Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_602.426625612890.0
YPR015C247643113e-34
Scas_707.46338733131e-33
YPR013C317683102e-33
CAGL0L05786g348613112e-33
CAGL0J01595g344733042e-32
Scas_602.4d256652749e-29
KLLA0A04609g4232782241e-20
Scas_656.1*102552071e-20
AEL077W336562095e-19
KLLA0F20636g285522032e-18
Scas_710.9505652063e-18
ADL040W330582017e-18
Sklu_2398.2288651962e-17
Kwal_26.8011190631912e-17
Scas_717.18354841912e-16
ADR308C278531856e-16
Sklu_2244.3271861784e-15
KLLA0F11682g374561815e-15
Scas_717.17d350531734e-14
Kwal_27.10467302861707e-14
Scas_718.36d330561691e-13
Kwal_14.2206254541671e-13
AGR186C287731672e-13
AGL207W277541662e-13
CAGL0M01870g315531611e-12
KLLA0F22319g203481572e-12
ADL042W281531566e-12
ADL050W146611497e-12
ADL051W173551393e-10
Scas_711.56832811242e-07
Scas_697.35839631232e-07
CAGL0M04323g703521223e-07
CAGL0E01331g689531213e-07
CAGL0M06831g645541213e-07
ACR264W769531171e-06
YOR113W (AZF1)914531171e-06
CAGL0L03916g642531161e-06
Scas_687.33288651141e-06
Kwal_14.2543711641162e-06
YDR216W (ADR1)1323741152e-06
AEL174W661591142e-06
Scas_709.32822841143e-06
Kwal_56.23925745711134e-06
Scas_713.52620521124e-06
Sklu_2389.2767551134e-06
YER028C394601124e-06
Scas_693.31635531125e-06
AGL197W844571125e-06
YNL027W (CRZ1)678541117e-06
Kwal_47.17888786531109e-06
KLLA0F23782g782561091e-05
KLLA0A10373g206581061e-05
YDR146C (SWI5)709541082e-05
ABR089C571551072e-05
YJL056C (ZAP1)880641072e-05
CAGL0K12078g463621053e-05
KLLA0E18645g4311281044e-05
YGL209W (MIG2)382661035e-05
KLLA0F01463g781551045e-05
CAGL0I02816g291481035e-05
KLLA0B00605g239581015e-05
AFR471C389521035e-05
Scas_695.2571541036e-05
Scas_712.42*290521026e-05
YGL035C (MIG1)504751036e-05
CAGL0J05060g713571028e-05
Kwal_27.11460531511011e-04
Kwal_26.8351698551011e-04
KLLA0F26961g694551001e-04
KLLA0F07073g558991001e-04
ADL198W547541001e-04
CAGL0A01628g424511001e-04
KLLA0F18524g35788992e-04
Kwal_23.540042957992e-04
YLR131C (ACE2)77053992e-04
CAGL0M13189g54155982e-04
CAGL0C02519g31852972e-04
Scas_569.229369973e-04
Scas_649.2873055983e-04
KLLA0D16456g85451983e-04
Scas_712.232752963e-04
Sklu_2351.654851974e-04
YKL062W (MSN4)63055964e-04
Kwal_47.1904526652954e-04
CAGL0K02145g31773955e-04
Kwal_14.227846351955e-04
KLLA0E10989g47452956e-04
CAGL0H07557g47666956e-04
Sklu_2289.129151937e-04
YGL254W (FZF1)29953937e-04
Scas_602.954780948e-04
Scas_683.3047870930.001
CAGL0F05995g59754930.001
CAGL0K03003g64750930.001
AGR031W14063880.001
Scas_575.345566910.002
Kwal_26.802150771910.002
Scas_703.23134197910.002
Scas_718.4426654890.002
CAGL0K09372g39652900.002
KLLA0E08679g59654900.002
CAGL0M00594g102068900.002
Sklu_2443.2221347880.003
CAGL0L07480g31486880.003
AER159C119147890.004
KLLA0B03454g47254880.004
YDR043C (NRG1)23153860.004
YMR037C (MSN2)70454880.005
CAGL0H04873g45180870.005
Kwal_27.1016728553860.005
CAGL0H04213g132170870.006
AGL071C39650860.006
Sklu_2206.2358199860.006
YPR186C (PZF1)42952860.007
KLLA0B04477g133247870.007
CAGL0K04697g51566860.007
YMR070W (MOT3)49064860.008
Scas_670.243561860.008
Kwal_47.1724140352840.013
Scas_721.92115247840.013
Kwal_47.166211178133840.014
Scas_717.1752559840.014
Scas_683.2587963840.015
YML081W125161840.016
Scas_631.743352830.018
YDL048C (STP4)49093820.020
AEL278W47654820.021
Sklu_2357.715752790.022
Scas_707.3128957810.025
YLR375W34359800.039
Sklu_2181.141052790.043
Scas_719.68135065790.060
ACL057W52059780.067
YER130C44352770.080
CAGL0E06116g61357770.099
YJR127C (ZMS1)138047770.12
Scas_378.120850740.13
YPR022C113364760.13
CAGL0K02343g116268750.17
KLLA0C17072g47452750.18
Kwal_27.1092526468720.27
KLLA0B07909g92259730.29
Sklu_1884.254670710.53
Kwal_47.1657788154710.60
KLLA0E00726g51748700.72
AFL136W40924700.72
AFR580C83862700.73
CAGL0K04631g101363690.91
Scas_627.6120779691.1
CAGL0E03762g58456681.4
AFR190C43247671.4
Sklu_2126.544858671.5
YMR182C (RGM1)21146661.7
Sklu_2359.572267662.5
KLLA0E13519g23056642.9
YPL230W39148643.1
Kwal_55.2063441938643.2
YHL027W (RIM101)62554643.8
YDR253C (MET32)19138633.8
CAGL0G10021g39454634.2
Kwal_26.930030458634.4
ADL227C66938626.0
CAGL0M06919g95647627.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_602.4
         (266 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_602.4                                                            501   0.0  
YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protei...   124   3e-34
Scas_707.46                                                           125   1e-33
YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putati...   124   2e-33
CAGL0L05786g complement(636176..637222) some similarities with t...   124   2e-33
CAGL0J01595g 151584..152618 some similarities with tr|Q12531 Sac...   121   2e-32
Scas_602.4d                                                           110   9e-29
KLLA0A04609g complement(411494..412765) some similarities with s...    91   1e-20
Scas_656.1*                                                            84   1e-20
AEL077W [2429] [Homologous to NOHBY] complement(483028..484038) ...    85   5e-19
KLLA0F20636g complement(1914452..1915309) some similarities with...    83   2e-18
Scas_710.9                                                             84   3e-18
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    82   7e-18
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                80   2e-17
Kwal_26.8011                                                           78   2e-17
Scas_717.18                                                            78   2e-16
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    76   6e-16
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                73   4e-15
KLLA0F11682g complement(1068992..1070116) some similarities with...    74   5e-15
Scas_717.17d                                                           71   4e-14
Kwal_27.10467                                                          70   7e-14
Scas_718.36d                                                           70   1e-13
Kwal_14.2206                                                           69   1e-13
AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,...    69   2e-13
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    69   2e-13
CAGL0M01870g complement(219813..220760) some similarities with t...    67   1e-12
KLLA0F22319g complement(2086613..2087224) some similarities with...    65   2e-12
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    65   6e-12
ADL050W [1691] [Homologous to NOHBY] complement(597229..597669) ...    62   7e-12
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    58   3e-10
Scas_711.56                                                            52   2e-07
Scas_697.35                                                            52   2e-07
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    52   3e-07
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    51   3e-07
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    51   3e-07
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    50   1e-06
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    50   1e-06
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    49   1e-06
Scas_687.33                                                            49   1e-06
Kwal_14.2543                                                           49   2e-06
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    49   2e-06
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    49   2e-06
Scas_709.32                                                            49   3e-06
Kwal_56.23925                                                          48   4e-06
Scas_713.52                                                            48   4e-06
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            48   4e-06
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    48   4e-06
Scas_693.31                                                            48   5e-06
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    48   5e-06
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    47   7e-06
Kwal_47.17888                                                          47   9e-06
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    47   1e-05
KLLA0A10373g complement(907244..907864) some similarities with c...    45   1e-05
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    46   2e-05
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    46   2e-05
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    46   2e-05
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    45   3e-05
KLLA0E18645g complement(1648263..1649558) some similarities with...    45   4e-05
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    44   5e-05
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    45   5e-05
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    44   5e-05
KLLA0B00605g complement(46736..47455) some similarities with sp|...    44   5e-05
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    44   5e-05
Scas_695.2                                                             44   6e-05
Scas_712.42*                                                           44   6e-05
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    44   6e-05
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    44   8e-05
Kwal_27.11460                                                          44   1e-04
Kwal_26.8351                                                           44   1e-04
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    43   1e-04
KLLA0F07073g 675221..676897 some similarities with sgd|S0004367 ...    43   1e-04
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    43   1e-04
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    43   1e-04
KLLA0F18524g complement(1701498..1702571) some similarities with...    43   2e-04
Kwal_23.5400                                                           43   2e-04
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    43   2e-04
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    42   2e-04
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    42   2e-04
Scas_569.2                                                             42   3e-04
Scas_649.28                                                            42   3e-04
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    42   3e-04
Scas_712.2                                                             42   3e-04
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       42   4e-04
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    42   4e-04
Kwal_47.19045                                                          41   4e-04
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    41   5e-04
Kwal_14.2278                                                           41   5e-04
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    41   6e-04
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    41   6e-04
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          40   7e-04
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    40   7e-04
Scas_602.9                                                             41   8e-04
Scas_683.30                                                            40   0.001
CAGL0F05995g complement(598819..600612) some similarities with s...    40   0.001
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    40   0.001
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    39   0.001
Scas_575.3                                                             40   0.002
Kwal_26.8021                                                           40   0.002
Scas_703.23                                                            40   0.002
Scas_718.44                                                            39   0.002
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    39   0.002
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    39   0.002
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    39   0.002
Sklu_2443.22 , Contig c2443 45390-46027                                39   0.003
CAGL0L07480g complement(822240..823184) some similarities with s...    39   0.003
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    39   0.004
KLLA0B03454g complement(314015..315433) some similarities with s...    39   0.004
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    38   0.004
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    39   0.005
CAGL0H04873g complement(465069..466424) some similarities with t...    38   0.005
Kwal_27.10167                                                          38   0.005
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    38   0.006
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    38   0.006
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            38   0.006
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    38   0.007
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    38   0.007
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    38   0.007
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    38   0.008
Scas_670.2                                                             38   0.008
Kwal_47.17241                                                          37   0.013
Scas_721.92                                                            37   0.013
Kwal_47.16621                                                          37   0.014
Scas_717.17                                                            37   0.014
Scas_683.25                                                            37   0.015
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    37   0.016
Scas_631.7                                                             37   0.018
YDL048C (STP4) [816] chr4 complement(366739..368211) Protein wit...    36   0.020
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    36   0.021
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        35   0.022
Scas_707.31                                                            36   0.025
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    35   0.039
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            35   0.043
Scas_719.68                                                            35   0.060
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    35   0.067
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    34   0.080
CAGL0E06116g complement(604708..606549) some similarities with t...    34   0.099
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    34   0.12 
Scas_378.1                                                             33   0.13 
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    34   0.13 
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    33   0.17 
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    33   0.18 
Kwal_27.10925                                                          32   0.27 
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    33   0.29 
Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement         32   0.53 
Kwal_47.16577                                                          32   0.60 
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    32   0.72 
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    32   0.72 
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    32   0.73 
CAGL0K04631g complement(440721..443762) some similarities with s...    31   0.91 
Scas_627.6                                                             31   1.1  
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    31   1.4  
AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH] (783110.....    30   1.4  
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            30   1.5  
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    30   1.7  
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          30   2.5  
KLLA0E13519g complement(1190615..1191307) some similarities with...    29   2.9  
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    29   3.1  
Kwal_55.20634                                                          29   3.2  
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    29   3.8  
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    29   3.8  
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    29   4.2  
Kwal_26.9300                                                           29   4.4  
ADL227C [1514] [Homologous to ScYIL101C (XBP1) - SH] (305768..30...    28   6.0  
CAGL0M06919g complement(703702..706572) similar to sp|P53971 Sac...    28   7.4  

