(411494..412765) some similarities with s...    86   5e-19
Scas_656.1*                                                            79   1e-18
KLLA0F20636g complement(1914452..1915309) some similarities with...    83   2e-18
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                78   1e-16
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    75   1e-15
Kwal_26.8011                                                           71   9e-15
KLLA0F11682g complement(1068992..1070116) some similarities with...    73   1e-14
Scas_718.36d                                                           72   2e-14
Kwal_14.2206                                                           71   2e-14
Scas_717.18                                                            72   3e-14
Scas_717.17d                                                           69   2e-13
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    69   2e-13
ADL050W [1691] [Homologous to NOHBY] complement(597229..597669) ...    66   2e-13
CAGL0M01870g complement(219813..220760) some similarities with t...    67   9e-13
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    65   1e-12
KLLA0F22319g complement(2086613..2087224) some similarities with...    65   1e-12
AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,...    66   1e-12
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                64   7e-12
Kwal_27.10467                                                          64   1e-11
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    55   2e-08
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    54   4e-08
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    54   5e-08
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    53   1e-07
Scas_697.35                                                            52   2e-07
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    52   2e-07
KLLA0B00605g complement(46736..47455) some similarities with sp|...    50   4e-07
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    51   4e-07
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    50   5e-07
Kwal_56.23925                                                          50   5e-07
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    50   5e-07
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    50   6e-07
Kwal_14.2543                                                           50   7e-07
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    50   7e-07
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            50   9e-07
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    50   1e-06
Scas_711.56                                                            50   1e-06
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    49   1e-06
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    48   2e-06
Scas_687.33                                                            48   3e-06
Kwal_47.17888                                                          49   3e-06
Kwal_47.19045                                                          47   3e-06
Scas_713.52                                                            48   3e-06
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    48   5e-06
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    47   6e-06
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    47   7e-06
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    47   8e-06
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    47   1e-05
Kwal_14.2278                                                           46   1e-05
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    47   1e-05
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       46   1e-05
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    46   1e-05
Scas_712.42*                                                           45   1e-05
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    46   1e-05
Scas_695.2                                                             46   2e-05
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    46   2e-05
Scas_693.31                                                            45   3e-05
Scas_709.32                                                            45   3e-05
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    45   3e-05
KLLA0A10373g complement(907244..907864) some similarities with c...    44   4e-05
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    45   4e-05
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    45   4e-05
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    44   5e-05
Kwal_27.11460                                                          44   5e-05
Scas_575.3                                                             44   6e-05
Kwal_23.5400                                                           44   8e-05
CAGL0F05995g complement(598819..600612) some similarities with s...    44   1e-04
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    43   1e-04
Scas_712.2                                                             43   1e-04
Scas_569.2                                                             43   1e-04
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    43   1e-04
Kwal_26.8351                                                           43   2e-04
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    42   2e-04
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          42   2e-04
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    42   3e-04
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    42   3e-04
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    42   3e-04
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    42   4e-04
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    42   4e-04
Scas_649.28                                                            42   4e-04
Kwal_47.17241                                                          41   5e-04
CAGL0L07480g complement(822240..823184) some similarities with s...    41   5e-04
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    41   6e-04
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    40   8e-04
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    40   9e-04
KLLA0F18524g complement(1701498..1702571) some similarities with...    40   0.001
Scas_718.44                                                            39   0.001
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    40   0.002
Scas_602.9                                                             40   0.002
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    39   0.002
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    39   0.003
KLLA0E18645g complement(1648263..1649558) some similarities with...    39   0.003
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    39   0.003
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    39   0.003
Scas_707.31                                                            38   0.004
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    39   0.005
Sklu_2443.22 , Contig c2443 45390-46027                                37   0.005
Kwal_27.10925                                                          38   0.005
Kwal_26.8021                                                           38   0.008
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    36   0.010
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    37   0.012
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            37   0.014
KLLA0B03454g complement(314015..315433) some similarities with s...    37   0.015
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    37   0.016
KLLA0F07073g 675221..676897 some similarities with sgd|S0004367 ...    36   0.020
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    36   0.024
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    36   0.026
Kwal_47.16621                                                          36   0.027
Scas_631.7                                                             36   0.029
Scas_721.92                                                            36   0.030
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        35   0.031
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    36   0.031
Scas_703.23                                                            36   0.033
Kwal_27.10167                                                          35   0.040
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    35   0.053
Scas_717.17                                                            35   0.054
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    34   0.056
CAGL0L06072g complement(679924..680826) some similarities with s...    34   0.066
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    34   0.11 
CAGL0E06116g complement(604708..606549) some similarities with t...    34   0.11 
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    33   0.14 
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    34   0.14 
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            33   0.15 
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    33   0.16 
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    33   0.19 
Scas_670.2                                                             33   0.20 
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    33   0.23 
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    33   0.29 
Scas_378.1                                                             32   0.31 
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    33   0.32 
YDL048C (STP4) [816] chr4 complement(366739..368211) Protein wit...    32   0.41 
Kwal_47.16577                                                          32   0.42 
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    32   0.64 
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    32   0.65 
Scas_683.25                                                            32   0.71 
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    31   0.72 
CAGL0H04873g complement(465069..466424) some similarities with t...    31   0.80 
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    32   0.83 
Scas_683.30                                                            31   0.86 
CAGL0K04631g complement(440721..443762) some similarities with s...    31   0.92 
Scas_627.6                                                             31   1.0  
Scas_719.68                                                            31   1.3  
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    30   1.3  
Kwal_55.20634                                                          30   1.7  
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            30   1.7  
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    30   1.9  
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          30   1.9  
Scas_641.24                                                            30   2.3  
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    30   2.4  
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    29   3.6  
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    29   3.9  
Scas_720.33                                                            28   6.2  
Kwal_26.9300                                                           28   7.6  

>Scas_602.4d
          Length = 256

 Score =  476 bits (1225), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 239/256 (93%), Positives = 239/256 (93%)

Query: 1   MTLSNPQISTVMYQNSSPLNQYQMNITPNTKISKPNKFTSSRSHFNTSYNKSLEPNHSST 60
           MTLSNPQISTVMYQNSSPLNQYQMNITPNTKISKPNKFTSSRSHFNTSYNKSLEPNHSST
Sbjct: 1   MTLSNPQISTVMYQNSSPLNQYQMNITPNTKISKPNKFTSSRSHFNTSYNKSLEPNHSST 60

Query: 61  NNYNLRSSVVLPSISTLVSDVYHQPAQTNSVVSTPESSYQYMNYPSTTQYGVYNPITLPI 120
           NNYNLRSSVVLPSISTLVSDVYHQPAQTNSVVSTPESSYQYMNYPSTTQYGVYNPITLPI
Sbjct: 61  NNYNLRSSVVLPSISTLVSDVYHQPAQTNSVVSTPESSYQYMNYPSTTQYGVYNPITLPI 120

Query: 121 GISMPPVPVIQLQLANTIPVQQFQQVVNSPPQALPVVRXXXXXXXXXXXXXXXXXMIHQH 180
           GISMPPVPVIQLQLANTIPVQQFQQVVNSPPQALPVVR                 MIHQH
Sbjct: 121 GISMPPVPVIQLQLANTIPVQQFQQVVNSPPQALPVVRSSSLPSTTSTSTSNSNNMIHQH 180

Query: 181 LSKVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNM 240
           LSKVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNM
Sbjct: 181 LSKVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNM 240

Query: 241 FRHLKCHERKKNKKLQ 256
           FRHLKCHERKKNKKLQ
Sbjct: 241 FRHLKCHERKKNKKLQ 256

>CAGL0L05786g complement(636176..637222) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 348

 Score =  122 bits (305), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 53/73 (72%), Positives = 59/73 (80%)

Query: 184 VYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           V    +L K  K+CPVCGK+CSRPSTLKTH+LIHTGDTPFKC +  CKK+FNVKSNM RH
Sbjct: 274 VSAIDELSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRH 333

Query: 244 LKCHERKKNKKLQ 256
           LKCHERKK  K Q
Sbjct: 334 LKCHERKKQAKAQ 346

>YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putative
           transcription factor with similarity to mouse REX1
           encoded transcription factor, has two tandem C2H2-type
           zinc fingers [954 bp, 317 aa]
          Length = 317

 Score =  120 bits (301), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 51/61 (83%), Positives = 56/61 (91%)

Query: 195 KECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNKK 254
           K+CPVCGK+CSRPSTLKTH+LIHTGDTPFKCT+ GC KSFNVKSNM RHLK HERK+NK 
Sbjct: 254 KQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRNKV 313

Query: 255 L 255
           L
Sbjct: 314 L 314

>Scas_602.4
          Length = 266

 Score =  110 bits (274), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (81%)

Query: 190 LMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           L K  K+CP CGK+CSRPSTLK H+LIHTGDTPFKCT+  C K+FNVKSNM RHLK HE+
Sbjct: 195 LSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254

