Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_594.665565525920.0
YMR227C (TAF7)5902419531e-120
CAGL0M11264g5492618551e-106
AFR563C5762758281e-102
Kwal_26.91765512668251e-102
KLLA0B08305g7352718221e-99
Kwal_26.720123495740.50
Sklu_2271.3552122702.4
Kwal_56.24832156980676.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_594.6
         (655 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_594.6                                                           1003   0.0  
YMR227C (TAF7) [4183] chr13 complement(722612..724384) Component...   371   e-120
CAGL0M11264g complement(1106912..1108561) similar to sp|Q05021 S...   333   e-106
AFR563C [3755] [Homologous to ScYMR227C (TAF67) - SH] (1444641.....   323   e-102
Kwal_26.9176                                                          322   e-102
KLLA0B08305g 737967..740174 some similarities with sp|Q05021 Sac...   321   1e-99
Kwal_26.7201                                                           33   0.50 
Sklu_2271.3 YBR255W, Contig c2271 1824-3482 reverse complement         32   2.4  
Kwal_56.24832                                                          30   6.6  

>Scas_594.6
          Length = 655

 Score = 1003 bits (2592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/655 (78%), Positives = 517/655 (78%)

Query: 1   MEGNKVHPSRQPDIITAKVIYWLVMVTIKLKRPNPPKETAEDSTNXXXXXXXXXXXXXXX 60
           MEGNKVHPSRQPDIITAKVIYWLVMVTIKLKRPNPPKETAEDSTN               
Sbjct: 1   MEGNKVHPSRQPDIITAKVIYWLVMVTIKLKRPNPPKETAEDSTNKEPKLKKIRIKTKNK 60

Query: 61  DNEQXXXXXXXXXXXXXXXVTDPLMDKPVGGPLKLKLHRKPSASPIVEKKVHKAPRLRLK 120
           DNEQ               VTDPLMDKPVGGPLKLKLHRKPSASPIVEKKVHKAPRLRLK
Sbjct: 61  DNEQIPKKPKLKISLKKRKVTDPLMDKPVGGPLKLKLHRKPSASPIVEKKVHKAPRLRLK 120

Query: 121 PIRIPGEGYDSEASDIEDDPLIESGIILRVLPDIQVEFVKNSIESGDYSGLTVKWLGHRH 180
           PIRIPGEGYDSEASDIEDDPLIESGIILRVLPDIQVEFVKNSIESGDYSGLTVKWLGHRH
Sbjct: 121 PIRIPGEGYDSEASDIEDDPLIESGIILRVLPDIQVEFVKNSIESGDYSGLTVKWLGHRH 180

Query: 181 AVVNINGNMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLICIKTIQKEDEVFTLKAP 240
           AVVNINGNMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLICIKTIQKEDEVFTLKAP
Sbjct: 181 AVVNINGNMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLICIKTIQKEDEVFTLKAP 240

Query: 241 NSEDLVTKHYSDIEEEILGNKKVLMKEQNTDLLSELEKQYLDEIATKGYDYKHGLSPPLY 300
           NSEDLVTKHYSDIEEEILGNKKVLMKEQNTDLLSELEKQYLDEIATKGYDYKHGLSPPLY
Sbjct: 241 NSEDLVTKHYSDIEEEILGNKKVLMKEQNTDLLSELEKQYLDEIATKGYDYKHGLSPPLY 300

Query: 301 NVRNRRFRRKMGPSEFEYAEEVVETLLRQDEKAENVTYELVDESEMLGRSNSTPIISEDY 360
           NVRNRRFRRKMGPSEFEYAEEVVETLLRQDEKAENVTYELVDESEMLGRSNSTPIISEDY
Sbjct: 301 NVRNRRFRRKMGPSEFEYAEEVVETLLRQDEKAENVTYELVDESEMLGRSNSTPIISEDY 360