>Scas_602.4
          Length = 266

 Score =  501 bits (1289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/256 (95%), Positives = 244/256 (95%)

Query: 11  PTFQIHQMNYNFIQPNMQYSPHANTDMAYAPQYMPTPVPQNNSLIENVSRSRSMPKNGIV 70
           PTFQIHQMNYNFIQPNMQYSPHANTDMAYAPQYMPTPVPQNNSLIENVSRSRSMPKNGIV
Sbjct: 11  PTFQIHQMNYNFIQPNMQYSPHANTDMAYAPQYMPTPVPQNNSLIENVSRSRSMPKNGIV 70

Query: 71  NANRMERHISLPPISSLMSTIYNTNVDNFHMQQPLPYEKKQQVDHNNLDTLMIQAKVLMN 130
           NANRMERHISLPPISSLMSTIYNTNVDNFHMQQPLPYEKKQQVDHNNLDTLMIQAKVLMN
Sbjct: 71  NANRMERHISLPPISSLMSTIYNTNVDNFHMQQPLPYEKKQQVDHNNLDTLMIQAKVLMN 130

Query: 131 NDASNVKADVTSRNIQPSNQPVNPVVTGXXXXXXXXXXXXQDVKPIINKNSSKVPSKKRA 190
           NDASNVKADVTSRNIQPSNQPVNPVVTG            QDVKPIINKNSSKVPSKKRA
Sbjct: 131 NDASNVKADVTSRNIQPSNQPVNPVVTGSLLPTSSRSSSLQDVKPIINKNSSKVPSKKRA 190

Query: 191 NRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLK 250
           NRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLK
Sbjct: 191 NRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLK 250

Query: 251 AHEKKVIKKEALQIMS 266
           AHEKKVIKKEALQIMS
Sbjct: 251 AHEKKVIKKEALQIMS 266

>YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protein
           with similarity to human GT box-binding protein
           (SP:B44489), has two tandem C2H2-type zinc fingers [744
           bp, 247 aa]
          Length = 247

 Score =  124 bits (311), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 51/64 (79%), Positives = 59/64 (92%)

Query: 197 KLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKV 256
           KLRKQCP CGK+CSRPSTL+ HYLIHTGDTPFKCTW +CNK+FNVKSNMLRHL+ H+KK+
Sbjct: 182 KLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKI 241

Query: 257 IKKE 260
            KK+
Sbjct: 242 AKKK 245

>Scas_707.46
          Length = 338

 Score =  125 bits (313), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 54/73 (73%), Positives = 61/73 (83%)

Query: 186 SKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNM 245
           S  + N  L S+LRKQCP CGKICSRPSTLK HYLIHTGDTPF+C W +CNK+FNVKSNM
Sbjct: 256 SAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNM 315

Query: 246 LRHLKAHEKKVIK 258
           LRHLK+H+KK  K
Sbjct: 316 LRHLKSHQKKGAK 328

>YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putative
           transcription factor with similarity to mouse REX1
           encoded transcription factor, has two tandem C2H2-type
           zinc fingers [954 bp, 317 aa]
          Length = 317

 Score =  124 bits (310), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 53/68 (77%), Positives = 57/68 (83%)

Query: 188 KRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLR 247
           K   R   +KLRKQCP CGKICSRPSTLK HYLIHTGDTPFKCTW  C K+FNVKSNMLR
Sbjct: 242 KTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLR 301

Query: 248 HLKAHEKK 255
           HLK+HE+K
Sbjct: 302 HLKSHERK 309

>CAGL0L05786g complement(636176..637222) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 348

 Score =  124 bits (311), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 55/61 (90%)

Query: 195 LSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           LSKLRKQCP CGK+CSRPSTLK HYLIHTGDTPFKC W +C KAFNVKSNMLRHLK HE+
Sbjct: 280 LSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339

Query: 255 K 255
           K
Sbjct: 340 K 340

>CAGL0J01595g 151584..152618 some similarities with tr|Q12531
           Saccharomyces cerevisiae YPR015c or tr|Q12145
           Saccharomyces cerevisiae YPR013c, hypothetical start
          Length = 344

 Score =  121 bits (304), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%)

Query: 188 KRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLR 247
           KR  +   ++LRKQCP CGKICSRPSTLK H LIHTGDTPFKCTW +C KAFNVKSN+LR
Sbjct: 272 KRQLKKATTRLRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLR 331

Query: 248 HLKAHEKKVIKKE 260
           HLK+HEK  + K+
Sbjct: 332 HLKSHEKNSLNKK 344

>Scas_602.4d
          Length = 256

 Score =  110 bits (274), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (81%)

Query: 195 LSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           L K  K+CP CGK+CSRPSTLK H+LIHTGDTPFKCT+  C K+FNVKSNM RHLK HE+
Sbjct: 190 LMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHER 249

Query: 255 KVIKK 259
           K  KK
Sbjct: 250 KKNKK 254

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 90.9 bits (224), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 119/278 (42%), Gaps = 38/278 (13%)

Query: 8   NNLPTFQIHQMNYNFIQPNMQYSPHANTDMAYAPQYMPTPVPQNNSLIENVSRSRSMPKN 67
           +NLPT   + M+Y    P        N    Y+ + +P  V    S IE        PK+
Sbjct: 127 SNLPTSNDNSMDYT---PMRSVGSFVNFQSNYSYRTLPQSVNDRES-IEAKRCVAEKPKS 182

Query: 68  GIVNANRMERHISLPPISSLMSTIYNTNVDNFHMQQPLPYEKKQQVDHNNLDTLMIQAKV 127
            +  AN +   I LPP+++L+  +   +++N H   PL   +   + H N     IQ   
Sbjct: 183 DLSAANNVRVLIQLPPVNTLL--MKENDINNSHQHYPL--SQPANMYHQNQQHFPIQHHD 238

Query: 128 LMNNDASNVKADVTSRNIQPSNQPVNPVVTGX---------XXXXXXXXXXXQDVKPIIN 178
            ++ ++S  +        Q    PV P++                       QD   + +
Sbjct: 239 SVSQESSQFQPLQDRHYHQTGTTPVPPMMVTTNDAAGPVIPSTANASQIQEEQDGSVVND 298

Query: 179 KNSSKVPSKKRANRTL-LSK-------------------LRK-QCPACGKICSRPSTLKA 217
           K+     S      TL +SK                   L+K QC  CG+ICSRPSTL+ 
Sbjct: 299 KDDHSSGSTTERETTLRISKTELDGSITNAMPINDSSLPLKKNQCHICGRICSRPSTLQT 358

Query: 218 HYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           H  IHTGD P+KC   NC+K FNVKSNMLRH K HE K
Sbjct: 359 HLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRHEFK 396

>Scas_656.1*
          Length = 102

 Score = 84.3 bits (207), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 41/55 (74%)

Query: 200 KQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           +QCP CGKI +R S+L+ H L+HTGD PFKC W NC K FNVKSNM RH K H K
Sbjct: 40  RQCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLHLK 94

>AEL077W [2429] [Homologous to NOHBY] complement(483028..484038)
           [1011 bp, 336 aa]
          Length = 336

 Score = 85.1 bits (209), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 40/56 (71%)

Query: 198 LRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHE 253
           +R QCP CGK+C RPS+L+ H  IHTG  PF C W  C K FNVKSNM+RH + H+
Sbjct: 272 VRNQCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQ 327

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 82.8 bits (203), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 32/52 (61%), Positives = 40/52 (76%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHE 253
           C  CGK  +RPS L+ H L+H+GD PF+CTW  CNK FNVKSN++RHLK H+
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLHK 285

>Scas_710.9
          Length = 505

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 37/65 (56%), Positives = 46/65 (70%), Gaps = 3/65 (4%)

Query: 197 KLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKV 256
           K +KQC  CGK+ +R S+L+ H LIHTG  PF CTW  C K FNVKSNM RHLK H   +
Sbjct: 444 KRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLH---L 500

Query: 257 IKKEA 261
           IK+++
Sbjct: 501 IKEDS 505

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 82.0 bits (201), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 46/58 (79%)

Query: 200 KQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVI 257
           K C  CG+ C+RPSTLK H LIHTG+ PF+C+W  C+K FNV+SNM RH+ +H+++++
Sbjct: 258 KTCLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSHKRRLM 315

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 80.1 bits (196), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 3/65 (4%)

Query: 197 KLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKV 256
           KL+  CP CGK   RPS LK H +IH G +P+ CTW  C+K FNVK N+LRH + H K  
Sbjct: 215 KLQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTK-- 272

Query: 257 IKKEA 261
            KKEA
Sbjct: 273 -KKEA 276

>Kwal_26.8011
          Length = 190

 Score = 78.2 bits (191), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 45/63 (71%)

Query: 199 RKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIK 258
           + QC  C KI SR S L+AH L HTG  PF+C + +C+K FNVKSNM+RHLK H++  ++
Sbjct: 127 KYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTHKQPEVR 186

Query: 259 KEA 261
           + +
Sbjct: 187 RSS 189

>Scas_717.18
          Length = 354

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 55/84 (65%), Gaps = 6/84 (7%)

Query: 171 QDVKPIINKNSSKVPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKC 230
           Q+ +P   K++S+   +K+  R        +CP C KI +R ++L++H LIHTG+ P+KC
Sbjct: 273 QNDEPTTPKSTSRPSREKKPARI------HKCPICDKIVTRSTSLRSHLLIHTGEKPYKC 326

Query: 231 TWGNCNKAFNVKSNMLRHLKAHEK 254
           TW NC+ + +VKSN+ RH K+H K
Sbjct: 327 TWPNCDTSSSVKSNITRHYKSHLK 350

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 75.9 bits (185), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 36/53 (67%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           C  CG+ C RPSTLK H L HTG  PF C    C+K+FNV+SNMLRH + H +
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLHSR 258