Query: 250 KKNKK 254
           K  KK
Sbjct: 255 KVIKK 259

>YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protein
           with similarity to human GT box-binding protein
           (SP:B44489), has two tandem C2H2-type zinc fingers [744
           bp, 247 aa]
          Length = 247

 Score =  107 bits (268), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%)

Query: 188 QQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           + ++K  K+CP+CGK+CSRPSTL+TH+LIHTGDTPFKCT+  C KSFNVKSNM RHL+ H
Sbjct: 178 RAVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237

Query: 248 ERKKNKK 254
           ++K  KK
Sbjct: 238 QKKIAKK 244

>CAGL0J01595g 151584..152618 some similarities with tr|Q12531
           Saccharomyces cerevisiae YPR015c or tr|Q12145
           Saccharomyces cerevisiae YPR013c, hypothetical start
          Length = 344

 Score =  109 bits (272), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 60/75 (80%), Gaps = 1/75 (1%)

Query: 181 LSKVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNM 240
           L+K  +++   +  K+CPVCGK+CSRPSTLKTH LIHTGDTPFKCT+  C+K+FNVKSN+
Sbjct: 270 LTKRQLKKATTRLRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNL 329

Query: 241 FRHLKCHERKK-NKK 254
            RHLK HE+   NKK
Sbjct: 330 LRHLKSHEKNSLNKK 344

>Scas_707.46
          Length = 338

 Score =  107 bits (267), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 44/59 (74%), Positives = 51/59 (86%)

Query: 195 KECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNK 253
           K+CPVCGK+CSRPSTLKTH+LIHTGDTPF+C +  C KSFNVKSNM RHLK H++K  K
Sbjct: 270 KQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAK 328

>AEL077W [2429] [Homologous to NOHBY] complement(483028..484038)
           [1011 bp, 336 aa]
          Length = 336

 Score = 86.3 bits (212), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 53/78 (67%), Gaps = 2/78 (2%)

Query: 179 QHLSKVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKS 238
           + LS     Q+ ++N  +CPVCGK+C RPS+L+ H  IHTG  PF C + GC+K FNVKS
Sbjct: 260 EQLSSADKRQKGVRN--QCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKS 317

Query: 239 NMFRHLKCHERKKNKKLQ 256
           NM RH + H+ ++ K+ Q
Sbjct: 318 NMVRHYRLHQLQRGKEGQ 335

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 86.3 bits (212), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 35/56 (62%), Positives = 45/56 (80%)

Query: 195 KECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           K C VCG+ C+RPSTLKTH LIHTG+ PF+C++ GC K FNV+SNM RH+  H+R+
Sbjct: 258 KTCLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSHKRR 313

>Scas_710.9
          Length = 505

 Score = 87.0 bits (214), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%)

Query: 187 EQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKC 246
           E Q  K  K+C +CGK+ +R S+L+TH LIHTG  PF CT+ GCKK+FNVKSNM RHLK 
Sbjct: 439 ELQTRKRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKL 498

Query: 247 HERKKN 252
           H  K++
Sbjct: 499 HLIKED 504

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 84.3 bits (207), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (71%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           C VCG+ C RPSTLKTH L HTG  PF C + GC KSFNV+SNM RH + H R
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLHSR 258

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 85.9 bits (211), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 2/61 (3%)

Query: 190 LMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           L KN  +C +CG++CSRPSTL+TH  IHTGD P+KC    C K FNVKSNM RH K HE 
Sbjct: 338 LKKN--QCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRHEF 395

Query: 250 K 250
           K
Sbjct: 396 K 396

>Scas_656.1*
          Length = 102

 Score = 79.0 bits (193), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (79%)

Query: 194 TKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           +++CP+CGK+ +R S+L+TH L+HTGD PFKC +  C K+FNVKSNM RH K H
Sbjct: 39  SRQCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLH 92

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 82.8 bits (203), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 32/52 (61%), Positives = 40/52 (76%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHE 248
           C  CGK  +RPS L+TH L+H+GD PF+CT+ GC K FNVKSN+ RHLK H+
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLHK 285

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 77.8 bits (190), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (69%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKN 252
           CP CGK   RPS LKTH +IH G +P+ CT++GC K FNVK N+ RH + H +KK 
Sbjct: 220 CPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTKKKE 275

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 75.1 bits (183), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 40/64 (62%)

Query: 185 YVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHL 244
           Y      KN   C +CGK   RPS L+TH ++H  D P+ C + GC+K FNVKSNM RH+
Sbjct: 215 YRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274

Query: 245 KCHE 248
           + H+
Sbjct: 275 RKHK 278

>Kwal_26.8011
          Length = 190

 Score = 70.9 bits (172), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNKK 254
           +C +C K+ SR S L+ H L HTG  PF+C +  C K+FNVKSNM RHLK H++ + ++
Sbjct: 129 QCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTHKQPEVRR 187

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/51 (60%), Positives = 34/51 (66%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           C  CGK  +RPS+L TH  IHTGD P+KC Y  C K FN KSNM RH K H
Sbjct: 306 CAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLH 356

>Scas_718.36d
          Length = 330

 Score = 72.0 bits (175), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 36/53 (67%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           C VCGK   RPS+L+TH  I +G+ P+KC Y  C KSFN KSNM RH K H R
Sbjct: 241 CDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKLHFR 293

>Kwal_14.2206
          Length = 254

 Score = 70.9 bits (172), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 37/57 (64%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKN 252
           EC +CGK  SRPS L TH LIHTG  P+ C    C K FNVKSN+ RH K H + ++
Sbjct: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251

>Scas_717.18
          Length = 354

 Score = 71.6 bits (174), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 43/58 (74%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNK 253
           +CP+C K+ +R ++L++H LIHTG+ P+KCT+  C  S +VKSN+ RH K H + +N+
Sbjct: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQNQ 354

>Scas_717.17d
          Length = 350

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 37/51 (72%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           C VCGK  +R ++L+TH LIHTG  PFKC++  CK S +VKSN+ RH K H
Sbjct: 287 CVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSH 337

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 68.6 bits (166), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 35/53 (66%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           C  CGK  +R S+L+TH  IHTGD PF C +  C KSFN +SNM RH K H R
Sbjct: 185 CTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFR 237

>ADL050W [1691] [Homologous to NOHBY] complement(597229..597669)
           [441 bp, 146 aa]
          Length = 146

 Score = 66.2 bits (160), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 37/55 (67%)

Query: 193 NTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           N+K CPVC K  +R ++L TH LIH    P+ C Y  C KSFNVKSN+ RHL+ H
Sbjct: 74  NSKTCPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIH 128

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 67.0 bits (162), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 33/51 (64%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           C VC K   RPS+L TH  IHTG+ P+ C +  C KSFN KSNM RH K H
Sbjct: 175 CKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLH 225

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (70%)

Query: 195 KECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           K C +C K  +R ++L+TH LIHT   P++C Y  C K+FNVKSN++RH + H+R
Sbjct: 116 KTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIHKR 170

>KLLA0F22319g complement(2086613..2087224) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 203

 Score = 65.1 bits (157), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 36/48 (75%)

Query: 201 GKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHE 248
           GK  SRPSTLKTH ++H+   PFKCTY  C KS+NVKSN+ RH K H+
Sbjct: 152 GKEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKKHK 199

>AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,
           287 aa]
          Length = 287

 Score = 66.2 bits (160), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query: 182 SKVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMF 241
           S+    + L+  +K CP+CGK  +R STL+ H LIHT   PFKC++  C K FNVKSN+ 
Sbjct: 154 SQTSSNRGLIFVSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLN 211

Query: 242 RHLKCHERKKNKKL 255
           RH + H +K +  L
Sbjct: 212 RHERIHRQKASPPL 225

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 63.9 bits (154), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 34/54 (62%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           CP C K   RPS L+TH +IH G  PF C +  C K FNVKSN+ RH + H R+
Sbjct: 218 CPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYRSHNRE 271

>Kwal_27.10467
          Length = 302

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 33/51 (64%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           C  CGK+ +RPS+L TH   HTGD P+ C +  C K FN +SNM RH K H
Sbjct: 200 CTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLH 250

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 184 VYVEQQLMKNTKEC--PVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMF 241
           VYV ++L     EC  P CGK   R   +++H   H  D P++C Y GC K+F    ++ 
Sbjct: 546 VYV-KELPDRMYECLYPQCGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLV 604

Query: 242 RHLKCHERK 250
           RH K H+ K
Sbjct: 605 RHKKTHQEK 613

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 185 YVEQQLMKNTKEC--PVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFR 242
           YV++   KN  EC  P CGK   R   +K+H   H  D P+KC + GC K+F    ++ R
Sbjct: 514 YVKELPDKNF-ECLFPNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLAR 572

Query: 243 HLKCHER 249
           H K H++
Sbjct: 573 HKKTHDK 579

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 188 QQLMKNTKEC--PVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLK 245
           ++L   T +C  P CGK+ +R   +++H   H  D PF+C + GC K+F    ++ RH K
Sbjct: 667 KKLQDKTFQCLYPECGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRHKK 726