Query: 361 FKDADVQEPSAAIESTVPILPIDENIRKEAKIQTNVNXXXXXXXXXXAAVFGSDSDKEEF 420
           FKDADVQEPSAAIESTVPILPIDENIRKEAKIQTNVN          AAVFGSDSDKEEF
Sbjct: 361 FKDADVQEPSAAIESTVPILPIDENIRKEAKIQTNVNLEDEDEDLDLAAVFGSDSDKEEF 420

Query: 421 NNNTDLTSGQTPTVDNQRFETVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 480
           NNNTDLTSGQTPTVDNQRFETV                                      
Sbjct: 421 NNNTDLTSGQTPTVDNQRFETVEQESGSEGNEEEEEEEEDDDEEDEEEEDDEEEEEGETG 480

Query: 481 XLVAKEDRQHVXXXXXXXXXXXXXXXXXRNKLQKVTNPLLRSRFIDNIXXXXXXXXXXRR 540
            LVAKEDRQHV                 RNKLQKVTNPLLRSRFIDNI          RR
Sbjct: 481 ELVAKEDRQHVELLADELSELETTLTHTRNKLQKVTNPLLRSRFIDNIKKLEKEVELKRR 540

Query: 541 QFKIREDQLNNVNPHDSNDLHKSPSTKTSALXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 600
           QFKIREDQLNNVNPHDSNDLHKSPSTKTSAL                             
Sbjct: 541 QFKIREDQLNNVNPHDSNDLHKSPSTKTSALDMDDEEEEEDDMEDEEEEDDEDEEEEEEE 600

Query: 601 XXXRNIEADEIVPEQSNSNTEAISMTNTDGITNLQENLDQNDLDMMMLFGAEGDE 655
              RNIEADEIVPEQSNSNTEAISMTNTDGITNLQENLDQNDLDMMMLFGAEGDE
Sbjct: 601 EEERNIEADEIVPEQSNSNTEAISMTNTDGITNLQENLDQNDLDMMMLFGAEGDE 655

>YMR227C (TAF7) [4183] chr13 complement(722612..724384) Component of
           the TAF(II) complex (TBP-associated factor), required
           for activated transcription by RNA polymerase II [1773
           bp, 590 aa]
          Length = 590

 Score =  371 bits (953), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 173/241 (71%), Positives = 210/241 (87%)

Query: 109 KKVHKAPRLRLKPIRIPGEGYDSEASDIEDDPLIESGIILRVLPDIQVEFVKNSIESGDY 168
           KK+HKAP+LRLKPIRIPGE YDSEASDIEDDPLIESG+ILR+LPDIQ+EFVKNS+ESGDY
Sbjct: 79  KKIHKAPKLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRILPDIQLEFVKNSLESGDY 138

Query: 169 SGLTVKWLGHRHAVVNINGNMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLICIKTI 228
           SG+++KW   RHAVV IN  MYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQML+CI+ I
Sbjct: 139 SGISIKWKNERHAVVTINDVMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLLCIRPI 198

Query: 229 QKEDEVFTLKAPNSEDLVTKHYSDIEEEILGNKKVLMKEQNTDLLSELEKQYLDEIATKG 288
           Q+E+EV+ L+AP++EDLV KH+  IE+EI  NK+  +K  N   LS++E ++L EIA KG
Sbjct: 199 QEEEEVYALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNGAPLSDMEAKHLKEIALKG 258

Query: 289 YDYKHGLSPPLYNVRNRRFRRKMGPSEFEYAEEVVETLLRQDEKAENVTYELVDESEMLG 348
           YDYKHG+SPPLYNVRNRRFRRKM P+E +Y E+VV+ LL+QD++AE V+Y+LVD+SE+  
Sbjct: 259 YDYKHGISPPLYNVRNRRFRRKMDPNEIDYVEKVVDMLLKQDKQAEEVSYDLVDKSELQA 318

Query: 349 R 349
           R
Sbjct: 319 R 319

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 66/170 (38%), Gaps = 16/170 (9%)