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 73.2 bits (178), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 9/86 (10%)

Query: 171 QDVKPIINKNSSKVP-SKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFK 229
           QD K  +NK  ++ P  KKR + T        CP C K   RPS L+ H +IH G  PF 
Sbjct: 194 QDWK--LNKECNRFPPRKKRVSYTYC------CPKCKKEFKRPSGLRTHMVIHYGRNPFF 245

Query: 230 CTWGNCNKAFNVKSNMLRHLKAHEKK 255
           C W NC+K FNVKSN+LRH ++H ++
Sbjct: 246 CKWPNCSKKFNVKSNLLRHYRSHNRE 271

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 74.3 bits (181), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 38/56 (67%)

Query: 199 RKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           + +C  CGK  +RPS+L  H  IHTGD P+KC + NC K FN KSNMLRH K H K
Sbjct: 303 KYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLK 358

>Scas_717.17d
          Length = 350

 Score = 71.2 bits (173), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 37/53 (69%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           C  CGK  +R ++L+ H LIHTG  PFKC+W NC  + +VKSN+ RH K+H K
Sbjct: 287 CVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSHLK 339

>Kwal_27.10467
          Length = 302

 Score = 70.1 bits (170), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 49/86 (56%)

Query: 177 INKNSSKVPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCN 236
           + +++ K  S++     L ++ R  C  CGK+ +RPS+L  H   HTGD P+ C + NC+
Sbjct: 175 LARSARKASSEELQPPRLRNQPRYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCD 234

Query: 237 KAFNVKSNMLRHLKAHEKKVIKKEAL 262
           K FN +SNM RH K H K  I    L
Sbjct: 235 KQFNARSNMTRHYKLHFKTDIGTYVL 260

>Scas_718.36d
          Length = 330

 Score = 69.7 bits (169), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 37/56 (66%)

Query: 197 KLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           KL   C  CGK   RPS+L+ H  I +G+ P+KC + NC K+FN KSNMLRH K H
Sbjct: 236 KLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKLH 291

>Kwal_14.2206
          Length = 254

 Score = 68.9 bits (167), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 35/54 (64%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           +C  CGK  SRPS L  H LIHTG  P+ C   NC K FNVKSN++RH K H K
Sbjct: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248

>AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,
           287 aa]
          Length = 287

 Score = 68.9 bits (167), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 184 VPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKS 243
           +PS+  +NR L+  + K CP CGK  +R STL+ H LIHT   PFKC++  C+K FNVKS
Sbjct: 152 LPSQTSSNRGLI-FVSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKS 208

Query: 244 NMLRHLKAHEKKV 256
           N+ RH + H +K 
Sbjct: 209 NLNRHERIHRQKA 221

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 68.6 bits (166), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 36/54 (66%)

Query: 199 RKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           R  C  CGK  +R S+L+ H  IHTGD PF C + NC K+FN +SNMLRH K H
Sbjct: 182 RYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLH 235

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 34/53 (64%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           C  C K   RPS+L  H  IHTG+ P+ C + NC K+FN KSNMLRH K H K
Sbjct: 175 CKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFK 227

>KLLA0F22319g complement(2086613..2087224) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 203

 Score = 65.1 bits (157), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%)

Query: 206 GKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHE 253
           GK  SRPSTLK H ++H+   PFKCT+ +CNK++NVKSN+ RH K H+
Sbjct: 152 GKEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKKHK 199

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 64.7 bits (156), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           C  CGK   RPS L+ H ++H  D P+ C    C K FNVKSNMLRH++ H++
Sbjct: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKHKE 279

>ADL050W [1691] [Homologous to NOHBY] complement(597229..597669)
           [441 bp, 146 aa]
          Length = 146

 Score = 62.0 bits (149), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 37/61 (60%)

Query: 200 KQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIKK 259
           K CP C K  +R ++L  H LIH    P+ C + NCNK+FNVKSN+ RHL+ H    +  
Sbjct: 76  KTCPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIHRGHELHH 135

Query: 260 E 260
           E
Sbjct: 136 E 136

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 58.2 bits (139), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%)

Query: 200 KQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           K C  C K  +R ++L+ H LIHT   P++C +  CNK FNVKSN+ RH + H++
Sbjct: 116 KTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIHKR 170

>Scas_711.56
          Length = 832

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 176 IINKNSSKVPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNC 235
           I  K+ S   + K+  RT   +   +C  CGK  +  S+LK H   HTG+ P  C    C
Sbjct: 730 ICKKHFSNEETLKQHERTHSGEKPFKCDICGKRFAISSSLKIHIRTHTGEKPLHCKI--C 787

Query: 236 NKAFNVKSNMLRHLKAHEKKV 256
            KAFN  SN+ +H+K H K+ 
Sbjct: 788 GKAFNESSNLSKHMKTHLKRF 808

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           QC  C K  S   TLK H   H+G+ PFKC    C K F + S++  H++ H
Sbjct: 727 QCSICKKHFSNEETLKQHERTHSGEKPFKCDI--CGKRFAISSSLKIHIRTH 776

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 20/29 (68%)

Query: 224 GDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           G + ++C W NC+K F+ +  ++RH++ H
Sbjct: 692 GQSQYECHWANCHKIFSQRQRLVRHMRVH 720

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 205 CGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           C KI S+   L  H  +H+G  PF+C+   C K F+ +  + +H + H
Sbjct: 703 CHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERTH 748

>Scas_697.35
          Length = 839

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 192 RTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKA 251
           R+ L     QC  CGK  ++   L+ H  +HTG+ P++C    C+K F+ K N+  HL  
Sbjct: 535 RSHLGYKPYQCGYCGKRFTQGGNLRTHQRLHTGEKPYECEL--CDKKFSRKGNLAAHLLT 592

Query: 252 HEK 254
           H+K
Sbjct: 593 HQK 595

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKV 256
           +C  C K  SR   L AH L H    PF C   NCN++F    NM    KAH+ + 
Sbjct: 572 ECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNM----KAHQNRF 623

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           +CP C ++ ++ + L+ H   H G  P++C  G C K F    N+  H + H
Sbjct: 516 KCPYCHRLFAQSTHLEVHIRSHLGYKPYQC--GYCGKRFTQGGNLRTHQRLH 565

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           P CGK   R   +K+H   H  D P+KC +  C KAF    ++ RH K H+K
Sbjct: 528 PNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKTHDK 579

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           P CGK   R   +++H   H  D P++C +  C+KAF    +++RH K H++K
Sbjct: 561 PQCGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKKTHQEK 613

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           C  CGK+ SRP  LK+H   HT + P++C+   C KAF  + +  RH   H  K
Sbjct: 523 CEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLHTGK 574

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 24/59 (40%), Gaps = 9/59 (15%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCT--------WGNCNKAFNVKSNMLRHLKA 251
           QC  CGK  +R    K H  +HTG   + C         WG C K F     + RH K 
Sbjct: 550 QCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWG-CGKKFARSDALGRHFKT 607

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHE 253
           QC  CGK  ++   L+ H  +HTG+ P++C    C K F+ K N+  H+  HE
Sbjct: 516 QCEYCGKRFTQGGNLRTHVRLHTGERPYECD--KCGKRFSRKGNLAAHMLTHE 566

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 25/48 (52%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRH 248
           +C  CGK  SR   L AH L H    PF+C   +CNK+F    NM  H
Sbjct: 544 ECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAH 591

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           +CP C K  ++ + L+ H   H G  PF+C +  C K F    N+  H++ H
Sbjct: 488 KCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 537

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           C  CGK  ++   L+ H  +HTG+ P+ C    C+K F+ K N+  HL  H+K
Sbjct: 623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 673

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 30/65 (46%), Gaps = 5/65 (7%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIKKEA 261
           C  C K  SR   L AH + H    PF C   NCNK F    NM    KAH+ +   KE 
Sbjct: 651 CDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNM----KAHQNR-FHKET 705

Query: 262 LQIMS 266
           L  ++
Sbjct: 706 LNALT 710

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 199 RKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           + +CP C ++ S+ + L+ H   H G  PF C +  C K F    N+  H + H
Sbjct: 592 KHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 643

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHE 253
           +C  CGK  ++   L+ H  +HTG+ PFKC    C+K F  + N+  H   HE
Sbjct: 509 ECEFCGKRFTQAGNLRTHRRLHTGERPFKCD--KCDKTFARRGNLTAHEFTHE 559

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 189 RANRTLLSKLRK-QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLR 247
           R +R L +  R  +C  C K  +R   L AH   H    P+ C   NC K F+   NM  
Sbjct: 524 RTHRRLHTGERPFKCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGNMKS 583

Query: 248 HLKAHEKKVIKK 259
           H   +  + IK+
Sbjct: 584 HQNKYHPQTIKE 595

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           QC  C K+ S+ + L  H   H G  PF+C +  C K F    N+  H + H
Sbjct: 481 QCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLH 530

>Scas_687.33
          Length = 288

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH----EKKV 256
           +CP C +   R    K H   HTG+ P  CT+ +C K+F+    + RH++ H     +++
Sbjct: 18  RCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIHLGLPSRRI 77

Query: 257 IKKEA 261
            KK A
Sbjct: 78  RKKAA 82

>Kwal_14.2543
          Length = 711

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 192 RTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKA 251
           RT   +   +C  CGK  +  S+L+ H   HTG+ P +C    C K FN  SN+ +H++ 
Sbjct: 626 RTHSGEKPYKCSHCGKGFATSSSLRIHIRTHTGEKPLECKV--CGKRFNESSNLSKHMRT 683

Query: 252 HEKK 255
           HE+K
Sbjct: 684 HERK 687

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           +C  C K  S    L+ H   H+G+ P+KC+  +C K F   S++  H++ H
Sbjct: 607 KCVHCLKTFSTQDILQQHMRTHSGEKPYKCS--HCGKGFATSSSLRIHIRTH 656

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 17/31 (54%)

Query: 224 GDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           G + + C W NC +    +  +LRHL+ H +
Sbjct: 572 GKSSYVCGWENCGRVITQRQKLLRHLRVHTR 602

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 205 CGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           CG++ ++   L  H  +HT   P KC   +C K F+ +  + +H++ H
Sbjct: 583 CGRVITQRQKLLRHLRVHTRYKPCKCV--HCLKTFSTQDILQQHMRTH 628

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 177 INKNSSKVPSKKRAN-RTLLSKLRK-QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGN 234
           INK   K+P   R N RT   KLR   C  C +  +R   LK HY  HT + P+ C  G 
Sbjct: 79  INKQLDKLPENLRLNGRTPSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPC--GL 136

Query: 235 CNKAFNVKSNMLRH 248
           CN+ F  +  ++RH
Sbjct: 137 CNRCFTRRDLLIRH 150

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIKK 259
            C  C K  S  S+L+ H   HTG+ P  CT   C K FN  SN+ +H+K HE+K + K
Sbjct: 573 HCHYCRKQFSTSSSLRVHIRTHTGEKPLSCT--VCGKRFNESSNLSKHMKIHERKYMCK 629