Query: 246 CHERK 250
            H  K
Sbjct: 727 THAEK 731

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 180 HLSKVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSN 239
           HL  V+++  +     EC  CGK  ++   L+TH  +HTG+ PFKC    C K+F  + N
Sbjct: 494 HLD-VHIKAHMGYKPFECEFCGKRFTQAGNLRTHRRLHTGERPFKCDK--CDKTFARRGN 550

Query: 240 MFRHLKCHE 248
           +  H   HE
Sbjct: 551 LTAHEFTHE 559

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           +C  C KM S+ + L  H   H G  PF+C +  C K F    N+  H + H  ++
Sbjct: 481 QCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLHTGER 534

>Scas_697.35
          Length = 839

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 180 HLSKVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSN 239
           HL +V++   L     +C  CGK  ++   L+TH  +HTG+ P++C    C K F+ K N
Sbjct: 529 HL-EVHIRSHLGYKPYQCGYCGKRFTQGGNLRTHQRLHTGEKPYECEL--CDKKFSRKGN 585

Query: 240 MFRHLKCHERKK 251
           +  HL  H++ K
Sbjct: 586 LAAHLLTHQKVK 597

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 21/48 (43%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           EC +C K  SR   L  H L H    PF C    C +SF    NM  H
Sbjct: 572 ECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAH 619

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           +CP C ++ ++ + L+ H   H G  P++C Y  C K F    N+  H + H  +K
Sbjct: 516 KCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNLRTHQRLHTGEK 569

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           C VCGK+ SRP  LK+H   HT + P++C+   C K+F  + +  RH   H  KK
Sbjct: 523 CEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLHTGKK 575

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 7/63 (11%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKC-------TYHGCKKSFNVKSNMFRHLKCHE 248
           +C +CGK  +R    K H  +HTG   + C       T+ GC K F     + RH K   
Sbjct: 550 QCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHFKTSS 609

Query: 249 RKK 251
            +K
Sbjct: 610 GRK 612

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNKK 254
           C +CG    R      H   HTG+ PF CT  GC K F+    + RH+K H + + +K
Sbjct: 14  CEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFKSRKRK 71

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 180 HLSKVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSN 239
           HL +V+V   +     +C  CGK  ++   L+TH  +HTG+ P++C    C K F+ K N
Sbjct: 501 HL-EVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGERPYECDK--CGKRFSRKGN 557

Query: 240 MFRHLKCHE 248
           +  H+  HE
Sbjct: 558 LAAHMLTHE 566

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 22/48 (45%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           EC  CGK  SR   L  H L H    PF+C    C KSF    NM  H
Sbjct: 544 ECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAH 591

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           +CP C K  ++ + L+ H   H G  PF+C Y  C K F    N+  H++ H
Sbjct: 488 KCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 537

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNKKL 255
           C  C K  S  S+L+ H   HTG+ P  CT   C K FN  SN+ +H+K HERK   KL
Sbjct: 574 CHYCRKQFSTSSSLRVHIRTHTGEKPLSCTV--CGKRFNESSNLSKHMKIHERKYMCKL 630

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           CP C K  S    L  H   H+G+ PF C Y  C+K F+  S++  H++ H  +K
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVHIRTHTGEK 598

>Kwal_56.23925
          Length = 745

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 188 QQLMKNTKEC--PVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLK 245
           ++L   T EC  P CGK   R   +++H   H  D P+ C + GC K+F    ++ RH K
Sbjct: 578 KELPDKTFECLHPDCGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKK 637

Query: 246 CHERK 250
            H  K
Sbjct: 638 THAEK 642

 Score = 28.5 bits (62), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query: 202 KMCSRPSTLK----THFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           K+  +P+TL       F+    D  F+C +  C K+F  + N+  H++ H
Sbjct: 560 KITKKPTTLPPGEIDKFVKELPDKTFECLHPDCGKTFRRRYNIRSHIQTH 609

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 50.1 bits (118), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHE--RKKNKK 254
           CP+C +   R      H   HTG+ P  C + GC K F+ +  + RH + HE  R K K+
Sbjct: 24  CPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIHESDRPKGKR 83

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           C  CGK  ++   L+TH  +HTG+ P+ C    C K F+ K N+  HL  H++ K
Sbjct: 623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQKLK 675

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           ECP C ++ S+ + L+ H   H G  PF C Y  C K F    N+  H + H  +K
Sbjct: 594 ECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLHTGEK 647

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 20/47 (42%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           C +C K  SR   L  H + H    PF C    C K+F    NM  H
Sbjct: 651 CDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 697

>Kwal_14.2543
          Length = 711

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           C  CGK  +  S+L+ H   HTG+ P +C    C K FN  SN+ +H++ HERK
Sbjct: 636 CSHCGKGFATSSSLRIHIRTHTGEKPLECKV--CGKRFNESSNLSKHMRTHERK 687

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 4/61 (6%)

Query: 183 KVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFR 242
           ++++     +   EC VCGK  +  S L  H   H  +  +KC    CK+SF+ K  +  
Sbjct: 650 RIHIRTHTGEKPLECKVCGKRFNESSNLSKHMRTH--ERKYKCQK--CKRSFDFKEQLEV 705

Query: 243 H 243
           H
Sbjct: 706 H 706

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 200 CGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           CG++ ++   L  H  +HT   P KC +  C K+F+ +  + +H++ H  +K
Sbjct: 583 CGRVITQRQKLLRHLRVHTRYKPCKCVH--CLKTFSTQDILQQHMRTHSGEK 632

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 49.7 bits (117), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNKK 254
            C +C +   R    K H   HTG+ P KCT  GC KSF+    + RHL+ H +   ++
Sbjct: 18  RCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTKGVQRR 76

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           +C  C K  +  S+L+ H   HTG+ P KC    C K FN  SN+ +H+K HERK
Sbjct: 687 KCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI--CGKRFNESSNLSKHMKTHERK 739

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 200 CGKMCSRPSTLKTHFL---IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           C ++   P  L  H     I  G + ++C++  C KSF  +  + RHLK H
Sbjct: 602 CSQVFPNPEALNNHIESQHIPRGQSSYQCSWDTCSKSFTQRQKLLRHLKVH 652

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 199 VCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
            C K  ++   L  H  +H+G  PFKC +  C K F+ +  + +H++ H  ++
Sbjct: 634 TCSKSFTQRQKLLRHLKVHSGYKPFKCPH--CTKKFSTEDILQQHIRTHSGER 684

 Score = 28.5 bits (62), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 4/53 (7%)

Query: 183 KVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFN 235
           ++++     +   +C +CGK  +  S L  H   H  +  +KC    CK+SFN
Sbjct: 702 RIHIRTHTGEKPLKCKICGKRFNESSNLSKHMKTH--ERKYKCE--KCKRSFN 750

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           C VCGK  +RP  LK+H   HT + PF C+   C K+F  + +  RH   H  KK
Sbjct: 571 CDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGKK 623

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 25/62 (40%), Gaps = 7/62 (11%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYH-------GCKKSFNVKSNMFRHLKCHER 249
           C +CGK  +R    K H  +HTG   + C          GC K F     + RH K    
Sbjct: 599 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESG 658

Query: 250 KK 251
           ++
Sbjct: 659 RR 660

>Scas_711.56
          Length = 832

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           +C +CGK  +  S+LK H   HTG+ P  C    C K+FN  SN+ +H+K H ++
Sbjct: 755 KCDICGKRFAISSSLKIHIRTHTGEKPLHCKI--CGKAFNESSNLSKHMKTHLKR 807

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           +C +C K  S   TLK H   H+G+ PFKC    C K F + S++  H++ H  +K
Sbjct: 727 QCSICKKHFSNEETLKQHERTHSGEKPFKCDI--CGKRFAISSSLKIHIRTHTGEK 780

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 200 CGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           C K+ S+   L  H  +H+G  PF+C+   CKK F+ +  + +H + H  +K
Sbjct: 703 CHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERTHSGEK 752

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 26/61 (42%), Gaps = 4/61 (6%)

Query: 183 KVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFR 242
           K+++     +    C +CGK  +  S L  H   H     FKC    C+ SFN  S +  
Sbjct: 770 KIHIRTHTGEKPLHCKICGKAFNESSNLSKHMKTHL--KRFKCE--KCEASFNTVSKLRS 825

Query: 243 H 243
           H
Sbjct: 826 H 826

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNKKLQ 256
           C  C +   R    K H   HTG+ P  C + GC KSF+    + RH++ H  +  ++L+
Sbjct: 19  CDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQRRLK 78

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           CP+CG+   R      H   HTG+ P  C + GC K F+    + RH + H
Sbjct: 45  CPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 95

>Scas_687.33
          Length = 288

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
            CP+C +   R    K H   HTG+ P  CT+  C KSF+    + RH++ H
Sbjct: 18  RCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIH 69