Query: 486 EDRQHVXXXXXXXXXXXXXXXXXRNKLQKVTNPLLRSRFIDNIXXXXXXXXXXRRQFKIR 545
           E+RQH                  ++KL K TNPLL+SRFID+I          R+Q +  
Sbjct: 437 ENRQHTELLADELNELETTLAHTKHKLSKATNPLLKSRFIDSIKKLEKEAELKRKQLQQT 496

Query: 546 EDQLNNVNPHDSNDLHKSPSTKTSALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRN 605
           ED +   + H S+   ++ +                                       +
Sbjct: 497 EDSVQKQHQHRSD--AETANNVEEEEEEEEEEEEEDEVDEDEEDDEENDEDEDNVHEREH 554

Query: 606 IEADEIVPEQSNSNTEAISMTNTDGITNLQENLDQNDLDMMMLFGAEGDE 655
           I+ +++V E   +  E              E LDQNDLDMMMLFGAEGDE
Sbjct: 555 IQENKVVRELDEAPAE--------------ETLDQNDLDMMMLFGAEGDE 590

>CAGL0M11264g complement(1106912..1108561) similar to sp|Q05021
           Saccharomyces cerevisiae YMR227c TAF67, start by
           similarity
          Length = 549

 Score =  333 bits (855), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 206/261 (78%), Gaps = 7/261 (2%)

Query: 87  KPVGGPLKLKLHRKPSASPIVEKKVHKAPRLRLKPIRIPGEGYDSEASDIEDDPLIESGI 146
           K  G  +KLKL  K       E+K  + PRLRLKPIRIPGEGYDSEASD+EDDPLIESGI
Sbjct: 52  KKSGSVVKLKLGSKK------EEKQSRTPRLRLKPIRIPGEGYDSEASDLEDDPLIESGI 105

Query: 147 ILRVLPDIQVEFVKNSIESGDYSGLTVKWLGHRHAVVNINGNMYGAILVDLPTVIEVNKS 206
           ILRVLPD+QV+F+KNSIESGDY+G+++KW G RHA++ +N   YGAILVDLPT+IEVNKS
Sbjct: 106 ILRVLPDVQVDFIKNSIESGDYTGISIKWKGERHAILKLNNVTYGAILVDLPTIIEVNKS 165

Query: 207 VDRKNLLKTFDVSQMLICIKTIQKEDEVFTLKAPNSEDLVTKHYSDIEEEILGNKKVLMK 266
           VDRKNL KTFDV+QML+C+K I  EDE+FTL+AP +EDL++KHY +  +EI  +K  L K
Sbjct: 166 VDRKNLFKTFDVTQMLVCVKPITSEDELFTLEAPETEDLISKHYEEYLDEINDHKVKLFK 225

Query: 267 EQN-TDLLSELEKQYLDEIATKGYDYKHGLSPPLYNVRNRRFRRKMGPSEFEYAEEVVET 325
             N  +L SE E + L+++A K Y YKHGL+PPLYNVRNRRFRR+M   EFEYAE++V+ 
Sbjct: 226 NANHVNLHSETEAKNLEKLALKKYHYKHGLTPPLYNVRNRRFRRQMHADEFEYAEKIVDM 285

Query: 326 LLRQDEKAENVTYELVDESEM 346
           LL+ D +AE+V ++L+  S++
Sbjct: 286 LLKADAQAEDVKFDLIAPSDV 306

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/21 (85%), Positives = 19/21 (90%)

Query: 635 QENLDQNDLDMMMLFGAEGDE 655
           +E LDQNDLDMMMLFG EGDE
Sbjct: 529 EEELDQNDLDMMMLFGGEGDE 549

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%)

Query: 486 EDRQHVXXXXXXXXXXXXXXXXXRNKLQKVTNPLLRSRFIDNIXXXXXXXXXXRRQFKIR 545
           E RQH                  ++KL+K TNPLL+SRF+D+I          ++Q K  
Sbjct: 414 EKRQHTELLADELNELVSTLEHTKDKLEKATNPLLKSRFVDSIKKLEKEVELKKKQLKES 473