>Scas_709.32
          Length = 822

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 175 PIINKNSSKVPSKKRANRTLLSKLRK--QCPACGKICSRPSTLKAHYL-IHTGDTPFKCT 231
           P++N   +   + KR+     S   K  +C  CGK   R   LK H   +H+ + PF C 
Sbjct: 738 PLLNGQKATTTTAKRSVSYNFSDENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACP 797

Query: 232 WGNCNKAFNVKSNMLRHLKAHEKK 255
              C+K F+   N+ +H+K H+K+
Sbjct: 798 T--CDKKFSRSDNLAQHIKTHKKR 819

>Kwal_56.23925
          Length = 745

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 9/71 (12%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHE--------- 253
           P CGK   R   +++H   H  D P+ C +  C+KAF    +++RH K H          
Sbjct: 590 PDCGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKKTHAEKCYVCPCG 649

Query: 254 KKVIKKEALQI 264
           KK ++++AL +
Sbjct: 650 KKFVREDALLV 660

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 4/59 (6%)

Query: 198 LRKQCPACGKICSRPSTLKAH----YLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           L    P+  KI  +P+TL       ++    D  F+C   +C K F  + N+  H++ H
Sbjct: 551 LEHHYPSPLKITKKPTTLPPGEIDKFVKELPDKTFECLHPDCGKTFRRRYNIRSHIQTH 609

>Scas_713.52
          Length = 620

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 205 CGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKV 256
           CGKI  R   +++H   H  D P+ C +  C KAF    +++RH K+H  + 
Sbjct: 487 CGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSHANRT 538

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           +C  C K  +  S+L+ H   HTG+ P KC    C K FN  SN+ +H+K HE+K
Sbjct: 687 KCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI--CGKRFNESSNLSKHMKTHERK 739

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 205 CGKICSRPSTLKAHYL---IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           C ++   P  L  H     I  G + ++C+W  C+K+F  +  +LRHLK H
Sbjct: 602 CSQVFPNPEALNNHIESQHIPRGQSSYQCSWDTCSKSFTQRQKLLRHLKVH 652

 Score = 32.0 bits (71), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 204 ACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
            C K  ++   L  H  +H+G  PFKC   +C K F+ +  + +H++ H
Sbjct: 634 TCSKSFTQRQKLLRHLKVHSGYKPFKCP--HCTKKFSTEDILQQHIRTH 680

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIKKE 260
           +C  C +   R    K H   HTG+ P KCT   C K+F+    + RHL+ H K V ++ 
Sbjct: 18  RCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTKGVQRRR 77

>Scas_693.31
          Length = 635

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           P CGK   R    ++H   H  D P+ C + NC+KAF    +++RH K H +K
Sbjct: 494 PNCGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKKVHSEK 546

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 21/46 (45%)

Query: 207 KICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           K+ + P      Y+    D  F+C + NC K F  + N   H++ H
Sbjct: 468 KLTTLPPGSIDRYVKELPDKTFECLYPNCGKHFKRRYNTRSHIQTH 513

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 201 QC--PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           QC  P CGK+ +R   +++H   H  D PF+C    C KAF    +++RH K H +K
Sbjct: 675 QCLYPECGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRHKKTHAEK 731

 Score = 29.3 bits (64), Expect = 4.6,   Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 18/35 (51%)

Query: 218 HYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
            Y+    D  F+C +  C K FN + N+  H++ H
Sbjct: 664 QYIKKLQDKTFQCLYPECGKLFNRRYNIRSHIQTH 698

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           C  CGK  +RP  LK+H   HT + PF C+   C KAF  + +  RH   H  K
Sbjct: 571 CDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGK 622

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 24/62 (38%), Gaps = 9/62 (14%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCT--------WGNCNKAFNVKSNMLRHLKAHE 253
           C  CGK  +R    K H  +HTG   + C         WG C K F     + RH K   
Sbjct: 599 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWG-CGKKFARSDALGRHFKTES 657

Query: 254 KK 255
            +
Sbjct: 658 GR 659

>Kwal_47.17888
          Length = 786

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHE 253
           QC  CGK  ++   L+ H  +HTG+ P++C    C + F+ K N+  H   HE
Sbjct: 532 QCEYCGKRFTQGGNLRTHVRLHTGEKPYECE--KCGRRFSRKGNLAAHRLTHE 582

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKV 256
           +C  CG+  SR   L AH L H    PF C    CNK+F    NM    KAH+ + 
Sbjct: 560 ECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNM----KAHQNRF 611

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           +CP C K  ++ + L+ H   H G  PF+C +  C K F    N+  H++ H
Sbjct: 504 ECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 553

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKV 256
           +C  CG+  SR   L AH L H    PF+C   +CNK F    NM    KAH+ + 
Sbjct: 580 ECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNM----KAHQNRF 631

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHE 253
           C  CGK  ++   L+ H  +HTG+ P++C    C + F+ K N+  H   H+
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYECE--RCGRKFSRKGNLAAHKLTHD 602

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           QCP C K  ++ + L+ H   H G  PF C +  C K F    N+  H++ H
Sbjct: 524 QCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLH 573

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 199 RKQCP--ACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           R  CP  +CGK  SRP  L+ H   HT + PF C    C+KAF   S++  H+ +H K
Sbjct: 7   RYVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHMLSHSK 64

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           P C K   RPS L+ H L H+   P+ C+   C K F  K    RH + H
Sbjct: 43  PGCDKAFLRPSHLRVHMLSHSKVKPYNCSV--CGKGFATKQQFQRHQQTH 90

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKV 256
           P C K   R   +++H   H  D P+ C    C+KAF    +++RH K+H++K 
Sbjct: 555 PGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQEKA 608

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 201 QCPACGKICSRPSTLKAHYL-IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           +C  C K   R   LK H   +H+ D PF CT+  C+K F+   N+ +HLK H K
Sbjct: 505 KCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLKTHRK 557

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 192 RTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKA 251
           RT   +   +C  C K  +  S+LK H   HTG+ P +C    C K FN  SN+ +H+K 
Sbjct: 788 RTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKT 845

Query: 252 HEKK 255
           H+KK
Sbjct: 846 HQKK 849

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           +C  C +  S   TL  H   H+G+ P+KC    CNK F + S++  H++ H
Sbjct: 769 KCKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTH 818

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 201 QCPACGKICSRPSTLKAHY-LIH--TGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           Q   C K  S    L  H   +H   G + ++C W +C++ F  +  ++RHLK H K
Sbjct: 708 QWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSK 764

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 197 KLRKQ--CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           +LR++  C  CGK  +    L  H  IHTG+    C +  C + FN   N L+H K H K
Sbjct: 397 ELRRKYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTHLK 456

Query: 255 KV 256
           ++
Sbjct: 457 RL 458

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 52/128 (40%), Gaps = 12/128 (9%)

Query: 142 SRNIQPSN--QPVNPVVTGXXXXXXXXXXXXQDVKPIINKNSSKVPSKKRANRTLL---- 195
           S NIQPS   QP+N + TG             + + + N N+ +     +  + L     
Sbjct: 240 SHNIQPSTALQPLN-IRTGEDSFSTFKEHNTHEQQLLSNPNNGRDQDHDQQQQQLTHDGV 298

Query: 196 ---SKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
              S    QC  C K   R S LK H L H+    F C W  C+     K N+L+HLK  
Sbjct: 299 PHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKLK 356

Query: 253 EKKVIKKE 260
             + +  E
Sbjct: 357 HTQYLLHE 364

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH---EKKVI 257
           +C  C +   R    K H   HTG+ P  C +  C K+F+    + RH++ H    ++ +
Sbjct: 18  RCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQRRL 77

Query: 258 KKEALQ 263
           KK ++Q
Sbjct: 78  KKASVQ 83

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           +C  C K  S  S+L+ H   HTG+ P  C    CNK FN  SN+ +H++ H+++
Sbjct: 721 KCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPI--CNKRFNESSNLAKHIRTHKRE 773

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 43/87 (49%), Gaps = 5/87 (5%)

Query: 172 DVKPIINKNSSK-VPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAH---YLIHTGDTP 227
           DVK + NK  +K V + K+ +    S + K    C K      +L  H   + + +G + 
Sbjct: 603 DVKVLDNKTMAKQVTAHKQLHEEPQSCICKW-AGCNKEFDSAKSLNEHIENFHVPSGLSS 661

Query: 228 FKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           +KC W  CNK F  K  ++RHLK H K
Sbjct: 662 YKCEWEGCNKVFVQKQKLIRHLKVHSK 688

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           +C  CGK  +    L  H  +H+G+ PFKC    C K+++  S++  H++ H
Sbjct: 693 RCAECGKCFNTQDILTQHLRVHSGERPFKCHL--CPKSYSTSSSLRIHIRTH 742

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 195 LSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           LS  + +   C K+  +   L  H  +H+   PF+C    C K FN +  + +HL+ H
Sbjct: 659 LSSYKCEWEGCNKVFVQKQKLIRHLKVHSKYKPFRC--AECGKCFNTQDILTQHLRVH 714

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 24/48 (50%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRH 248
           +C  C K  SR   L AH + H    PF C   NCNK+F+   NM  H
Sbjct: 12  ECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSH 59

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 26/58 (44%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIKK 259
           C  CG    R      H   HTG+ PF CT   C K F+    + RH+K H K   +K
Sbjct: 14  CEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFKSRKRK 71

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHE 253
           CP C +   R      H   HTG+ P  C +  C K F+ +  + RH + HE
Sbjct: 24  CPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIHE 75

>Scas_695.2
          Length = 571

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           C  C K  +RP  LK+H   HT + PF C    C KAF  + +  RH   H  K
Sbjct: 454 CELCDKTFTRPYNLKSHLRTHTNEXPFVCNI--CGKAFARQHDRKRHEDLHTGK 505

>Scas_712.42*
          Length = 290

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           +C  C +   R    K H   HTG+ P  C +  C K F+    + RHL+ H
Sbjct: 19  RCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTH 70

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 2/43 (4%)

Query: 183 KVPSKKRANRTLLSKLRKQC--PACGKICSRPSTLKAHYLIHT 223
           ++  KKR  RT   +    C  P CGK  SR   LK H   HT
Sbjct: 29  RLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTHT 71

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 6/75 (8%)

Query: 178 NKNSSKVPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNK 237
           +K+ SKV +K  A R         CP C +   R      H  IHTG+ P  C +  C K
Sbjct: 22  SKSKSKVAAKSEAPRP------HACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVK 75

Query: 238 AFNVKSNMLRHLKAH 252
            F+    + RH + H
Sbjct: 76  RFSRSDELTRHRRIH 90

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVI 257
           +C  C K  +  ++LK H   HTG+ P KC    C + FN  SN+ +H+K H KK  
Sbjct: 626 ECHICHKRFAISNSLKIHIRTHTGEKPLKCKV--CGRCFNESSNLSKHMKTHMKKYF 680

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           QCP C K  S   TL  H  +H+G+ P++C    C+K F + +++  H++ H
Sbjct: 598 QCPQCQKCFSTEDTLNQHKRVHSGEKPYECHI--CHKRFAISNSLKIHIRTH 647