>Kwal_47.17888
          Length = 786

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 180 HLSKVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSN 239
           HL +V+V   +     +C  CGK  ++   L+TH  +HTG+ P++C    C + F+ K N
Sbjct: 517 HL-EVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEKPYECEK--CGRRFSRKGN 573

Query: 240 MFRHLKCHE 248
           +  H   HE
Sbjct: 574 LAAHRLTHE 582

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 22/48 (45%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           EC  CG+  SR   L  H L H    PF C   GC KSF    NM  H
Sbjct: 560 ECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAH 607

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 186 VEQQLMKNTK--ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           VE+   +  K  ECP C K  ++ + L+ H   H G  PF+C Y  C K F    N+  H
Sbjct: 492 VEKPKARGAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTH 549

Query: 244 LKCHERKK 251
           ++ H  +K
Sbjct: 550 VRLHTGEK 557

>Kwal_47.19045
          Length = 266

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH---ERKKN 252
           +C +CGK   R    + H   HTG+ P  C + GC K F+    + RH++ H    R K 
Sbjct: 15  KCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTHMSTSRGKG 74

Query: 253 KK 254
           +K
Sbjct: 75  RK 76

>Scas_713.52
          Length = 620

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 200 CGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           CGK+  R   +++H   H  D P+ C + GC+K+F    ++ RH K H  +
Sbjct: 487 CGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSHANR 537

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 6/70 (8%)

Query: 186 VEQQLMKNTKECPVCGKMCSRPSTLKTH----FLIHTGDTPFKCTYHGCKKSFNVKSNMF 241
           V+QQ     K  P   ++ ++PSTL       ++    D  F+C Y  C K F  + N+ 
Sbjct: 441 VKQQQRTPIKTSPT--RITNKPSTLPRGTIDLYVKELPDKLFECLYEDCGKIFKRRYNVR 498

Query: 242 RHLKCHERKK 251
            H++ H   K
Sbjct: 499 SHIQTHLEDK 508

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 3/72 (4%)

Query: 180 HLSKVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSN 239
           HL +V+V   +      C  CGK  ++   L+TH  +HTG+ P++C    C + F+ K N
Sbjct: 537 HL-EVHVRSHIGYKPFSCEFCGKRFTQGGNLRTHIRLHTGEKPYECER--CGRKFSRKGN 593

Query: 240 MFRHLKCHERKK 251
           +  H   H+  K
Sbjct: 594 LAAHKLTHDNLK 605

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 22/48 (45%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           EC  CG+  SR   L  H L H    PF+C    C K+F    NM  H
Sbjct: 580 ECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAH 627

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           +CP C K  ++ + L+ H   H G  PF C +  C K F    N+  H++ H  +K
Sbjct: 524 QCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLHTGEK 577

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           C VCGK  +    L  H  IHTG+    C Y GC + FN   N  +H K H ++
Sbjct: 404 CKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTHLKR 457

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           CP+C +   R      H  IHTG+ P  C + GC K F+    + RH + H
Sbjct: 40  CPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 196 ECPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNKK 254
           +C  C K   R   LK H   +H+ D PF CTY  C K F+   N+ +HLK H +  + K
Sbjct: 505 KCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLKTHRKHGDIK 562

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           +C +C K  +  S+LK H   HTG+ P +C    C K FN  SN+ +H+K H++K
Sbjct: 797 KCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHQKK 849

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           +C  C +  S   TL  H   H+G+ P+KC  H C K F + S++  H++ H  +K
Sbjct: 769 KCKTCKRCFSSEETLVQHTRTHSGEKPYKC--HICNKKFAISSSLKIHIRTHTGEK 822

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 200 CGKMCSRPSTLKTHF-LIH--TGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           C K  S    L  H   +H   G + ++C +H C ++F  +  + RHLK H + K
Sbjct: 712 CNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYK 766

>Kwal_14.2278
          Length = 463

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           CP+C +   R      H   HTG+ P  C + GC K F+    + RH + H
Sbjct: 25  CPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRIH 75

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 188 QQLMKNTKEC--PVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLK 245
           +++   T EC  P C K   R   +++H   H  D P+ C + GC K+F    ++ RH K
Sbjct: 543 KEMPDKTFECLFPGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKK 602

Query: 246 CHERK 250
            H+ K
Sbjct: 603 SHQEK 607

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           CP+C +   R      H   HTG+ P  C + GC K F+    + RH + H
Sbjct: 36  CPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIH 86

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           C +C K  +RP  LK+H   HT + PF C+   C K+F  + +  RH   H  KK
Sbjct: 428 CNLCDKKFTRPYNLKSHLRTHTDERPFSCSV--CGKAFARQHDRKRHEDLHSGKK 480

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 25/62 (40%), Gaps = 7/62 (11%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKC-------TYHGCKKSFNVKSNMFRHLKCHER 249
           C VCGK  +R    K H  +H+G   + C          GC K F     + RH K    
Sbjct: 456 CSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHFKTESG 515

Query: 250 KK 251
           ++
Sbjct: 516 RR 517

>Scas_712.42*
          Length = 290

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
            C  C +   R    K H   HTG+ P  C + GC K F+    + RHL+ H
Sbjct: 19  RCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTH 70

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHE 248
           CP+C +   R      H   HTG+ P  C + GC K F+    + RH + H+
Sbjct: 28  CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD 79

>Scas_695.2
          Length = 571

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           C +C K  +RP  LK+H   HT + PF C    C K+F  + +  RH   H  KK
Sbjct: 454 CELCDKTFTRPYNLKSHLRTHTNEXPFVCNI--CGKAFARQHDRKRHEDLHTGKK 506

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 26/62 (41%), Gaps = 7/62 (11%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKC-------TYHGCKKSFNVKSNMFRHLKCHER 249
           C +CGK  +R    K H  +HTG   + C       T  GC K F     + RH K    
Sbjct: 482 CNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHFKTDSG 541

Query: 250 KK 251
           +K
Sbjct: 542 RK 543

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           EC +C K  +  ++LK H   HTG+ P KC    C + FN  SN+ +H+K H +K
Sbjct: 626 ECHICHKRFAISNSLKIHIRTHTGEKPLKCKV--CGRCFNESSNLSKHMKTHMKK 678

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           +CP C K  S   TL  H  +H+G+ P++C  H C K F + +++  H++ H  +K
Sbjct: 598 QCPQCQKCFSTEDTLNQHKRVHSGEKPYEC--HICHKRFAISNSLKIHIRTHTGEK 651

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 219 GDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           G + + C + GC K+F+ +  + RHLK H + K
Sbjct: 563 GKSQYTCEWEGCNKTFSQRQKLVRHLKVHSKYK 595

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 177 IHQHLSKVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNV 236
           ++ HL ++++ +   + T E   C K  S+   L  H  +H+   P++C    C+K F+ 
Sbjct: 551 LNDHLEEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLKVHSKYKPYQCPQ--CQKCFST 608

Query: 237 KSNMFRHLKCHERKK 251
           +  + +H + H  +K
Sbjct: 609 EDTLNQHKRVHSGEK 623

>Scas_693.31
          Length = 635

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 188 QQLMKNTKEC--PVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLK 245
           ++L   T EC  P CGK   R    ++H   H  D P+ C +  C K+F    ++ RH K
Sbjct: 482 KELPDKTFECLYPNCGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKK 541

Query: 246 CHERK 250
            H  K
Sbjct: 542 VHSEK 546

>Scas_709.32
          Length = 822

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 194 TKECPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKN 252
           T +C  CGK   R   LK H   +H+ + PF C    C K F+   N+ +H+K H+++ +
Sbjct: 764 TFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPT--CDKKFSRSDNLAQHIKTHKKRGD 821

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
            C +C +   R    K HF  HTG+ P KC +  C KSF+    + RH + H
Sbjct: 21  RCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRTH 72

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 197 CPV--CGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           CP+  CGK  SRP  L+ H   HT + PF C   GC K+F   S++  H+  H + K
Sbjct: 10  CPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHMLSHSKVK 66

 Score = 36.2 bits (82), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 198 PVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNK 253
           P C K   RPS L+ H L H+   P+ C+   C K F  K    RH + H + ++ 
Sbjct: 43  PGCDKAFLRPSHLRVHMLSHSKVKPYNCSV--CGKGFATKQQFQRHQQTHTQNQDD 96

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 200 CGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           C K  +R    +TH   H  D P+KC + GC+K+F    ++ RH K H  K
Sbjct: 700 CQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDLLRHKKSHLEK 750

 Score = 31.2 bits (69), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 19/34 (55%)

Query: 214 FLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           +++  G   F+C +  C+K FN + N   H++ H
Sbjct: 684 YILEIGPKQFQCKFKDCQKRFNRRYNARTHIQTH 717

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 196 EC--PVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           EC  P C K+  R   +++H   H  D P+ C + GC K+F    ++ RH   H  KK
Sbjct: 604 ECLYPNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAKK 661

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           +C +C K  S  S+L+ H   HTG+ P  C    C K FN  SN+ +H++ H+R+
Sbjct: 721 KCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPI--CNKRFNESSNLAKHIRTHKRE 773

