Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_594.534334318280.0
Sklu_2383.23383419601e-130
YMR228W (MTF1)3413469221e-124
CAGL0M11286g3383438741e-116
Kwal_26.91803413438511e-113
AFR564W3343206742e-86
KLLA0B08283g3353266672e-85
CAGL0J10824g73389760.19
KLLA0F03168g518179730.48
CAGL0F07997g93678710.81
AGR043W3645142691.5
Scas_588.1722541652.6
Scas_686.2652753663.3
KLLA0B10175g73169645.8
Scas_702.26148181638.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_594.5
         (343 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_594.5                                                            708   0.0  
Sklu_2383.2 YMR228W, Contig c2383 8318-9334 reverse complement        374   e-130
YMR228W (MTF1) [4184] chr13 (724625..725650) Mitochondrial RNA p...   359   e-124
CAGL0M11286g 1108814..1109830 similar to sp|P14908 Saccharomyces...   341   e-116
Kwal_26.9180                                                          332   e-113
AFR564W [3756] [Homologous to ScYMR228W (MTF1) - SH] complement(...   264   2e-86
KLLA0B08283g complement(736483..737490) gi|3024184|sp|P87250|MTF...   261   2e-85
CAGL0J10824g complement(1054080..1056281) highly similar to sp|P...    34   0.19 
KLLA0F03168g 294261..295817 similar to sgd|S0005479 Saccharomyce...    33   0.48 
CAGL0F07997g complement(785803..788613) weakly similar to sp|P50...    32   0.81 
AGR043W [4353] [Homologous to ScYDR150W (NUM1) - SH] complement(...    31   1.5  
Scas_588.17                                                            30   2.6  
Scas_686.26                                                            30   3.3  
KLLA0B10175g 889538..891733 highly similar to sp|P38604 Saccharo...    29   5.8  
Scas_702.26                                                            29   8.9  

>Scas_594.5
          Length = 343

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/343 (100%), Positives = 343/343 (100%)

Query: 1   MSLSVPTTGVLSKITQRYGSQYLINPKVFDKIFKKLDFKEYSSTLKVLDMYPGPCVQSTM 60
           MSLSVPTTGVLSKITQRYGSQYLINPKVFDKIFKKLDFKEYSSTLKVLDMYPGPCVQSTM
Sbjct: 1   MSLSVPTTGVLSKITQRYGSQYLINPKVFDKIFKKLDFKEYSSTLKVLDMYPGPCVQSTM 60

Query: 61  FYNKYQPKQYVLMESRSQFVKLIKSEFPFPSPLERTERDPYHWESFIEIIEKEKLLVPEK 120
           FYNKYQPKQYVLMESRSQFVKLIKSEFPFPSPLERTERDPYHWESFIEIIEKEKLLVPEK
Sbjct: 61  FYNKYQPKQYVLMESRSQFVKLIKSEFPFPSPLERTERDPYHWESFIEIIEKEKLLVPEK 120

Query: 121 QPLTHIHNSFLVVGNVTNRNNESLIMQWFHCIGNRNWLQRFGRVRMLLWVPLSTASKLMA 180
           QPLTHIHNSFLVVGNVTNRNNESLIMQWFHCIGNRNWLQRFGRVRMLLWVPLSTASKLMA
Sbjct: 121 QPLTHIHNSFLVVGNVTNRNNESLIMQWFHCIGNRNWLQRFGRVRMLLWVPLSTASKLMA 180

Query: 181 EPKSKLRSKASVIREAFTDTRLLAISNIAELKKFDKIVLDESNPIVFGEDSMLKGAGVSS 240
           EPKSKLRSKASVIREAFTDTRLLAISNIAELKKFDKIVLDESNPIVFGEDSMLKGAGVSS
Sbjct: 181 EPKSKLRSKASVIREAFTDTRLLAISNIAELKKFDKIVLDESNPIVFGEDSMLKGAGVSS 240

Query: 241 ATSIALLEINPKNHDLDLENWDYVTKHLMILKQTKLIDALESLGHGAKDYFTEKIEDSTY 300
           ATSIALLEINPKNHDLDLENWDYVTKHLMILKQTKLIDALESLGHGAKDYFTEKIEDSTY
Sbjct: 241 ATSIALLEINPKNHDLDLENWDYVTKHLMILKQTKLIDALESLGHGAKDYFTEKIEDSTY 300

Query: 301 LNKTPGEMTNDDFIYLTKIFANWPFKPDIYMDFVDILQEESTS 343
           LNKTPGEMTNDDFIYLTKIFANWPFKPDIYMDFVDILQEESTS
Sbjct: 301 LNKTPGEMTNDDFIYLTKIFANWPFKPDIYMDFVDILQEESTS 343