Query: 546 EDQLNN 551
           E+QL+ 
Sbjct: 474 ENQLSG 479

>AFR563C [3755] [Homologous to ScYMR227C (TAF67) - SH]
           (1444641..1446371) [1731 bp, 576 aa]
          Length = 576

 Score =  323 bits (828), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 164/275 (59%), Positives = 214/275 (77%), Gaps = 3/275 (1%)

Query: 81  TDPLMDKPVGGPLKLKLHRKPSASP--IVEKKVHKAPRLRLKPIRIPGEGYDSEASDIED 138
           ++PL+ +P   P+KLKL+ K    P  +    + KAPR+R+KP RIPGEGYDSEASDIED
Sbjct: 62  SEPLLPEP-KAPVKLKLNLKKDTPPTSVPASALTKAPRIRVKPPRIPGEGYDSEASDIED 120

Query: 139 DPLIESGIILRVLPDIQVEFVKNSIESGDYSGLTVKWLGHRHAVVNINGNMYGAILVDLP 198
           DPL+E GIILRVLPD+Q EFVKNSIESGDYS +++KW G RHAVV+ING+ YGA+LV+LP
Sbjct: 121 DPLMEEGIILRVLPDLQAEFVKNSIESGDYSNISIKWKGERHAVVSINGHQYGAVLVNLP 180

Query: 199 TVIEVNKSVDRKNLLKTFDVSQMLICIKTIQKEDEVFTLKAPNSEDLVTKHYSDIEEEIL 258
           TVIEVNKSVDRKN+LK FDVSQML+C+  I +E++VF L+ P++EDLV KH+ + E+EI 
Sbjct: 181 TVIEVNKSVDRKNMLKAFDVSQMLLCVALISREEDVFDLQPPDTEDLVKKHFENYEKEIC 240

Query: 259 GNKKVLMKEQNTDLLSELEKQYLDEIATKGYDYKHGLSPPLYNVRNRRFRRKMGPSEFEY 318
             +K++++      L++ E +++D I  KGYDYKHG++ PLYNVRNRRFRR+M  SE +Y
Sbjct: 241 DARKIMIQGFQGGSLTDAESKHMDAILEKGYDYKHGITAPLYNVRNRRFRRRMTGSEIDY 300

Query: 319 AEEVVETLLRQDEKAENVTYELVDESEMLGRSNST 353
            +  VE LL+QD +AE  TYELVDE  +L +S ST
Sbjct: 301 VDRTVEFLLKQDGEAEEFTYELVDEDAVLQKSAST 335

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 58/147 (39%), Gaps = 29/147 (19%)

Query: 509 RNKLQKVTNPLLRSRFIDNIXXXXXXXXXXRRQFKIREDQLNNVNPHDSNDLHKSPSTKT 568
           R+KL K TNPLL+SRF+D+I          R+Q    E+ L   +P  S+  H++P    
Sbjct: 459 RDKLAKATNPLLKSRFVDSIAKLEKEVDIKRKQLLANEEILET-SPATSS--HRTPRPDE 515

Query: 569 SALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNIEADEIVPEQSNSNTEAISMTNT 628
                                                       P Q+ ++T A      
Sbjct: 516 DDELDDDEDEDELDEEDLDDQDDDEEVA---------------TPAQATTHTSA------ 554

Query: 629 DGITNLQENLDQNDLDMMMLFGAEGDE 655
                L + LDQ D+DMMMLFGAEGD+
Sbjct: 555 -----LDDELDQEDMDMMMLFGAEGDD 576

>Kwal_26.9176
          Length = 551

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 167/266 (62%), Positives = 203/266 (76%), Gaps = 2/266 (0%)

Query: 89  VGG-PLKLKLHRKPSASPIVEKKVHKAPRLRLKPIRIPGEGYDSEASDIEDDPLIESGII 147
           VGG  LK+ L  K ++S        KAPR R+KP+R+PGEGYDSEASDIEDDPLIE G+I
Sbjct: 59  VGGIKLKINLGSKETSSSTASAP-PKAPRFRIKPVRVPGEGYDSEASDIEDDPLIEEGVI 117