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 11/79 (13%)

Query: 182 SKVYVEQQ-LMKNTK--------ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKK 232
           +KV+V++Q L+++ K         C  CGK  +    L  H  +H+G+ PFKC  H C K
Sbjct: 670 NKVFVQKQKLIRHLKVHSKYKPFRCAECGKCFNTQDILTQHLRVHSGERPFKC--HLCPK 727

Query: 233 SFNVKSNMFRHLKCHERKK 251
           S++  S++  H++ H  +K
Sbjct: 728 SYSTSSSLRIHIRTHTGEK 746

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 7/76 (9%)

Query: 183 KVYVEQQLMKNTKEC----PVCGKMCSRPSTLKTH---FLIHTGDTPFKCTYHGCKKSFN 235
           +V   +QL +  + C      C K      +L  H   F + +G + +KC + GC K F 
Sbjct: 615 QVTAHKQLHEEPQSCICKWAGCNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFV 674

Query: 236 VKSNMFRHLKCHERKK 251
            K  + RHLK H + K
Sbjct: 675 QKQKLIRHLKVHSKYK 690

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 2/75 (2%)

Query: 177 IHQHLSKVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNV 236
           +++H+   +V   L     E   C K+  +   L  H  +H+   PF+C    C K FN 
Sbjct: 646 LNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHLKVHSKYKPFRCAE--CGKCFNT 703

Query: 237 KSNMFRHLKCHERKK 251
           +  + +HL+ H  ++
Sbjct: 704 QDILTQHLRVHSGER 718

>Kwal_27.11460
          Length = 531

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           C +C K  +RP  LK+H   HT + PF C    C K+F  + +  RH   H  +K
Sbjct: 415 CELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHDRKRHEDLHTGQK 467

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 26/62 (41%), Gaps = 7/62 (11%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKC-------TYHGCKKSFNVKSNMFRHLKCHER 249
           C +CGK  +R    K H  +HTG   + C       T  GC K F     + RH K    
Sbjct: 443 CAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFKTEGG 502

Query: 250 KK 251
           K+
Sbjct: 503 KR 504

>Scas_575.3
          Length = 455

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           CP+C +   R      H   HTG+ P +C + GC K F+    + RH + H
Sbjct: 70  CPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIH 120

>Kwal_23.5400
          Length = 429

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           +C VC +  SR + L+ H   H+ D PFKC+Y  C K    K  + RH   H R
Sbjct: 82  QCTVCARQFSRKTHLERHMFSHSEDKPFKCSY--CGKGVTTKQQLRRHEITHTR 133

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 200 CGKMCSRPSTLKTH-FLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           C K  SRPS L  H  ++H G  PF+CT   C + F+ K+++ RH+  H   K
Sbjct: 57  CSKAFSRPSQLTEHQEVVHQGIKPFQCTV--CARQFSRKTHLERHMFSHSEDK 107

 Score = 31.2 bits (69), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDT---PFKCTYHGCKKSFNVKSNMFRHLK 245
           C +CGK   RP  LK H   H        ++C+   C ++F   S + +H+K
Sbjct: 166 CEICGKRFQRPYRLKNHIAKHHNPDVVQKYQCSQGSCIEAFKTWSALQQHMK 217

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 3/34 (8%)

Query: 188 QQLMKNTK---ECPVCGKMCSRPSTLKTHFLIHT 218
           QQ MK T    +CP CGK C     L+ H  IH+
Sbjct: 213 QQHMKETHPKLQCPECGKACVGEQGLQMHMKIHS 246

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 197 CPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           C +C K   R   LK H   +H+ D PF C  H C+K F+   N+ +H+K H++
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSC--HLCEKKFSRSDNLSQHIKTHKK 588

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 196 ECPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           +C  C K   R   LK H   +H+ + PF C +  C+K F+   N+ +HLK H+R
Sbjct: 485 QCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTHKR 537

>Scas_712.2
          Length = 327

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 200 CGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNKKL 255
           CGK   RP  LK H   H+   P KC +  C+K F     + RHL  H +K  K L
Sbjct: 50  CGKRFMRPCHLKVHKWTHSKVKPLKCAF--CEKGFITNQQLKRHLNTHAKKSRKAL 103

 Score = 32.3 bits (72), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 184 VYVEQQLMKNTKECPV--CGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSF 234
           V  E++  K   +C    C +  +RP  L+ H   HT + P+ C   GC K F
Sbjct: 2   VATEKRSKKKVYKCQFEGCHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRF 54

>Scas_569.2
          Length = 293

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 179 QHLSKVYVEQQLMKNTKE-CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVK 237
           + L K   E++L K  K  C VC K  +    L  H  IHTG+    C+Y GC   F+  
Sbjct: 211 KDLKKRKHEEELEKRRKYICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRH 270

Query: 238 SNMFRHLKCH 247
            N  +H + H
Sbjct: 271 DNCVQHYRTH 280

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           +C  C +   R    K H   HTG+ P  C++ GC KSF+    + RH + H
Sbjct: 18  KCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTH 69

>Kwal_26.8351
          Length = 698

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 196 ECPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKN 252
           +C  C K   R   LK H   +H+ + PF C+Y  C K F+   N+ +HLK H++  +
Sbjct: 642 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHKKHGD 697

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 22/48 (45%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           EC +C K  SR   L  H + H    PF C    C KSF+   NM  H
Sbjct: 12  ECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSH 59

 Score = 28.5 bits (62), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 2/32 (6%)

Query: 218 TGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           TG+ P++C    CKK F+ K N+  H   H +
Sbjct: 6   TGEKPYECDI--CKKRFSRKGNLAAHKMTHGK 35

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 27/52 (51%)

Query: 200 CGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           CGKM SRP  L+ H   HT + PF C   GC K F   S++  H   H + K
Sbjct: 15  CGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVHKWSHSQVK 66

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 23/53 (43%), Gaps = 2/53 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHE 248
           E P CGK   R S LK H   H+   P  C    C K F     + RH K H+
Sbjct: 41  EEPGCGKGFLRASHLKVHKWSHSQVKPLACPV--CSKGFTTNQQLSRHKKTHK 91

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           C +C K  +RP  LK+H   HT + P+ C+   C K+F    +  RH   H  K+
Sbjct: 471 CDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLHTGKR 523

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 24/62 (38%), Gaps = 7/62 (11%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTY-------HGCKKSFNVKSNMFRHLKCHER 249
           C VCGK  +R      H  +HTG   + C          GC K F     + RH K    
Sbjct: 499 CSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFKTELG 558

Query: 250 KK 251
           KK
Sbjct: 559 KK 560

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 5/71 (7%)

Query: 182 SKVYVE--QQLMKNTKECPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKS 238
           S V +E  ++L +    C +C K   R   LK H   +H+ + PF C  H C K F+   
Sbjct: 632 SSVVIESTKELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFAC--HICDKKFSRSD 689

Query: 239 NMFRHLKCHER 249
           N+ +H+K H++
Sbjct: 690 NLSQHIKTHKK 700

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 197 CPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           C  C +   R   LK H   +H G+ P++C  H C K F+   N+ +H+K H
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYEC--HICNKKFSRSDNLNQHIKTH 315

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 196 ECPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           +C  C K   R   LK H   +H+ + PF C +  C+K F+   N+ +HLK H++
Sbjct: 574 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKK 626

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 198 PVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           P CGK   RP  L+ H   H    P KC+Y  C++ F     + RH   HER+
Sbjct: 92  PNCGKRFLRPCHLRVHKWTHAQVKPLKCSY--CERRFITNQQLKRHTNTHERR 142

>Scas_649.28
          Length = 730

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 196 ECPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           +C  C K   R   LK H   +H+ + PF C +  C+K F+   N+ +HLK H++
Sbjct: 674 KCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHKK 726

>Kwal_47.17241
          Length = 403

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 197 CPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           C  C +   R   LK H   +H G+ PF C  H C K F+   N+ +H+K H
Sbjct: 348 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDC--HICGKKFSRSDNLNQHIKTH 397

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           C +C    +    L  H  IHTG+    C + GC +SF+   N  +H + H +KK
Sbjct: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKK 308

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 196 ECPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           +C  C K   R   LK H   +H+ + PF C +  C K F+   N+ +HLK H++
Sbjct: 622 KCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTHKK 674

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 40.0 bits (92), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 198 PVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           P CGK   RP  L+ H   H+   P  CT   C+K F     + RHL  HERK
Sbjct: 47  PGCGKKFIRPCHLRVHKWTHSQIKPKACTL--CQKRFVTNQQLRRHLNSHERK 97

 Score = 31.2 bits (69), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%)

Query: 200 CGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSF 234
           C K+ +RPS L+ H   HT   P+ C   GC K F
Sbjct: 19  CEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKF 53

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 39.7 bits (91), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           C +C +  +    L  H  IHTG+    C Y GC + F+   N  +H + H +K
Sbjct: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKK 229

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 12/66 (18%)