>Sklu_2383.2 YMR228W, Contig c2383 8318-9334 reverse complement
          Length = 338

 Score =  374 bits (960), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 178/341 (52%), Positives = 238/341 (69%), Gaps = 7/341 (2%)

Query: 1   MSLSVPTTGVLSKITQRYGSQYLINPKVFDKIFKKLDFKEY--SSTLKVLDMYPGPCVQS 58
           MS+ +PT    +KI   YG +YL+N  V  +I+ KL  +       LKVLD+YPGP   S
Sbjct: 1   MSVHIPTLNSATKIKHYYGFKYLLNSSVHTQIYNKLQLQSTYKMDELKVLDLYPGPSQHS 60

Query: 59  TMFYNKYQPKQYVLMESRSQFVKLIKSEFPFPSPLERTERDPYHWESFIEIIEKEKLLVP 118
            +F N + PKQYVLM+SR  FVK I+  F   S +E  +RDPY W S+ ++IEKEK  VP
Sbjct: 61  AIFRNIFNPKQYVLMDSRPDFVKFIQDNFAGTS-MELYQRDPYEWSSYTDMIEKEKRFVP 119

Query: 119 EKQPLTHIHNSFLVVGNVTNRNNESLIMQWFHCIGNRNWLQRFGRVRMLLWVPLSTASKL 178
            +Q    IHN FLV+ N+T    E L MQW  CIGN+NWLQRFGRV+ML+WVP +TA K+
Sbjct: 120 NRQSRDKIHNQFLVMANLTGMIGEGLFMQWLSCIGNKNWLQRFGRVKMLVWVPEATAHKV 179

Query: 179 MAEPKSKLRSKASVIREAFTDTRLLAISNIAELKKFDKIVLDESNPIVFGEDSMLKGAGV 238
           +A P S +R+K SV+ EAFTDT+L+A S+ + L+KF   +L+E +PI+F      +   +
Sbjct: 180 LARPGSLIRAKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPIIFST----RDTWL 235

Query: 239 SSATSIALLEINPKNHDLDLENWDYVTKHLMILKQTKLIDALESLGHGAKDYFTEKIEDS 298
           +S   I+LLE+NP +HD+DL+NWDYVTKHL+ILK T L  A++SLGHG K YF+EK+ED 
Sbjct: 236 NSGKPISLLEVNPIDHDIDLDNWDYVTKHLLILKSTPLHTAIDSLGHGGKQYFSEKVEDK 295

Query: 299 TYLNKTPGEMTNDDFIYLTKIFANWPFKPDIYMDFVDILQE 339
             ++K P ++TN +F+YLT IF NWPFKPDIYMDF+D+ QE
Sbjct: 296 LLMDKCPKDLTNKEFVYLTSIFNNWPFKPDIYMDFIDVFQE 336

>YMR228W (MTF1) [4184] chr13 (724625..725650) Mitochondrial RNA
           polymerase specificity factor, distantly related to
           bacterial sigma factors [1026 bp, 341 aa]
          Length = 341

 Score =  359 bits (922), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 175/346 (50%), Positives = 237/346 (68%), Gaps = 8/346 (2%)

Query: 1   MSLSVPTTGVLSKITQRYGSQYLINPKVFDKIFKKLDFKE---YSSTLKVLDMYPGPCVQ 57
           MS+ +P    +SK+   YG +YL NP V++KIF KLD  +   +   LKVLD+YPG  +Q
Sbjct: 1   MSVPIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQ 60

Query: 58  STMFYNKYQPKQYVLMESRSQFVKLIKSEFPFPSPLERTERDPYHWESFIEIIEKEKLLV 117
           S +FYNKY P+QY L+E RS   K + ++F   SPL+  +RDPY W ++  +I++E++ V
Sbjct: 61  SAIFYNKYCPRQYSLLEKRSSLYKFLNAKFE-GSPLQILKRDPYDWSTYSNLIDEERIFV 119

Query: 118 PEKQPLTHIHNSFLVVGNVTNRNNESLIMQWFHCIGNRNWLQRFGRVRMLLWVPLSTASK 177
           PE Q   HI++ FL V NVT   +E LIMQW  CIGN+NWL RFG+V+MLLW+P +TA K
Sbjct: 120 PEVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARK 179

Query: 178 LMAEPKSKLRSKASVIREAFTDTRLLAISNIAELKKFDKIVLDESNPIVFGEDSMLKGAG 237
           L+A P    RSK SV+REAFTDT+L+AIS+  ELK FD   ++E +PI+F    +    G
Sbjct: 180 LLARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKG 239