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 224 GDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           G + + C W  CNK F+ +  ++RHLK H K
Sbjct: 563 GKSQYTCEWEGCNKTFSQRQKLVRHLKVHSK 593

>Kwal_27.11460
          Length = 531

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           C  C K  +RP  LK+H   HT + PF C    C KAF  + +  RH   H
Sbjct: 415 CELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHDRKRHEDLH 463

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 24/62 (38%), Gaps = 9/62 (14%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKC--------TWGNCNKAFNVKSNMLRHLKAHE 253
           C  CGK  +R    K H  +HTG   + C         WG C K F     + RH K   
Sbjct: 443 CAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWG-CGKKFARSDALGRHFKTEG 501

Query: 254 KK 255
            K
Sbjct: 502 GK 503

>Kwal_26.8351
          Length = 698

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 201 QCPACGKICSRPSTLKAHYL-IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           +C  C K   R   LK H   +H+ + PF C++  C+K F+   N+ +HLK H+K
Sbjct: 642 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHKK 694

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 201 QCPACGKICSRPSTLKAHYL-IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           +C  C K   R   LK H   +H+ + PF C +  C+K F+   N+ +HLK H+K
Sbjct: 622 KCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTHKK 674

>KLLA0F07073g 675221..676897 some similarities with sgd|S0004367
           Saccharomyces cerevisiae YLR375w STP3 involved in
           pre-tRNA splicing and in uptake of branched-chain amino
           acids, hypothetical start
          Length = 558

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 9/99 (9%)

Query: 172 DVKPIINKNSSKVPSKKRANRTLLSKL----RKQCPACGKICSRPSTLKAHYLIHTGDT- 226
           D+   +  NS     K   N  ++SK     +KQCP CG   S  ST K+ +L  + +T 
Sbjct: 352 DLNTHLMDNSKSAKMKIENNANMVSKKQPRKKKQCPLCGLFFSNLSTHKSTHL--SPETR 409

Query: 227 PFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIKKEALQIM 265
           PFKC    C++ F   ++++RH K H K  + +E++  +
Sbjct: 410 PFKCEV--CSRGFARSNDLIRHKKLHWKDDLNQESMDFV 446

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           C  C K  +RP  LK+H   HT + PF C+   C KAF  + +  RH   H  K
Sbjct: 428 CNLCDKKFTRPYNLKSHLRTHTDERPFSCSV--CGKAFARQHDRKRHEDLHSGK 479

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 25/62 (40%), Gaps = 9/62 (14%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKC--------TWGNCNKAFNVKSNMLRHLKAHE 253
           C  CGK  +R    K H  +H+G   + C        TWG C K F     + RH K   
Sbjct: 456 CSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWG-CGKKFARSDALGRHFKTES 514

Query: 254 KK 255
            +
Sbjct: 515 GR 516

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 23/51 (45%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           CP CG+   R      H   HTG+ P  C +  C K F+    + RH + H
Sbjct: 45  CPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 95

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 5/88 (5%)

Query: 171 QDVKPIINKNSSKVPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYL----IHTGDT 226
           QD KP  ++      + K++N   L    ++   C KICSR  T   H      IHTG+ 
Sbjct: 252 QDRKPKASQQHKISNTGKQSNTKDLPLAERRKYIC-KICSRGFTTSGHLARHNRIHTGEK 310

Query: 227 PFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
             +C +  CN+ F+   N ++H + H K
Sbjct: 311 RHQCQFPGCNQRFSRHDNYIQHYRTHFK 338

>Kwal_23.5400
          Length = 429

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVI 257
           QC  C +  SR + L+ H   H+ D PFKC++  C K    K  + RH   H +  +
Sbjct: 82  QCTVCARQFSRKTHLERHMFSHSEDKPFKCSY--CGKGVTTKQQLRRHEITHTRSFV 136

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 204 ACGKICSRPSTLKAH-YLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
            C K  SRPS L  H  ++H G  PF+CT   C + F+ K+++ RH+ +H
Sbjct: 56  GCSKAFSRPSQLTEHQEVVHQGIKPFQCT--VCARQFSRKTHLERHMFSH 103

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDT---PFKCTWGNCNKAFNVKSNMLRHLK 250
           C  CGK   RP  LK H   H        ++C+ G+C +AF   S + +H+K
Sbjct: 166 CEICGKRFQRPYRLKNHIAKHHNPDVVQKYQCSQGSCIEAFKTWSALQQHMK 217

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 5/60 (8%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTP--FKCTWGNCNKAFNVKS-NMLRHLKAHEKKVI 257
           QCP CGK C     L+ H  IH+      +KC    CN  +  K  +++ H   H K ++
Sbjct: 224 QCPECGKACVGEQGLQMHMKIHSNAVIKNWKCE--TCNDLYFAKKIDLMAHYMEHHKDLV 281

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           P C K+  R   +++H   H  D P+ C +  C KAF    +++RH  +H  K
Sbjct: 608 PNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAK 660

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query: 207 KICSRPSTLK----AHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           KI  +P+TL       Y+    D  F+C + NCNK F  + N+  H++ H
Sbjct: 578 KITKKPTTLPPGTIDQYVKELPDKLFECLYPNCNKVFKRRYNIRSHIQTH 627

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 201 QCPACGKICSRPSTLKAHYL-IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           QC  C K   R   LK H   +H+ + PF C +  C K F+   N+ +HLK H++
Sbjct: 485 QCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTHKR 537

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           +C  C +   R    K H+  HTG+ P KC + +C K+F+    + RH + H
Sbjct: 21  RCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRTH 72

>Scas_569.2
          Length = 293

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 1/69 (1%)

Query: 187 KKRANRTLLSKLRKQ-CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNM 245
           KKR +   L K RK  C  C K  +    L  H  IHTG+    C++  C   F+   N 
Sbjct: 214 KKRKHEEELEKRRKYICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNC 273

Query: 246 LRHLKAHEK 254
           ++H + H K
Sbjct: 274 VQHYRTHFK 282

>Scas_649.28
          Length = 730

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 201 QCPACGKICSRPSTLKAHYL-IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           +C  C K   R   LK H   +H+ + PF C +  C K F+   N+ +HLK H+K
Sbjct: 674 KCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHKK 726

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 205 CGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           C K  +R    + H   H  D P+KC +  C KAF    ++LRH K+H +K
Sbjct: 700 CQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDLLRHKKSHLEK 750

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 19/34 (55%)

Query: 219 YLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           Y++  G   F+C + +C K FN + N   H++ H
Sbjct: 684 YILEIGPKQFQCKFKDCQKRFNRRYNARTHIQTH 717

>Scas_712.2
          Length = 327

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 204 ACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
            CGK   RP  LK H   H+   P KC +  C K F     + RHL  H KK
Sbjct: 49  GCGKRFMRPCHLKVHKWTHSKVKPLKCAF--CEKGFITNQQLKRHLNTHAKK 98

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 3/71 (4%)

Query: 184 VPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKS 243
           V ++KR+ + +    + Q   C +  +RP  L+ H   HT + P+ C    C K F    
Sbjct: 2   VATEKRSKKKVY---KCQFEGCHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRFMRPC 58

Query: 244 NMLRHLKAHEK 254
           ++  H   H K
Sbjct: 59  HLKVHKWTHSK 69

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 22/51 (43%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           CP C +   R      H   HTG+ P  C +  C K F+    + RH + H
Sbjct: 36  CPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIH 86

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 2/57 (3%)

Query: 173 VKPIINKNSSKVPSKKRANRTLLSKLRKQC--PACGKICSRPSTLKAHYLIHTGDTP 227
           V PI ++   ++  + R  RT   +    C  P CGK  SR   L  H  IHT   P
Sbjct: 35  VCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIHTNPAP 91

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 201 QCPACGKICSRPSTLKAHYL-IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           +C  C K   R   LK H   +H+ + PF C +  C K F+   N+ +HLK H+K
Sbjct: 574 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKK 626

>Kwal_47.19045
          Length = 266

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           +C  CGK   R    + H   HTG+ P  C +  C K F+    + RH++ H
Sbjct: 15  KCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTH 66

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 6/73 (8%)

Query: 184 VPSKKRANR-TLLSKLRKQ--CPACGKICSRPSTLKAHYL-IHTGDTPFKCTWGNCNKAF 239
           +P + R  + +L+  L KQ  C  C +   R   LK H   +H G+ P++C    CNK F
Sbjct: 245 LPPRTRGRKPSLVPDLSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHI--CNKKF 302

Query: 240 NVKSNMLRHLKAH 252
           +   N+ +H+K H
Sbjct: 303 SRSDNLNQHIKTH 315

>Kwal_14.2278
          Length = 463

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 22/51 (43%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           CP C +   R      H   HTG+ P  C +  C K F+    + RH + H
Sbjct: 25  CPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRIH 75

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 24/52 (46%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHE 253
           CP C +   R      H   HTG+ P  C +  C+K F+    + RH + H+
Sbjct: 28  CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD 79

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 5/66 (7%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVI---KK 259
           P CGK   RP  L+ H   H    P KC++  C + F     + RH   HE+++    KK
Sbjct: 92  PNCGKRFLRPCHLRVHKWTHAQVKPLKCSY--CERRFITNQQLKRHTNTHERRIAASKKK 149

Query: 260 EALQIM 265
           E    M
Sbjct: 150 ETEAAM 155

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 32/75 (42%), Gaps = 11/75 (14%)

Query: 184 VPSKKRANRTLLSKLRK---QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFN 240
           V   K+A +      RK   Q   C +  S PS L  H   HT + P+ C   NC K F 
Sbjct: 40  VDEAKKAKKGRTKSGRKYVCQIDGCKREFSVPSLLAQHRNAHTDERPYVCDEPNCGKRF- 98

Query: 241 VKSNMLR--HLKAHE 253
                LR  HL+ H+
Sbjct: 99  -----LRPCHLRVHK 108

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 40.4 bits (93), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%)

Query: 204 ACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
            CGK+ SRP  L+ H   HT + PF C    C K F   S++  H  +H +
Sbjct: 14  GCGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVHKWSHSQ 64

 Score = 34.7 bits (78), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 2/51 (3%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHE 253
           P CGK   R S LK H   H+   P  C    C+K F     + RH K H+
Sbjct: 43  PGCGKGFLRASHLKVHKWSHSQVKPLACP--VCSKGFTTNQQLSRHKKTHK 91

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 40.4 bits (93), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           P CGK   RP  L+ H   H+   P  CT   C K F     + RHL +HE+K
Sbjct: 47  PGCGKKFIRPCHLRVHKWTHSQIKPKACTL--CQKRFVTNQQLRRHLNSHERK 97

 Score = 31.6 bits (70), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%)

Query: 204 ACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAF 239
            C K+ +RPS L+ H   HT   P+ C    C K F
Sbjct: 18  GCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKF 53

>Scas_602.9
          Length = 547

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 176 IINKNSSKVPSKKRANRTLLSKLRKQ--CPACGKICSRPSTLKAHYL-IHTGDTPFKCTW 232
           +I K    +P  +    +LL    KQ  C  C +   R   LK H   +H G+ P+ C  
Sbjct: 469 VIRKKLGNMPKTRGRKPSLLPDATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHI 528