Query: 193 NTKECP-------VCGKMCSRPST----LKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMF 241
           NTK+ P       +C K+CSR  T    L  H  IHTG+   +C + GC + F+   N  
Sbjct: 272 NTKDLPLAERRKYIC-KICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYI 330

Query: 242 RHLKCH 247
           +H + H
Sbjct: 331 QHYRTH 336

>Scas_718.44
          Length = 266

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 31/67 (46%)

Query: 184 VYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           + +++Q  +    C +C    +    L  H  IHTG+    C + GC + F+   N  +H
Sbjct: 199 IAMKRQQNRRKHVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQH 258

Query: 244 LKCHERK 250
            + H +K
Sbjct: 259 YRTHLKK 265

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 3/61 (4%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHL-KCHERKKNKKL 255
           CP+C +   R   LK H   HT + PF C    C K F  K  + RHL K H   K ++L
Sbjct: 29  CPICSRGFVRQEHLKRHQNSHTHEKPFLCLI--CGKCFARKDLVLRHLQKLHRDYKTEQL 86

Query: 256 Q 256
            
Sbjct: 87  D 87

>Scas_602.9
          Length = 547

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 197 CPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           C  C +   R   LK H   +H G+ P+ C  H C K+F+   N+ +H+K H
Sbjct: 497 CDYCERRFKRQEHLKRHVRSLHIGEKPYAC--HICNKNFSRSDNLTQHIKTH 546

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTG---DTPFKCTYHGCKKSFNVKSNMFRHLK 245
           CP C K   RP  L+ H   H     + P++CT+ GC K F + S +  H+K
Sbjct: 165 CPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAGCCKEFRIWSQLQSHIK 216

 Score = 35.0 bits (79), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 200 CGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           C K  +RPS L  H L +H G   F+C    C KSF  KS++ RHL  H
Sbjct: 56  CDKAFTRPSILTEHQLSVHQGLRAFQCD--KCAKSFVKKSHLERHLYTH 102

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           +C  C K   + S L+ H   H+   PF+C+Y  C K    +  + RH
Sbjct: 81  QCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKRH 126

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 35/78 (44%), Gaps = 14/78 (17%)

Query: 183 KVYVEQQLMKNTKE----CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKS 238
           K+++E+ L  +T E    C  CGK       LK H + HT    F C Y GC +SF    
Sbjct: 79  KIHLERHLYTHTDERPFYCSFCGKGLITRQQLKRHEVTHT--KSFNCEYEGCNESFYKHP 136

Query: 239 NMFRH--------LKCHE 248
            +  H        LKCHE
Sbjct: 137 QLRAHILAVHLQSLKCHE 154

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 3/53 (5%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDT---PFKCTYHGCKKSFNVKSNMFRHLK 245
           +C  C K   RP  LK H   H        ++CT+  C KSF   S +  H+K
Sbjct: 151 KCHECNKSFQRPYRLKNHIAKHHNPDVVNAYQCTFSVCSKSFKTWSALRLHVK 203

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLK 245
           +C +C K   R S LK H L H+    F C +  C  +   K N+ +HLK
Sbjct: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 191 MKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLK 245
            +N  +C  C K   R S LK H L H+   P+ C +  C      K N+ +HLK
Sbjct: 181 FENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLK 233

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           CPVC +  +R   LK H   HT + PF C +  C + F  +  + RH
Sbjct: 82  CPVCTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 126

>Scas_707.31
          Length = 289

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 197 CPVCGKMCSRPSTLKTHF-LIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           C +C K   R   LK HF  IH    PF+C+   C K F+   N+ +H++ HE++
Sbjct: 225 CHLCKKRFKRHEHLKRHFRTIHLRVRPFECSV--CHKRFSRNDNLNQHVRIHEQQ 277

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 18/40 (45%)

Query: 178 HQHLSKVYVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIH 217
           H+HL + +    L     EC VC K  SR   L  H  IH
Sbjct: 235 HEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRIH 274

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           CP+C +  +R   L+ H   HT + PF C +  C + F  +  + RH
Sbjct: 85  CPICTRGFARQEHLRRHERSHTNEKPFLCAF--CGRCFARRDLVLRH 129

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 37.4 bits (85), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           CP+C +  +R   LK H   HT + PF C +  C + F  +  + RH
Sbjct: 50  CPICTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 94

>Kwal_27.10925
          Length = 264

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           C +C K  +    L  H  IHTG+    C + GC + F+   N  +H K H R+
Sbjct: 203 CKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYKTHLRR 256

>Kwal_26.8021
          Length = 507

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLK 245
            C +C K   R S  K H L H+   P+ C +  C+     + N+F+H+K
Sbjct: 390 RCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMK 437

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 35.8 bits (81), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           C  CGK  +    L  H  IHTG+    C + GC + F+   N  +H + H ++
Sbjct: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           CP+C +   R   LK H   HT + PF C +  C + F  +  + RH
Sbjct: 35  CPICTRGFVRLEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRH 79

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 197 CPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           C  C +   R   LK H   +H G+ P+ C    C K F+   N+ +H+K H
Sbjct: 356 CEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEI--CGKKFSRSDNLNQHIKTH 405

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 12/24 (50%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGD 220
           C +CGK  SR   L  H   H GD
Sbjct: 385 CEICGKKFSRSDNLNQHIKTHGGD 408

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           +C  CGK  ++ S L  H   HT D PF C+   C K    +  + RH
Sbjct: 138 KCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSI--CGKGVTTRQQLKRH 183

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH-LKCHERK 250
           C +CGK  +    LK H + HT    F C+Y GC +SF     +  H L  HE+K
Sbjct: 167 CSICGKGVTTRQQLKRHEITHT--KSFHCSYEGCNESFYKHPQLRSHILSVHEKK 219

 Score = 35.8 bits (81), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 200 CGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           C K  +RPS L  H L +H G  PFKC    C K F  KS++ RH+  H   K
Sbjct: 113 CNKSFTRPSLLTEHQLTVHHGIKPFKCD--TCGKEFAKKSHLNRHMFSHTDDK 163

 Score = 31.2 bits (69), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 14/21 (66%)

Query: 197 CPVCGKMCSRPSTLKTHFLIH 217
           CP+CGK C   S L+ H +IH
Sbjct: 281 CPICGKPCVAESGLRNHMMIH 301

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 8/57 (14%)

Query: 197 CPVCGKMCSRPSTLKTHFLIH-----TGDTPFKCTYHGCKKSFNVKSNMFRHLK-CH 247
           CP C K   RP  LK H   H     TG   ++C +  C   F+  S++ +H+K CH
Sbjct: 222 CPHCNKTFQRPYRLKNHIDKHHNPESTG--MYQCDFLSCTDVFSTWSSLQQHIKQCH 276

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 197 CPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           C  C +   R   LK H   +H G+ P+ C    C K F+   N+ +H+K H
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGCDI--CGKKFSRSDNLNQHIKTH 511

>KLLA0F07073g 675221..676897 some similarities with sgd|S0004367
           Saccharomyces cerevisiae YLR375w STP3 involved in
           pre-tRNA splicing and in uptake of branched-chain amino
           acids, hypothetical start
          Length = 558

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 5/67 (7%)

Query: 186 VEQQLMKNTKECPVCGKMCSRPSTLK-THFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHL 244
           V ++  +  K+CP+CG   S  ST K TH    T   PFKC    C + F   +++ RH 
Sbjct: 375 VSKKQPRKKKQCPLCGLFFSNLSTHKSTHLSPET--RPFKCEV--CSRGFARSNDLIRHK 430

Query: 245 KCHERKK 251
           K H +  
Sbjct: 431 KLHWKDD 437

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 35.8 bits (81), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 197 CPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           C  C +   R   LK H   +H  + PF C  H C K+F+   N+ +H+K H
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTC--HICNKNFSRSDNLNQHVKTH 440

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 35.8 bits (81), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 197 CPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           C  C +   R   LK H   +H  + P+ C  H C K F+   N+ +HLK H
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGC--HLCGKKFSRSDNLSQHLKTH 469

>Kwal_47.16621
          Length = 1178

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           C +C +  +R   LK H   HT + PF C +  C + F  +  + RH
Sbjct: 80  CSICTRGFARQEHLKRHQRAHTNEKPFLCAF--CGRCFARRDLVLRH 124

>Scas_631.7
          Length = 433

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 200 CGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHL 244
           C K  +RPS L  H L  H G  PFKC    C K F+ K+++ RHL
Sbjct: 64  CTKAFTRPSLLSEHQLTFHQGIKPFKCE--QCDKQFSRKTHLERHL 107

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 3/41 (7%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTG---DTPFKCTYHGCKKSF 234
           C  CGK   RP  L+ H   H      TP++CT+  C +SF
Sbjct: 173 CKHCGKKFQRPYRLQNHIAKHHNPDVKTPYQCTFANCHRSF 213

 Score = 31.2 bits (69), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           +C  C K  SR + L+ H + H+   PF C +  C K    +  + RH
Sbjct: 89  KCEQCDKQFSRKTHLERHLISHSDSKPFCCLH--CGKGVTTRQQLKRH 134