Query: 238 VSSATSIALLEINPKNHDLDLENWDYVTKHLMILKQTKLIDALESLGHGAKDYFTEKIED 297
                 IAL+E++P + D D++NWDYVT+HLMILK+T L   ++SLGHG + YF  +I D
Sbjct: 240 ----KPIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITD 295

Query: 298 STYLNKTPGEMTNDDFIYLTKIFANWPFKPDIYMDFVDILQEESTS 343
              L K P ++TND+FIYLTK+F  WPFKPDI MDFVD+ Q E + 
Sbjct: 296 KDLLKKCPIDLTNDEFIYLTKLFMEWPFKPDILMDFVDMYQTEHSG 341

>CAGL0M11286g 1108814..1109830 similar to sp|P14908 Saccharomyces
           cerevisiae YMR228w MTF1 RNA polymerase specific factor,
           start by similarity
          Length = 338

 Score =  341 bits (874), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 162/343 (47%), Positives = 234/343 (68%), Gaps = 9/343 (2%)

Query: 1   MSLSVPTTGVLSKITQRYGSQYLINPKVFDKIFKKLDFKEYSSTLKVLDMYPGPCVQSTM 60
           M ++VPT   L  I   YG +YL++P    K+F+KL     +  +KVLD+YPGP + S +
Sbjct: 1   MKVAVPTISQLH-IKSYYGFRYLLDPDWHQKVFEKLGLSS-NPNMKVLDLYPGPGIHSAV 58

Query: 61  FYNKYQPKQYVLMESRSQFVKLIKSEFPFPSPLERTERDPYHWESFIEIIEKEKLLVPEK 120
            YNK QP+QY +ME R  F+  +++ +    P+E  ++DPY WES+ E+I++EKL VP+K
Sbjct: 59  LYNKVQPQQYTMMECRRDFLSNLRNIYT-DGPMELVKKDPYKWESYTELIDQEKLFVPKK 117

Query: 121 QPLTHIHNSFLVVGNVTNRNNESLIMQWFHCIGNRNWLQRFGRVRMLLWVPLSTASKLMA 180
                ++  F ++ N+T + +E L+MQW +C+GNRNWL RFGR  ML+W+P  TASKL+A
Sbjct: 118 ADYNVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPMLIWMPTPTASKLLA 177

Query: 181 EPKSKLRSKASVIREAFTDTRLLAISNIAELKKFDKIVLDESNPIVFGEDSMLKGAGVSS 240
           +     R K S++REAFTDT+L+A+S   ++K F+ + LD+SNP+V  + +   G     
Sbjct: 178 DSGDHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDKSNPLVIPDGTDYGGKDF-- 235

Query: 241 ATSIALLEINPKNHDLDLENWDYVTKHLMILKQTKLIDALESLGHGAKDYFTEKIEDS-- 298
              IAL+E  PK HD+DL+NW++VTKHLM+L +T LIDA++ LGHGA+DYF+  I+    
Sbjct: 236 --PIALVEFTPKKHDIDLDNWEFVTKHLMVLYKTPLIDAIDCLGHGARDYFSANIDKDHI 293

Query: 299 TYLNKTPGEMTNDDFIYLTKIFANWPFKPDIYMDFVDILQEES 341
             L K P + TN+DF+YLT +F  WPFKPD+YMDF+DI QEES
Sbjct: 294 HLLKKCPQDFTNNDFVYLTNLFHLWPFKPDVYMDFLDIYQEES 336

>Kwal_26.9180
          Length = 341

 Score =  332 bits (851), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 171/343 (49%), Positives = 221/343 (64%), Gaps = 8/343 (2%)

Query: 1   MSLSVPTTGVLSKITQRYGSQYLINPKVFDKIFKKLDFKE-YSST--LKVLDMYPGPCVQ 57
           M+L V     L+KI   YG +YL+N  V +KIF KL  K+ YS    LKVLD+YPGP   
Sbjct: 1   MALKVQPLQELAKIQHYYGFRYLLNKAVHEKIFSKLKLKDTYSDVNKLKVLDLYPGPAQH 60

Query: 58  STMFYNKYQPKQYVLMESRSQFVKLIKS-EFPFPSPLERTERDPYHWESFIEIIEKEKLL 116
           S +  N  +P Q+VLM++R  FVK I++        L+   RDPY W+S+  +IEKEKL 
Sbjct: 61  SVVLNNYLKPSQHVLMDARPDFVKHIRALSLESNGNLQLYNRDPYDWQSYTNMIEKEKLF 120