Query: 148 LRVLPDIQVEFVKNSIESGDYSGLTVKWLGHRHAVVNINGNMYGAILVDLPTVIEVNKSV 207
           LRVLPD+Q EFVKN IESGD+SGL++KW G RHAVV ING  YGA+LV+LPT IEVNKS+
Sbjct: 118 LRVLPDVQTEFVKNCIESGDFSGLSLKWKGERHAVVKINGYQYGAVLVNLPTTIEVNKSI 177

Query: 208 DRKNLLKTFDVSQMLICIKTIQKEDEVFTLKAPNSEDLVTKHYSDIEEEILGNKKVLMKE 267
           DRKNLLKTFDVSQML+C++TI  E+EVF+L  P+SEDLVTKHY + + EI+  KK L + 
Sbjct: 178 DRKNLLKTFDVSQMLLCVRTIDHEEEVFSLVPPDSEDLVTKHYDEYKNEIIECKKTLYRG 237

Query: 268 QNTDLLSELEKQYLDEIATKGYDYKHGLSPPLYNVRNRRFRRKMGPSEFEYAEEVVETLL 327
            N   L++ E   +D I  KGYDYKHGL+PPLYNVRNRRFRR++   E +Y E+ VE LL
Sbjct: 238 FNGGPLTDAEANNIDNIVKKGYDYKHGLTPPLYNVRNRRFRRRLTTQEVDYVEKTVEHLL 297

Query: 328 RQDEKAENVTYELVDESEMLGRSNST 353
            QD +AE V+Y+LVDE  +  RS S 
Sbjct: 298 EQDAEAEGVSYDLVDEDILAQRSASA 323

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 31/66 (46%)

Query: 486 EDRQHVXXXXXXXXXXXXXXXXXRNKLQKVTNPLLRSRFIDNIXXXXXXXXXXRRQFKIR 545
           E+RQH                  + KL+K TNPLL+SRFI++I          R+Q KI 
Sbjct: 416 EERQHSELLQDELEELESTLHQNKQKLEKATNPLLKSRFIESIKKLEKEVELKRKQLKIG 475

Query: 546 EDQLNN 551
            +Q  N
Sbjct: 476 HEQSAN 481

>KLLA0B08305g 737967..740174 some similarities with sp|Q05021
           Saccharomyces cerevisiae YMR227c TAF67 TFIID subunit
           (TBP-associated factor), 67 kD singleton, hypothetical
           start
          Length = 735

 Score =  321 bits (822), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 147/271 (54%), Positives = 202/271 (74%)

Query: 111 VHKAPRLRLKPIRIPGEGYDSEASDIEDDPLIESGIILRVLPDIQVEFVKNSIESGDYSG 170
           V K P+ R+KP+R+PGEGYDSEASD+EDDPLIE GIILRVLPD+  EFVKNSIESGDYS 
Sbjct: 139 VVKTPKFRIKPVRVPGEGYDSEASDVEDDPLIEEGIILRVLPDLSAEFVKNSIESGDYSD 198

Query: 171 LTVKWLGHRHAVVNINGNMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLICIKTIQK 230
           +++KW G RHAVV +NG  YGA+LV+LP++IEVNKSVDRKNLLKTFDVSQMLIC++T+ K
Sbjct: 199 VSIKWKGERHAVVKVNGVQYGAVLVNLPSIIEVNKSVDRKNLLKTFDVSQMLICVRTVNK 258

Query: 231 EDEVFTLKAPNSEDLVTKHYSDIEEEILGNKKVLMKEQNTDLLSELEKQYLDEIATKGYD 290
           E+EVF+L+  ++EDL  KH+ + ++EI   +K  ++  N   L++ E + +++I  K YD
Sbjct: 259 EEEVFSLQVSDTEDLTKKHFEEYQKEITEQRKQQLRGYNGGPLTDAESKNIEQIINKRYD 318