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 6/56 (10%)

Query: 183 KVYVEQQLMKNTKECPVCGKMCSRPST----LKTHFLIHTGDTPFKCTYHGCKKSF 234
           K ++E+ L+ ++   P C   C +  T    LK H + HT    FKC Y  C +++
Sbjct: 100 KTHLERHLISHSDSKPFCCLHCGKGVTTRQQLKRHEVTHT--KSFKCPYENCDEAY 153

 Score = 28.1 bits (61), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 3/34 (8%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGD---TPFKCT 226
           +C +C K+C   + LK H  +H  D     +KCT
Sbjct: 231 KCSICDKLCVGENGLKMHMSVHDEDLVIKNWKCT 264

>Scas_721.92
          Length = 1152

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 8/66 (12%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLK------CHERK 250
           C VC +  +R   L  H   HT + P++C    C K F  +  + RH +      C E  
Sbjct: 80  CDVCSRAFARQEHLDRHARSHTNEKPYQCGI--CTKKFTRRDLLLRHAQKVHNGNCGETI 137

Query: 251 KNKKLQ 256
           + KK Q
Sbjct: 138 QRKKRQ 143

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 34.7 bits (78), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           C +C +  +    L  H  IHTG+    C + GC + F+   N  +H + H
Sbjct: 102 CKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 35.8 bits (81), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKC 246
            C +C K+  R S LK H L H+    F C +  C      + N+ +H+K 
Sbjct: 535 RCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPW--CNSRHKRRDNLLQHMKL 583

>Scas_703.23
          Length = 1341

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 3/61 (4%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHL-KCHERKKNKKL 255
           CP C +   R   LK H   HT + PF C +  C + F  +  + RH  K H      +L
Sbjct: 74  CPTCTRGFVRQEHLKRHQRSHTNEKPFLCVF--CGRCFARRDLVLRHQHKLHAALIGNEL 131

Query: 256 Q 256
           Q
Sbjct: 132 Q 132

>Kwal_27.10167
          Length = 285

 Score = 35.0 bits (79), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 2/53 (3%)

Query: 198 PVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           P CGK   R   +  H   H+   P KC    C K F  K  + RHL  H+++
Sbjct: 70  PNCGKRFLRVCHMNVHRWTHSKIKPLKC--EECSKGFTTKQQLSRHLATHKKR 120

 Score = 31.2 bits (69), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 11/67 (16%)

Query: 197 CPV--CGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH---------LK 245
           CP+  C K   +PS+L+ H   H  + PF C    C K F    +M  H         LK
Sbjct: 37  CPITSCNKRYRKPSSLREHVNSHNNNRPFACPEPNCGKRFLRVCHMNVHRWTHSKIKPLK 96

Query: 246 CHERKKN 252
           C E  K 
Sbjct: 97  CEECSKG 103

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 35.0 bits (79), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           C VC +  +R   LK H+  HT + P+ C    C + F  +  + RH
Sbjct: 106 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGL--CNRCFTRRDLLIRH 150

>Scas_717.17
          Length = 525

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250
           C +C K   R S LK H L H+ +  + C +  C      + N+ +H+K    K
Sbjct: 390 CHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKLKHSK 441

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 34.3 bits (77), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNKKLQ 256
           C +C    +    L  H  IHTG+    C + GC + F+   N  +H + H  KK +  +
Sbjct: 155 CKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTHANKKKRNWK 214

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 34.3 bits (77), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 196 ECPVCGKMCSRPSTLKTHFL-IHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247
           +C +C +   R   LK H   +H G+ P+ C    C KSF+   N+ +H + H
Sbjct: 219 KCDMCERRFKRQEHLKRHVSSLHMGERPYSCDI--CLKSFSRSDNLNQHKRTH 269

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 183 KVYVEQQLMKNTK----ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKS 238
           K ++E+ L  +++     C VCGK  +    L+ H + HT    FKC + GC ++F    
Sbjct: 162 KSHLERHLFSHSETKPFSCTVCGKGVTTRQQLRRHEITHT--KSFKCPHEGCGEAFYKHP 219

Query: 239 NMFRH-LKCHERK 250
            +  H L  HE+K
Sbjct: 220 QLRSHVLAVHEQK 232

 Score = 32.7 bits (73), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           +C  CG+  ++ S L+ H   H+   PF CT   C K    +  + RH
Sbjct: 151 QCEQCGRGFTKKSHLERHLFSHSETKPFSCTV--CGKGVTTRQQLRRH 196

 Score = 32.3 bits (72), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 3/51 (5%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTP---FKCTYHGCKKSFNVKSNMFRHL 244
           C  C K   RP  LKTH   H G      ++CT  GC + F   S + +HL
Sbjct: 235 CTHCDKRFQRPYRLKTHIAKHHGPASQFRYQCTNAGCVQCFETWSALQQHL 285

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 25/57 (43%), Gaps = 2/57 (3%)

Query: 198 PVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNKK 254
           P C    SR   L  H   HTG+ PFKC    C K F+   N+ +H      K N K
Sbjct: 31  PGCEMSFSRAEHLARHIRRHTGEKPFKCDI--CLKYFSRIDNLKQHKDTVHAKDNVK 85

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 223 FKCT-YHGCKKSFNVKSNMFRHLKCHERKK 251
           FKCT Y GC+ SF+   ++ RH++ H  +K
Sbjct: 25  FKCTGYPGCEMSFSRAEHLARHIRRHTGEK 54

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLK 245
           +C  C K   R S LK H L H+    F C +  C      K N+ +H+K
Sbjct: 347 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 394

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           C +C +   R   LK H   HT + PF C +  C + F  +  + RH
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRH 107

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 192 KNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           +  KECPVC    +  ST K+  L    D P KC+   C + F   +++ RH K H + +
Sbjct: 158 RRKKECPVCHNFYANLSTHKSTHLT-PEDRPHKCSV--CSRGFARSNDLLRHKKRHWKDE 214

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 25/59 (42%), Gaps = 6/59 (10%)

Query: 198 PVCGKMCSRPSTLKTHFLIHTGDTPFKCTY------HGCKKSFNVKSNMFRHLKCHERK 250
           P C K  SR   L  H L H     FKC Y        C K+F  +  + RH K HE K
Sbjct: 50  PTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRRDLLNRHEKRHENK 108

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 192 KNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           K  ++CP+C K  +  ST K+  L  + D P KC    C+  F   +++ RH K H +  
Sbjct: 321 KKKRQCPICHKYFANLSTHKSTHLT-SQDRPHKCII--CQSGFARNNDLIRHRKRHWKDD 377

>Scas_670.2
          Length = 435

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 3/64 (4%)

Query: 186 VEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLK 245
           V  +  +  K+CP+C    +  +T K   L+   D P KC    C++ F   +++ RH K
Sbjct: 243 VSAKTKRRKKQCPICSGYYANLTTHKATHLVPE-DRPHKCPI--CQRGFGRNNDLIRHQK 299

Query: 246 CHER 249
            H +
Sbjct: 300 RHWK 303

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 5/75 (6%)

Query: 176 MIHQHLSKVYVEQQLMKNTK---ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKK 232
           +++ HL + +V ++  KN +   +   C     +   + +H  +H    PF C+   C K
Sbjct: 169 LLYHHLCQEHVGRKSQKNLQLKCQWDNCTSKTEKRDHMTSHLRVHVPLKPFACS--TCSK 226

Query: 233 SFNVKSNMFRHLKCH 247
            F    ++ +HLK H
Sbjct: 227 RFKRPQDLKKHLKIH 241

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 11/24 (45%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGD 220
           C  C K   RP  LK H  IH  D
Sbjct: 221 CSTCSKRFKRPQDLKKHLKIHLSD 244

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 6/62 (9%)

Query: 198 PVCGKMCSRPSTLKTHFLIHTGDTPFKCTY------HGCKKSFNVKSNMFRHLKCHERKK 251
           P C K  SR   L  H L H     + C+Y        C K+F  K  + RH K H + K
Sbjct: 36  PECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRHEKRHSKVK 95

Query: 252 NK 253
           N+
Sbjct: 96  NR 97

>Scas_378.1
          Length = 208

 Score = 32.0 bits (71), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLK 245
           +C +C K   R S LK H L H+    + C    C      K N+ +HLK
Sbjct: 85  QCHMCVKSFRRHSWLKRHLLAHSSQRHYSCP--KCVSKHKRKDNLLQHLK 132

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 3/61 (4%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLK-CHERKKNKKL 255
           C  C K  SR      H   HTG  PF C+   C  SF  +  + RH++  H+   N  L
Sbjct: 10  CSFCAKPFSRSEHKARHERSHTGSKPFSCSI--CSHSFVRRDLLQRHIRTVHKSSLNSML 67

Query: 256 Q 256
           +
Sbjct: 68  K 68

>YDL048C (STP4) [816] chr4 complement(366739..368211) Protein with
           strong similarity to Stp1p, which is involved in tRNA
           splicing and branched-chain amino acid uptake [1473 bp,
           490 aa]
          Length = 490