Query: 233 GNCNKAFNVKSNMLRHLKAH 252
             CNK F+   N+ +H+K H
Sbjct: 529 --CNKNFSRSDNLTQHIKTH 546

>Scas_683.30
          Length = 478

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 3/70 (4%)

Query: 196 SKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           ++ +KQCP C    +  ST K+ +L    D P KC    C + F   ++++RH K H K 
Sbjct: 283 TRRKKQCPTCLNYYANLSTHKSTHLT-PEDRPHKCPI--CERGFARNNDLIRHKKRHWKD 339

Query: 256 VIKKEALQIM 265
             KK+ ++++
Sbjct: 340 EFKKDKMKLL 349

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 202 CPACGKICSRPSTLKAHYL-IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           C  C K   R   LK H   +H+ D PF C    C K F+   N+ +H+K H+K
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHL--CEKKFSRSDNLSQHIKTHKK 588

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLK 250
           +C  C K+  R S LK H L H+    F C W  CN     + N+L+H+K
Sbjct: 535 RCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPW--CNSRHKRRDNLLQHMK 582

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 195 LSKLRKQ-CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHE 253
           + K RK  C  CGK  +    L  H  IHTG+    C +  C + F+   N L+H + H 
Sbjct: 74  VEKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133

Query: 254 KKV 256
           K+ 
Sbjct: 134 KRT 136

>Scas_575.3
          Length = 455

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 29/66 (43%)

Query: 187 KKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNML 246
           + RAN+   +     CP C +   R      H   HTG+ P +C +  C K F+    + 
Sbjct: 55  RSRANKDGDAPRPHVCPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELT 114

Query: 247 RHLKAH 252
           RH + H
Sbjct: 115 RHKRIH 120

>Kwal_26.8021
          Length = 507

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 194 LLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHE 253
           L+  +  +C  C K   R S  K H L H+   P+ C W  C      + N+ +H+K   
Sbjct: 383 LVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKTKH 440

Query: 254 KKVIKKEALQI 264
            + + +E L++
Sbjct: 441 VRHVVQELLEV 451

>Scas_703.23
          Length = 1341

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 41/97 (42%), Gaps = 5/97 (5%)

Query: 171 QDVKPIINKNSSKVPSKKRANRTLLSKLRK-QCPACGKICSRPSTLKAHYLIHTGDTPFK 229
           Q + P    N   +P K R  +T   K R   CP C +   R   LK H   HT + PF 
Sbjct: 44  QSITPAPLANVMPIPKKSRVIKT--DKPRPFLCPTCTRGFVRQEHLKRHQRSHTNEKPFL 101

Query: 230 CTWGNCNKAFNVKSNMLRHLKAHEKKVIKKEALQIMS 266
           C +  C + F  +  +LRH       +I  E  Q +S
Sbjct: 102 CVF--CGRCFARRDLVLRHQHKLHAALIGNELQQNLS 136

>Scas_718.44
          Length = 266

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 25/54 (46%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           C  C    +    L  H  IHTG+    C +  CN+ F+   N L+H + H KK
Sbjct: 212 CKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLKK 265

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           +C  C +   R    K H   HTG+ P  C++  C K+F+    + RH + H
Sbjct: 18  KCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTH 69

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           C  C K  +RP  LK+H   HT + P+ C+   C KAF    +  RH   H  K
Sbjct: 471 CDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLHTGK 522

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 24/62 (38%), Gaps = 9/62 (14%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKC--------TWGNCNKAFNVKSNMLRHLKAHE 253
           C  CGK  +R      H  +HTG   + C        +WG C K F     + RH K   
Sbjct: 499 CSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWG-CGKKFARSDALGRHFKTEL 557

Query: 254 KK 255
            K
Sbjct: 558 GK 559

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 33/68 (48%), Gaps = 5/68 (7%)

Query: 184 VPSKKRANRTLLSKLR-KQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVK 242
           +P K RA +T   K R   CP C +   R   LK H   HT + PF C    C K F  K
Sbjct: 12  IPKKSRAVKT--DKPRPFLCPICSRGFVRQEHLKRHQNSHTHEKPFLCL--ICGKCFARK 67

Query: 243 SNMLRHLK 250
             +LRHL+
Sbjct: 68  DLVLRHLQ 75

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRH 248
           CP C +  +R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 50  CPICTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 94

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 7/86 (8%)

Query: 177 INKNSSKVPS------KKRANRTLLSKLRKQ-CPACGKICSRPSTLKAHYLIHTGDTPFK 229
           I+K S+KV S      K + N   + + RK  C  C    +    L  H  IHTG+    
Sbjct: 222 ISKPSNKVYSNRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHV 281

Query: 230 CTWGNCNKAFNVKSNMLRHLKAHEKK 255
           C    CN++F+   N L+H + H KK
Sbjct: 282 CPHEGCNQSFSRHDNCLQHYRTHSKK 307

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRH 248
           CP C +  +R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 82  CPVCTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 126

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           +C  CGK  ++ S L  H   HT D PF C+   C K    +  + RH   H K
Sbjct: 138 KCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSI--CGKGVTTRQQLKRHEITHTK 189

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 40/89 (44%), Gaps = 7/89 (7%)

Query: 173 VKPIINKNSSKVPSKK-RANRTLLSKLRKQ---CPACGKICSRPSTLKAHYLIHTGDTPF 228
           +KP       K  +KK   NR + S    +   C  CGK  +    LK H + HT    F
Sbjct: 134 IKPFKCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSICGKGVTTRQQLKRHEITHT--KSF 191

Query: 229 KCTWGNCNKAFNVKSNMLRH-LKAHEKKV 256
            C++  CN++F     +  H L  HEKK+
Sbjct: 192 HCSYEGCNESFYKHPQLRSHILSVHEKKL 220

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTP---FKCTWGNC-NKAFNVKSNMLRHLKAHEKKV 256
           CP CGK C   S L+ H +IH        +KC+  +C + +F  K+ +++H +   K V
Sbjct: 281 CPICGKPCVAESGLRNHMMIHDESLVTKNWKCS--SCPDTSFAKKTQLVQHYEESHKDV 337

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 7/54 (12%)

Query: 202 CPACGKICSRPSTLKAHYLIH-----TGDTPFKCTWGNCNKAFNVKSNMLRHLK 250
           CP C K   RP  LK H   H     TG   ++C + +C   F+  S++ +H+K
Sbjct: 222 CPHCNKTFQRPYRLKNHIDKHHNPESTG--MYQCDFLSCTDVFSTWSSLQQHIK 273

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 4/53 (7%)

Query: 207 KICSRPSTLKAHYL----IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           KIC+R  T   H      IHTG+    C +  C + F+   N L+H + H KK
Sbjct: 177 KICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKK 229

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 202 CPACGKICSRPSTLKAHYL-IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           C  C K   R   LK H   +H+ + PF C    C+K F+   N+ +H+K H+K
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTHKK 700

>CAGL0H04873g complement(465069..466424) some similarities with
           tr|Q05937 Saccharomyces cerevisiae YLR375w STP3 or
           tr|Q07351 Saccharomyces cerevisiae YDL048c STP4,
           hypothetical start
          Length = 451

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 184 VPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKS 243
           VPS K   +    + RKQCP C    +  +T KA +L      PF C+   C + F  ++
Sbjct: 248 VPSVKTDMKVTKKRRRKQCPICHGFFANLTTHKAIHL-EPDIKPFVCSV--CQRGFVRQN 304

Query: 244 NMLRHLKAHEKKVIKKEALQ 263
           +++RH K H K  I   A++
Sbjct: 305 DVMRHEKMHWKDKILSSAVK 324

>Kwal_27.10167
          Length = 285

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           P CGK   R   +  H   H+   P KC    C+K F  K  + RHL  H+K+
Sbjct: 70  PNCGKRFLRVCHMNVHRWTHSKIKPLKCE--ECSKGFTTKQQLSRHLATHKKR 120

 Score = 31.6 bits (70), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 202 CP--ACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           CP  +C K   +PS+L+ H   H  + PF C   NC K F    +M  H   H K
Sbjct: 37  CPITSCNKRYRKPSSLREHVNSHNNNRPFACPEPNCGKRFLRVCHMNVHRWTHSK 91

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 5/70 (7%)

Query: 180 NSSKVPSKKRANRTLLSKLRKQ-CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKA 238
           N + +P K R  +T   K R   CP C +   R   LK H   HT + PF C +  C + 
Sbjct: 14  NFAPIPKKSRTIKT--DKPRPHLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVF--CGRC 69

Query: 239 FNVKSNMLRH 248
           F  +  +LRH
Sbjct: 70  FARRDLVLRH 79

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLK 250
           +C  C K   R S LK H L H+   P+ C W  C+     K N+ +HLK
Sbjct: 186 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLK 233

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 79/199 (39%), Gaps = 12/199 (6%)

Query: 59  SRSRSMPKN---GIVNANRMERHISLPPISSLMSTIYNTNVDNFHMQQPLPYEKKQQVDH 115
           S +R+ P N      N+     HI+LPPISS  S I     +  ++   +      Q+  
Sbjct: 23  SSARAGPSNTSTSPTNSAAHPAHITLPPISSFDSLI--RAAEEQYINGAVTANNSPQIGS 80

Query: 116 NNLDTLMIQAKVLMNNDASNVKADVTSRNIQPSNQPVNPVVTGXXXXXXXXXXXXQDVKP 175
            ++           NN  +N      S  + P +   + +V              Q    
Sbjct: 81  LSVSPASAIQSRDHNNGHNNALVYQLSTTMTPRSNSTDSIVGLPSPTTASASFFIQQRST 140

Query: 176 IINKNSSKVPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNC 235
            ++  S ++ S    NR    + +K+CP C    +  ST K+ +L    D P KC+   C
Sbjct: 141 SVDSGSPQINS----NRVSKPRRKKECPVCHNFYANLSTHKSTHLT-PEDRPHKCSV--C 193

Query: 236 NKAFNVKSNMLRHLKAHEK 254
           ++ F   +++LRH K H K
Sbjct: 194 SRGFARSNDLLRHKKRHWK 212

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 202 CPACGKICSRPSTLKAHYLIHTG---DTPFKCTWGNCNKAFNVKSNMLRHLK 250
           CP C K   RP  L+ H   H     + P++CT+  C K F + S +  H+K
Sbjct: 165 CPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAGCCKEFRIWSQLQSHIK 216

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVI 257
           QC  C K   + S L+ H   H+   PF+C++  C K    +  + RH   H K  I
Sbjct: 81  QCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKRHEVTHTKSFI 135

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 24/44 (54%)

Query: 220 LIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIKKEALQ 263
           L++T    ++C + NC++ F  K    +H+  H+   +K + LQ
Sbjct: 357 LLNTVGRKYRCFYNNCSRTFKTKEKYEKHIDKHKVHELKLKILQ 400

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRH 248
           CP C +  +R   L+ H   HT + PF C +  C + F  +  +LRH
Sbjct: 85  CPICTRGFARQEHLRRHERSHTNEKPFLCAF--CGRCFARRDLVLRH 129