Query: 291 YKHGLSPPLYNVRNRRFRRKMGPSEFEYAEEVVETLLRQDEKAENVTYELVDESEMLGRS 350
           YKHG++PPLYN RNRRFR +MGP+ F+Y E  VE LL+ D +AE   YELV+E  +  + 
Sbjct: 319 YKHGITPPLYNARNRRFRHRMGPTAFDYVERTVEKLLKLDAEAEEFGYELVNEDAIQQQR 378

Query: 351 NSTPIISEDYFKDADVQEPSAAIESTVPILP 381
           +++      Y K  +  + ++++  +  I P
Sbjct: 379 STSAADLAHYQKAGEHMDETSSVGYSQEIKP 409

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%)

Query: 636 ENLDQNDLDMMMLFGAEGD 654
           E LDQ+D+DMM+LFGA+ D
Sbjct: 717 EELDQDDMDMMLLFGADND 735

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 25/59 (42%)

Query: 484 AKEDRQHVXXXXXXXXXXXXXXXXXRNKLQKVTNPLLRSRFIDNIXXXXXXXXXXRRQF 542
           A E+ QH                  RNK  + TNPLL++RF+++I          R+Q 
Sbjct: 535 ANEEEQHRELLLDELRELESTLELNRNKASRTTNPLLKTRFLESIKKLEKEVELKRKQL 593

>Kwal_26.7201
          Length = 234

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 42/95 (44%)

Query: 213 LKTFDVSQMLICIKTIQKEDEVFTLKAPNSEDLVTKHYSDIEEEILGNKKVLMKEQNTDL 272
           L++ ++S+++I I    K+  VF L+   +    + + S +     G  +V    Q   +
Sbjct: 116 LRSSNISELIIGISIEPKDQAVFKLQESRARQAGSANASSLVVARSGANRVSTPGQLAKI 175

Query: 273 LSELEKQYLDEIATKGYDYKHGLSPPLYNVRNRRF 307
              L +Q   +I    Y+Y  G   P  NV  +RF
Sbjct: 176 YPLLTQQLAAKIVQHAYNYLTGFLDPQGNVSIKRF 210

>Sklu_2271.3 YBR255W, Contig c2271 1824-3482 reverse complement
          Length = 552

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (46%), Gaps = 16/122 (13%)

Query: 240 PNSEDLVTKHYSDIEEEILGNKKVLMKEQN-TDLLSELEKQYLD--------EIATKGYD 290
           PN+ ++  +  +   E I  + +V++   N T L +E    YL+         I T+   
Sbjct: 71  PNASNIQPRDSTAGREGIRNSGEVVLSYSNRTKLRAERVNTYLNYYYLLIERAINTEDDK 130

Query: 291 YKH----GLSPPLYNVRNRRFRRKM---GPSEFEYAEEVVETLLRQDEKAENVTYELVDE 343
           Y+H    G+  PL  +RNR+ R+K     P +  + +E V  + +  +K   VT  LVD 
Sbjct: 131 YQHEGVEGIYNPLQIIRNRKIRKKYHQPAPRKLTFVKEPVIAIKKFTKKPNQVTPWLVDI 190

Query: 344 SE 345
           +E
Sbjct: 191 NE 192

>Kwal_56.24832
          Length = 1569

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 248 KHYSDIEEEILGNKKVLMKEQNTDLLSELE--KQYLDEIATKGYDYKHGLSPPLYNVRNR 305
           + YS   EE+L + K  ++ Q+ +L+SELE  KQ + +I   G      LSPP  N  + 
Sbjct: 558 RSYSSGFEEVLISSKCCIEIQSIELVSELEPIKQIISDIQELGQKIME-LSPP--NQSHE 614

Query: 306 RFRRKMGPSEFEYAEEVVET 325
            F  K  P     +  ++ T
Sbjct: 615 HFASKKFPKHLRRSVRIMGT 634

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.131    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,264,684
Number of extensions: 749409
Number of successful extensions: 2073
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2127
Number of HSP's successfully gapped: 36
Length of query: 655
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 547
Effective length of database: 12,857,365
Effective search space: 7032978655
Effective search space used: 7032978655
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)