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 192 KNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           +  KECP+C    +  ST K+  L    D P KC    C++ F   +++ RH K H + +
Sbjct: 274 RKKKECPICHNFYANLSTHKSTHLT-PEDRPHKCPI--CQRGFARNNDLIRHKKRHWKDE 330

>Kwal_47.16577
          Length = 881

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 219 GDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNK 253
           G  PF C + GC KSF+   ++ RH   H  +K K
Sbjct: 9   GSGPFFCPFPGCSKSFSRSDHLGRHKANHSSEKYK 43

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 31.6 bits (70), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           CP C +   R   LK H   HT + P+ C +  C + F  +  + RH
Sbjct: 153 CPTCTRGFVRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRH 197

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 31.6 bits (70), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 176 MIHQHLSKVYVEQQLMKNTK---ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKK 232
           +++ HL + +V ++  KN +   +   C     +   + +H  +H    PF C+   C K
Sbjct: 127 LLYHHLCQDHVGRKSQKNLQLNCQWGDCQTKTVKRDHITSHLRVHVQLKPFACST--CNK 184

Query: 233 SFNVKSNMFRHLKCHERK 250
            F    ++ +HLK H  +
Sbjct: 185 KFKRPQDLKKHLKVHNEE 202

>Scas_683.25
          Length = 879

 Score = 31.6 bits (70), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNM-FRHLKCHERKK 251
           C  C K  SR      H   HTG  P+KC    C   F V+S++  RH+K   +K+
Sbjct: 17  CSFCAKGFSRAEHKIRHERSHTGLKPYKCKV--CTHCF-VRSDLALRHIKTVHKKE 69

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 30.8 bits (68), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 198 PVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           P C    +R   L  H   HTG+ PF+C    C K F+   N+ +H
Sbjct: 25  PDCNMSFNRTEHLARHIRKHTGEKPFQCNI--CLKFFSRIDNLRQH 68

>CAGL0H04873g complement(465069..466424) some similarities with
           tr|Q05937 Saccharomyces cerevisiae YLR375w STP3 or
           tr|Q07351 Saccharomyces cerevisiae YDL048c STP4,
           hypothetical start
          Length = 451

 Score = 31.2 bits (69), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 192 KNTKECPVCGKMCSRPSTLKTHFLIHT--GDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           +  K+CP+C    +    L TH  IH      PF C+   C++ F  ++++ RH K H +
Sbjct: 261 RRRKQCPICHGFFA---NLTTHKAIHLEPDIKPFVCSV--CQRGFVRQNDVMRHEKMHWK 315

Query: 250 KK 251
            K
Sbjct: 316 DK 317

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 31.6 bits (70), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           C VC +  +R   L  H   HT + P+ C    C++ F  +  + RH
Sbjct: 127 CKVCTRAFARQEHLTRHERSHTKEKPYVCGI--CERRFTRRDLLIRH 171

>Scas_683.30
          Length = 478

 Score = 31.2 bits (69), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 3/63 (4%)

Query: 192 KNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           +  K+CP C    +  ST K+  L    D P KC    C++ F   +++ RH K H + +
Sbjct: 284 RRKKQCPTCLNYYANLSTHKSTHLT-PEDRPHKCPI--CERGFARNNDLIRHKKRHWKDE 340

Query: 252 NKK 254
            KK
Sbjct: 341 FKK 343

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 31.2 bits (69), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 22/53 (41%), Gaps = 2/53 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           C  C K  SR      H   H G  PF+C    C  SF  +  + RH++   R
Sbjct: 14  CSFCNKAFSRSEHKTRHERSHAGVKPFECQV--CSHSFVRRDLLQRHIRTVHR 64

>Scas_627.6
          Length = 1207

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 26/62 (41%), Gaps = 6/62 (9%)

Query: 198 PVCGKMCSRPSTLKTHFLIHTGDTPFKC------TYHGCKKSFNVKSNMFRHLKCHERKK 251
           P C K  +R   L  H L H     F C      T   C K+F  K  + RH K H + K
Sbjct: 47  PDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTFVRKDLLIRHQKRHTKSK 106

Query: 252 NK 253
           N+
Sbjct: 107 NR 108

>Scas_719.68
          Length = 1350

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 191 MKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRH 243
           +K  K  P    +C+R   LK H   HT + PF C +  C + F  +  + R+
Sbjct: 33  IKTDKPRPFLCPICTRTEHLKRHQRSHTREKPFVCVF--CGRCFARRDLVLRY 83

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 223 FKCT-YHGCKKSFNVKSNMFRHLKCHERKK 251
           FKCT Y GC  SF    ++ RH++ H  +K
Sbjct: 41  FKCTGYDGCTMSFTRAEHLARHIRKHTGEK 70

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%)

Query: 200 CGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKN 252
           C    +R   L  H   HTG+ PF+C    C K F+   N+ +H +     KN
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCP--ACLKFFSRVDNLKQHRESVHAHKN 99

>Kwal_55.20634
          Length = 419

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 176 MIHQHLSKVYVEQQLMKNTKECPVCGKMCSRP---STLKTHFLIHTGDTPFKCTYHGCKK 232
           +++ HL   +V ++  KN +     GK  ++      + +H  +H    PF C+   C K
Sbjct: 72  LLYHHLCHDHVGRKSQKNLQLNCRWGKCTAKTVKRDHITSHLRVHVPLKPFACS--TCTK 129

Query: 233 SFNVKSNMFRHLKCH 247
           +F    ++ +HLK H
Sbjct: 130 TFKRPQDLKKHLKVH 144

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 12/24 (50%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGD 220
           C  CGK   RP  LK H  +H  D
Sbjct: 120 CSTCGKKFKRPQDLKKHLRVHLDD 143

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 2/60 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNKKLQ 256
           C  C +  SR      H   HTG  PF C    C  SF  +  + RH++   R    ++Q
Sbjct: 10  CSFCAQAFSRSEHKTRHERSHTGVKPFSCKV--CNHSFVRRDLLQRHIRTVHRSMLLEIQ 67

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 6/62 (9%)

Query: 198 PVCGKMCSRPSTLKTHFLIHTGDTPFKCTY------HGCKKSFNVKSNMFRHLKCHERKK 251
           P C K  +R   L  H L H     F+C Y        C ++F  +  + RH K H R  
Sbjct: 21  PNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVRHEKRHSRSG 80

Query: 252 NK 253
           ++
Sbjct: 81  SR 82

>Scas_641.24
          Length = 532

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 2/35 (5%)

Query: 217 HTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
            T D PF C Y  C   F ++  + RH+K H  +K
Sbjct: 177 ETDDGPFICHY--CDAKFRIRGYLTRHIKKHAVEK 209

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 29.6 bits (65), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 200 CGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLK 245
           C    +R   L  H   HTG+ PF+C  H C + F+   N+ +H++
Sbjct: 28  CRMEFTRQEHLARHIRKHTGEQPFQC--HLCLRFFSRLDNLKQHVE 71

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 2/53 (3%)

Query: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249
           C  C K  SR      H   H G  PF+C    CK SF  +  + RH++   R
Sbjct: 10  CSFCLKPFSRSEHKIRHERSHAGVKPFQC--QVCKHSFVRRDLLQRHIRTVHR 60

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 5/75 (6%)

Query: 176 MIHQHLSKVYVEQQLMKNTK---ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKK 232
           +++ HL   +V ++  KN +       C     +   + +H  +H    PF C+   C K
Sbjct: 162 LLYNHLCHDHVGRKSHKNLQLNCHWGDCTTKTEKRDHITSHLRVHVPLKPFGCST--CSK 219

Query: 233 SFNVKSNMFRHLKCH 247
            F    ++ +HLK H
Sbjct: 220 KFKRPQDLKKHLKIH 234

>Scas_720.33
          Length = 316

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 2/56 (3%)

Query: 200 CGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNKKL 255
           C    +R   L  H   HTG+ PF+C  + C + F+   N+ +H      K N + 
Sbjct: 23  CHMTFTREEHLARHIRKHTGEKPFQC--YICFRFFSRMDNLKQHRDTVHGKSNNRF 76

>Kwal_26.9300
          Length = 304

 Score = 28.1 bits (61), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 192 KNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKK 251
           +  KECP+C    +  ST ++  L    + P KC    C + F   +++ RH K H + +
Sbjct: 143 RRKKECPICHNFYANLSTHRSSHL-QPENKPHKCPV--CGRGFTRHNDLLRHRKRHWKDE 199

Query: 252 N 252
           +
Sbjct: 200 D 200

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.127    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,347,862
Number of extensions: 343750
Number of successful extensions: 2269
Number of sequences better than 10.0: 267
Number of HSP's gapped: 2196
Number of HSP's successfully gapped: 362
Length of query: 256
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 157
Effective length of database: 13,168,927
Effective search space: 2067521539
Effective search space used: 2067521539
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)