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 196 SKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           +K ++QCP C K  +  ST K+ +L  + D P KC    C   F   ++++RH K H K 
Sbjct: 320 TKKKRQCPICHKYFANLSTHKSTHLT-SQDRPHKCII--CQSGFARNNDLIRHRKRHWKD 376

Query: 256 VIKKEA 261
            I+  A
Sbjct: 377 DIQNIA 382

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 27/64 (42%), Gaps = 2/64 (3%)

Query: 197 KLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKV 256
           K   QC  C K   R S LK H L H+    F C W  C      K N+L+H+K      
Sbjct: 343 KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHTNY 400

Query: 257 IKKE 260
           +  E
Sbjct: 401 LLDE 404

>Scas_670.2
          Length = 435

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 197 KLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKV 256
           + +KQCP C    +  +T KA +L+   D P KC    C + F   ++++RH K H K  
Sbjct: 249 RRKKQCPICSGYYANLTTHKATHLVPE-DRPHKCPI--CQRGFGRNNDLIRHQKRHWKDA 305

Query: 257 I 257
           +
Sbjct: 306 L 306

>Kwal_47.17241
          Length = 403

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 202 CPACGKICSRPSTLKAHYL-IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           C  C +   R   LK H   +H G+ PF C    C K F+   N+ +H+K H
Sbjct: 348 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHI--CGKKFSRSDNLNQHIKTH 397

>Scas_721.92
          Length = 1152

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRH 248
           C  C +  +R   L  H   HT + P++C  G C K F  +  +LRH
Sbjct: 80  CDVCSRAFARQEHLDRHARSHTNEKPYQC--GICTKKFTRRDLLLRH 124

>Kwal_47.16621
          Length = 1178

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 57/133 (42%), Gaps = 28/133 (21%)

Query: 124 QAKVLMNNDASNVKADVTSR--NIQPSNQPVNPVVTGXXXXXXXXXXXXQDVKPIINKNS 181
           QA + M ++ S+   D T++  N+  ++   +P ++                 P+I + +
Sbjct: 12  QAALAMESETSSGSKDATTQYINVSGTSSRSSPTIS----------------PPVIGQKA 55

Query: 182 SK-----VPSKKRANRTLLSKLR-KQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNC 235
           S      +P K R  +T   + R   C  C +  +R   LK H   HT + PF C +  C
Sbjct: 56  STPATMPIPKKSRTIKT--DRPRPFLCSICTRGFARQEHLKRHQRAHTNEKPFLCAF--C 111

Query: 236 NKAFNVKSNMLRH 248
            + F  +  +LRH
Sbjct: 112 GRCFARRDLVLRH 124

>Scas_717.17
          Length = 525

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLK-AHEKKVIKK 259
           C  C K   R S LK H L H+ +  + C W  C      + N+L+H+K  H K +I +
Sbjct: 390 CHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKLKHSKNLINE 446

>Scas_683.25
          Length = 879

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 199 RKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNM-LRHLK-AHEKKV 256
           R  C  C K  SR      H   HTG  P+KC    C   F V+S++ LRH+K  H+K++
Sbjct: 14  RFICSFCAKGFSRAEHKIRHERSHTGLKPYKC--KVCTHCF-VRSDLALRHIKTVHKKEI 70

Query: 257 IKK 259
           +++
Sbjct: 71  LQR 73

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 2/61 (3%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIKKEA 261
           C  C +   R   LK H   HT + PF C +  C + F  +  +LRH       ++ KE+
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRHQHKLHSALVSKES 120

Query: 262 L 262
           +
Sbjct: 121 I 121

>Scas_631.7
          Length = 433

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 202 CPACGKICSRPSTLKAHYLIHTG---DTPFKCTWGNCNKAFNVKSNMLRHLK 250
           C  CGK   RP  L+ H   H      TP++CT+ NC+++F   +    H+K
Sbjct: 173 CKHCGKKFQRPYRLQNHIAKHHNPDVKTPYQCTFANCHRSFRTWTLYQSHVK 224

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           +C  C K  SR + L+ H + H+   PF C   +C K    +  + RH   H K
Sbjct: 89  KCEQCDKQFSRKTHLERHLISHSDSKPFCCL--HCGKGVTTRQQLKRHEVTHTK 140

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 6/73 (8%)

Query: 171 QDVKPIINKNSSKVPSKK-RANRTLLSKLRKQ---CPACGKICSRPSTLKAHYLIHTGDT 226
           Q +KP   +   K  S+K    R L+S    +   C  CGK  +    LK H + HT   
Sbjct: 83  QGIKPFKCEQCDKQFSRKTHLERHLISHSDSKPFCCLHCGKGVTTRQQLKRHEVTHT--K 140

Query: 227 PFKCTWGNCNKAF 239
            FKC + NC++A+
Sbjct: 141 SFKCPYENCDEAY 153

>YDL048C (STP4) [816] chr4 complement(366739..368211) Protein with
           strong similarity to Stp1p, which is involved in tRNA
           splicing and branched-chain amino acid uptake [1473 bp,
           490 aa]
          Length = 490

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 8/93 (8%)

Query: 175 PIINKNSSKVPSK-KRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWG 233
           P+ N+++S+  S  K + +    + +K+CP C    +  ST K+ +L    D P KC   
Sbjct: 251 PLTNEHTSRYSSSLKDSAKITKQRKKKECPICHNFYANLSTHKSTHLT-PEDRPHKCPI- 308

Query: 234 NCNKAFNVKSNMLRHLKAHEKKVIKKEALQIMS 266
            C + F   ++++RH K H     K E +QI +
Sbjct: 309 -CQRGFARNNDLIRHKKRH----WKDEFMQIYA 336

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           QC  CG+  ++ S L+ H   H+   PF CT   C K    +  + RH   H K
Sbjct: 151 QCEQCGRGFTKKSHLERHLFSHSETKPFSCT--VCGKGVTTRQQLRRHEITHTK 202

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 3/51 (5%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTP---FKCTWGNCNKAFNVKSNMLRHL 249
           C  C K   RP  LK H   H G      ++CT   C + F   S + +HL
Sbjct: 235 CTHCDKRFQRPYRLKTHIAKHHGPASQFRYQCTNAGCVQCFETWSALQQHL 285

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 35.0 bits (79), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 4/52 (7%)

Query: 207 KICSRPSTLKAHYL----IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           KICSR  T   H      IHTG+    C +  C + F+   N ++H + H K
Sbjct: 103 KICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154

>Scas_707.31
          Length = 289

 Score = 35.8 bits (81), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 202 CPACGKICSRPSTLKAHY-LIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVI 257
           C  C K   R   LK H+  IH    PF+C+   C+K F+   N+ +H++ HE++ I
Sbjct: 225 CHLCKKRFKRHEHLKRHFRTIHLRVRPFECS--VCHKRFSRNDNLNQHVRIHEQQPI 279

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 199 RKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVI 257
           +KQCP C    +  +T KA +L    D P KC    C++ F   +++LRH K H K  I
Sbjct: 141 KKQCPICRNFYANLTTHKATHLT-PEDRPHKCPI--CHRGFARNNDLLRHKKRHWKDEI 196

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 35.0 bits (79), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 202 CPACGKICSRPSTLKAHYL-IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           C  C +   R   LK H   +H G+ P+ C    C K F+   N+ +H+K H
Sbjct: 356 CEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEI--CGKKFSRSDNLNQHIKTH 405

>Scas_719.68
          Length = 1350

 Score = 35.0 bits (79), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 7/65 (10%)

Query: 184 VPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKS 243
           +P K R  +T      K  P    IC+R   LK H   HT + PF C +  C + F  + 
Sbjct: 26  IPKKSRTIKT-----DKPRPFLCPICTRTEHLKRHQRSHTREKPFVCVF--CGRCFARRD 78

Query: 244 NMLRH 248
            +LR+
Sbjct: 79  LVLRY 83

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 34.7 bits (78), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 3/59 (5%)

Query: 202 CPACGKICSRPSTLKAHYL-IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIKK 259
           C  C +   R   LK H   +H G+ P+ C    C K F+   N+ +H+K H     ++
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGCDI--CGKKFSRSDNLNQHIKTHSNGATER 518

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 34.3 bits (77), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 202 CPACGKICSRPSTLKAHYL-IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           C  C +   R   LK H   +H  + PF C    CNK F+   N+ +H+K H
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI--CNKNFSRSDNLNQHVKTH 440

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 34.3 bits (77), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 26/57 (45%), Gaps = 3/57 (5%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKA-HEKKVIK 258
           P C    SR   L  H   HTG+ PFKC    C K F+   N+ +H    H K  +K
Sbjct: 31  PGCEMSFSRAEHLARHIRRHTGEKPFKCDI--CLKYFSRIDNLKQHKDTVHAKDNVK 85

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRH 248
           CP C +   R   LK H   HT + P+ C +  C + F  +  +LRH
Sbjct: 153 CPTCTRGFVRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRH 197

>Scas_378.1
          Length = 208

 Score = 33.1 bits (74), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLK 250
           QC  C K   R S LK H L H+    + C    C      K N+L+HLK
Sbjct: 85  QCHMCVKSFRRHSWLKRHLLAHSSQRHYSCP--KCVSKHKRKDNLLQHLK 132

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 8/64 (12%)

Query: 199 RKQCP--ACGKICSRPSTLKAHYLIHTGDTPFKCTW------GNCNKAFNVKSNMLRHLK 250
           R +CP   C K  SR   L  H L H     + C++        CNK F  K  ++RH K
Sbjct: 30  RFRCPHPECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRHEK 89

Query: 251 AHEK 254
            H K
Sbjct: 90  RHSK 93

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 29/68 (42%), Gaps = 8/68 (11%)

Query: 196 SKLRKQCP--ACGKICSRPSTLKAHYLIHTGDTPFKCTWGN------CNKAFNVKSNMLR 247
            + R +CP   C K  SR   L  H L H     FKC + +      C K F  +  + R
Sbjct: 41  GQYRYKCPHPTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRRDLLNR 100

Query: 248 HLKAHEKK 255
           H K HE K
Sbjct: 101 HEKRHENK 108

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 3/52 (5%)

Query: 202 CPACGKICSRPSTLKAHYL-IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           C  C +   R   LK H   +H  + P+ C    C K F+   N+ +HLK H
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGCHL--CGKKFSRSDNLSQHLKTH 469

>Kwal_27.10925
          Length = 264

 Score = 32.3 bits (72), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 29/68 (42%)

Query: 188 KRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLR 247
           KR    +  + R  C  C K  +    L  H  IHTG+    C    C + F+   N ++
Sbjct: 189 KRTRSPVEQRRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQ 248

Query: 248 HLKAHEKK 255
           H K H ++
Sbjct: 249 HYKTHLRR 256

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 2/59 (3%)

Query: 196 SKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           S+ +  C  C K  SR      H   HTG  PF C+   C+ +F  +  + RH++   K
Sbjct: 4   SQRKYICSFCAKPFSRSEHKARHERSHTGSKPFSCS--ICSHSFVRRDLLQRHIRTVHK 60

>Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement
          Length = 546

 Score = 32.0 bits (71), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 12/70 (17%)

Query: 181 SSKVPSKKRANRTLLSKLR-----------KQCPACGKICSRPSTLKAHYLIHTGD-TPF 228
           +SK+P     + T + KLR           K CP    + +  + LK H  +HTG+ T +
Sbjct: 15  ASKIPRDWVIDETTIQKLREVKVGLSEEIDKLCPESENLVTHSTILKLHSSVHTGELTCY 74

Query: 229 KCTWGNCNKA 238
           +  +  C++A
Sbjct: 75  QVVYSFCHRA 84

>Kwal_47.16577
          Length = 881

 Score = 32.0 bits (71), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 1/54 (1%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKV 256
           P C K  SR   L  H   H+ +  +KC W  C + F+      +H   H + V
Sbjct: 18  PGCSKSFSRSDHLGRHKANHSSEK-YKCEWPACGREFSRLDVKKKHFGRHLRDV 70

 Score = 28.1 bits (61), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 19/37 (51%)

Query: 224 GDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIKKE 260
           G  PF C +  C+K+F+   ++ RH   H  +  K E
Sbjct: 9   GSGPFFCPFPGCSKSFSRSDHLGRHKANHSSEKYKCE 45

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 31.6 bits (70), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 215 LKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH--EKKVIKKE 260
           + +H  +H    PF C+   CNK F    ++ +HLK H  E  ++KK+
Sbjct: 164 ITSHLRVHVQLKPFACS--TCNKKFKRPQDLKKHLKVHNEELSLLKKK 209

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 31.6 bits (70), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 18/24 (75%), Gaps = 1/24 (4%)

Query: 228 FKCT-WGNCNKAFNVKSNMLRHLK 250
           FKCT +GNC+++F    ++ RH++
Sbjct: 20  FKCTGYGNCDRSFTRAEHLARHIR 43

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 31.6 bits (70), Expect = 0.73,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 2/62 (3%)

Query: 196 SKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255
           S+ +  C  C +  SR      H   HTG  PF C    CN +F  +  + RH++   + 
Sbjct: 4   SQRKYICSFCAQAFSRSEHKTRHERSHTGVKPFSCKV--CNHSFVRRDLLQRHIRTVHRS 61

Query: 256 VI 257
           ++
Sbjct: 62  ML 63

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 31.2 bits (69), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 2/63 (3%)

Query: 199 RKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIK 258
           R  C  C K  SR      H   H G  PF+C    C+ +F  +  + RH++   + ++ 
Sbjct: 11  RHFCSFCNKAFSRSEHKTRHERSHAGVKPFECQV--CSHSFVRRDLLQRHIRTVHRILLL 68

Query: 259 KEA 261
           ++ 
Sbjct: 69  RDT 71

>Scas_627.6
          Length = 1207

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 31/79 (39%), Gaps = 6/79 (7%)

Query: 182 SKVPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKC------TWGNC 235
           +  P +K A   +  +     P C K  +R   L  H L H     F C      T   C
Sbjct: 26  ASAPVQKSAKLAVTERYICPHPDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITC 85

Query: 236 NKAFNVKSNMLRHLKAHEK 254
           NK F  K  ++RH K H K
Sbjct: 86  NKTFVRKDLLIRHQKRHTK 104

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 197 KLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           +L+ Q   C     +   + +H  +H    PF C+   C+K F    ++ +HLK H
Sbjct: 188 QLKCQWDNCTSKTEKRDHMTSHLRVHVPLKPFACS--TCSKRFKRPQDLKKHLKIH 241

>AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH]
           (783110..784408) [1299 bp, 432 aa]
          Length = 432

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 215 LKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIKKEA 261
           + +H  +H    PF C+   C++ F    ++ +HLK H +  +K+ +
Sbjct: 123 ITSHLRVHVPLKPFSCS--TCSRKFKRPQDLKKHLKVHMEDTMKERS 167

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 6/62 (9%)

Query: 197 KLRKQCPACGKICSRPSTLKAHYL-IHTG-----DTPFKCTWGNCNKAFNVKSNMLRHLK 250
           +L  Q  ACG   S+P  L  H    H G     +    C WG+C      + ++  HL+
Sbjct: 69  RLLCQWDACGSEFSQPELLYHHLCQDHVGRKSQRNLQLNCHWGSCTTKTVKRDHITSHLR 128

Query: 251 AH 252
            H
Sbjct: 129 VH 130

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 6/58 (10%)

Query: 201 QCPACGKICSRPSTLKAHYL-IHTGDTPFK-----CTWGNCNKAFNVKSNMLRHLKAH 252
           Q   C ++  +P  L  H    H G    K     C WGNCN     + ++  HL+ H
Sbjct: 55  QWQGCSQVFPQPELLYHHLCNDHVGRKSQKNLQLNCNWGNCNTKTVKRDHITSHLRVH 112

 Score = 28.5 bits (62), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 12/24 (50%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGD 225
           C  CGK   RP  LK H  +H  D
Sbjct: 120 CSTCGKKFKRPQDLKKHLRVHLDD 143

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRH 248
           P C    +R   L  H   HTG+ PF+C    C K F+   N+ +H
Sbjct: 25  PDCNMSFNRTEHLARHIRKHTGEKPFQCNI--CLKFFSRIDNLRQH 68

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 8/67 (11%)

Query: 196 SKLRKQCPA--CGKICSRPSTLKAHYLIHTGDTPFKCTW------GNCNKAFNVKSNMLR 247
            K R  CP   C K  +R   L  H L H     F+C +        CN+ F  +  ++R
Sbjct: 12  GKPRYVCPHPNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVR 71

Query: 248 HLKAHEK 254
           H K H +
Sbjct: 72  HEKRHSR 78

>KLLA0E13519g complement(1190615..1191307) some similarities with
           sgd|S0006226 Saccharomyces cerevisiae YPR022c,
           hypothetical start
          Length = 230

 Score = 29.3 bits (64), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 6/56 (10%)

Query: 203 PACGKICSRPSTLKAHYLIHTGDTPFKCTWGN------CNKAFNVKSNMLRHLKAH 252
           P C K  SR   L+ H L H     F+C +        CN+ F  K  ++RH + H
Sbjct: 23  PDCEKTFSRYEHLQRHKLNHWPKQIFRCEYVYPDDGIVCNRTFVRKDLLVRHQRRH 78

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 29.3 bits (64), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 204 ACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKA 251
            C    +R   L  H   HTG+ PF+C    C K F+   N+ +H ++
Sbjct: 48  GCTMSFTRAEHLARHIRKHTGEKPFQCPA--CLKFFSRVDNLKQHRES 93

>Kwal_55.20634
          Length = 419

 Score = 29.3 bits (64), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 215 LKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           + +H  +H    PF C+   C K F    ++ +HLK H
Sbjct: 109 ITSHLRVHVPLKPFACS--TCTKTFKRPQDLKKHLKVH 144

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 6/55 (10%)

Query: 204 ACGKICSRPSTLKAHYL-IHTGDTPFK-----CTWGNCNKAFNVKSNMLRHLKAH 252
           ACG+  ++P  L  H    H G    K     C WG C      + ++  HL+ H
Sbjct: 62  ACGQKFAQPELLYHHLCHDHVGRKSQKNLQLNCRWGKCTAKTVKRDHITSHLRVH 116

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 6/54 (11%)

Query: 205 CGKICSRPSTLKAHYL-IHTGDTPFK-----CTWGNCNKAFNVKSNMLRHLKAH 252
           CG I ++P  L  H    H G    K     C WG+C      + ++  HL+ H
Sbjct: 153 CGMIFNQPELLYNHLCHDHVGRKSHKNLQLNCHWGDCTTKTEKRDHITSHLRVH 206

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 215 LKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252
           + +H  +H    PF C+   C+K F    ++ +HLK H
Sbjct: 199 ITSHLRVHVPLKPFGCS--TCSKKFKRPQDLKKHLKIH 234

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 28.9 bits (63), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%)

Query: 182 SKVPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAHY 219
           S+    +R  +T  + L   CP CGK  +R   LK HY
Sbjct: 108 SRSSDLRRHEKTHFAILPNICPQCGKGFARKDALKRHY 145

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 28.9 bits (63), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 2/54 (3%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           +C  C    ++   L+ H   HT + PF C++  C K    +  + RH   H K
Sbjct: 68  KCNQCESSFTKKIHLERHLYTHTDERPFYCSF--CGKGLITRQQLKRHEVTHTK 119

 Score = 28.9 bits (63), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 10/60 (16%)

Query: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAF--------NVKSNMLRHLKAHE 253
           C  CGK       LK H + HT    F C +  CN++F        ++ +  L+ LK HE
Sbjct: 97  CSFCGKGLITRQQLKRHEVTHT--KSFNCEYEGCNESFYKHPQLRAHILAVHLQSLKCHE 154

 Score = 28.5 bits (62), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 201 QCPACGKICSRPSTLKAHYLIHTGDT---PFKCTWGNCNKAFNVKSNMLRHLK 250
           +C  C K   RP  LK H   H        ++CT+  C+K+F   S +  H+K
Sbjct: 151 KCHECNKSFQRPYRLKNHIAKHHNPDVVNAYQCTFSVCSKSFKTWSALRLHVK 203

>Kwal_26.9300
          Length = 304

 Score = 28.9 bits (63), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 197 KLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254
           + +K+CP C    +  ST ++ +L    + P KC    C + F   +++LRH K H K
Sbjct: 143 RRKKECPICHNFYANLSTHRSSHL-QPENKPHKCP--VCGRGFTRHNDLLRHRKRHWK 197

>ADL227C [1514] [Homologous to ScYIL101C (XBP1) - SH]
           (305768..307777) [2010 bp, 669 aa]
          Length = 669

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 25/38 (65%)

Query: 75  MERHISLPPISSLMSTIYNTNVDNFHMQQPLPYEKKQQ 112
           ++R  SLPPIS+L++++ N N++   M   L  E K++
Sbjct: 519 VQRQESLPPISTLINSLPNFNLEAAEMPNSLALEYKKE 556

>CAGL0M06919g complement(703702..706572) similar to sp|P53971
           Saccharomyces cerevisiae YNL023c FAP1, start by
           similarity
          Length = 956

 Score = 28.5 bits (62), Expect = 7.4,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 10/47 (21%)

Query: 193 TLLSKLRKQC----PACGKICSRPSTLKAHYLIHTGDTPFKCTWGNC 235
           T LSK R +C    P CG++C +      H        PF C  G+C
Sbjct: 344 TDLSKPRSKCTDAIPTCGQVCGKMLKCGKH------KCPFACHLGDC 384

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.128    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,824,911
Number of extensions: 385305
Number of successful extensions: 1883
Number of sequences better than 10.0: 212
Number of HSP's gapped: 1783
Number of HSP's successfully gapped: 286
Length of query: 266
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 166
Effective length of database: 13,134,309
Effective search space: 2180295294
Effective search space used: 2180295294
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)