Query: 117 VPEKQPLTHIHNSFLVVGNVTNRNNESLIMQWFHCIGNRNWLQRFGRVRMLLWVPLSTAS 176
           VP KQP   IH  FLV+ N+T    E L MQW  CIGN+NWLQRFGRV+ML+WV  STA 
Sbjct: 121 VPTKQPQDAIHKEFLVMANLTGMIGEGLFMQWLACIGNKNWLQRFGRVKMLVWVQESTAL 180

Query: 177 KLMAEPKSKLRSKASVIREAFTDTRLLAISNIAELKKFDKIVLDESNPIVFGEDSMLKGA 236
           KL+A P   LRSK SV+ EAFTDT+L+A  +   + KF   VL    PIVF    +   +
Sbjct: 181 KLLARPGEHLRSKCSVVAEAFTDTKLVATMDSKNISKFSTSVLSTHEPIVFPSQDVWAPS 240

Query: 237 GVSSATSIALLEINPKNHDLDLENWDYVTKHLMILKQTKLIDALESLGHGAKDYFTEKIE 296
           G      I+LLE+NP +H +DL+N+DY TKHL+ILK T L ++L+SLGHG K+YF   I 
Sbjct: 241 G----KPISLLEVNPLDHIIDLDNFDYATKHLLILKSTPLSESLDSLGHGGKEYFRRVIR 296

Query: 297 DSTYLNKTPGEMTNDDFIYLTKIFANWPFKPDIYMDFVDILQE 339
           D   L + P ++T  +FI +T +F  WPFKPDIYMDF+D+ QE
Sbjct: 297 DKNLLQRCPKDLTCREFIEITDLFDKWPFKPDIYMDFIDVFQE 339

>AFR564W [3756] [Homologous to ScYMR228W (MTF1) - SH]
           complement(1446758..1447762) [1005 bp, 334 aa]
          Length = 334

 Score =  264 bits (674), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 136/320 (42%), Positives = 200/320 (62%), Gaps = 15/320 (4%)

Query: 18  YGSQYLINPKVFDKIFKKLDFKEY--SSTLKVLDMYPGPCVQSTMFYNKYQPKQYVLMES 75
           YG   L +P   +  +K+L+ +E+   S ++VL++YPG  + S +F++ Y+PK  VLMES
Sbjct: 23  YGRTLLHSPTAIELAYKRLNLQEHYDMSKVQVLELYPGTGLPSYIFHDIYKPKLQVLMES 82

Query: 76  RSQFVKLIKSEFPFPSPLERTERDPYHWESFIEIIEKEKLLVPEKQPLTHIHNSFLVVGN 135
           +  + K+I+        ++  + DPY WESF+ +I+++K++ PE Q   HIH+SF+V+GN
Sbjct: 83  KPAYAKVIEQHLTLLDNIKLHKEDPYMWESFVSLIDEKKIMQPEVQTRDHIHDSFIVMGN 142

Query: 136 VTNRNNESLIMQWFHCIGNRNWLQRFGRVRMLLWVPLSTASKLMAEPKSKLRSKASVIRE 195
           +T++  E L MQ+  CI N+NW+QRFG VRML WVP +TA KL++    K RS+ SVI E
Sbjct: 143 LTDKRGEQLYMQYLQCIANKNWMQRFGLVRMLFWVPQTTAIKLLSPCGFKSRSRCSVITE 202

Query: 196 AFTDTRLLAISNIAELKKFDKIVLDESNPIVFGEDSMLKGAGVSSATSIALLEINPKNHD 255
           A TDTRL+A +    L  F   VLD+ +P++  E+           T  ALLE+ P NH+
Sbjct: 203 AVTDTRLIATTP-DNLASFGPGVLDKHDPLILPENK----------TDYALLEVLPLNHN 251

Query: 256 LDLENWDYVTKHLMILKQTKLIDALESLGHGAKDYFTEKIEDSTYLNKTPGEMTNDDFIY 315
           + LE WDY  + L++ K T L D LE LGHGA D+   +I D   L K P ++TN +F  
Sbjct: 252 MKLEYWDYCMQRLLVCKSTPLEDILEVLGHGASDFLKCRI-DPELLKKKPMQLTNQEFTK 310

Query: 316 LTKIFANWPFKPDIYMDFVD 335
           +  ++A WPFKP IY DF D
Sbjct: 311 IASLYALWPFKPSIY-DFYD 329

>KLLA0B08283g complement(736483..737490)
           gi|3024184|sp|P87250|MTF1_KLULA Kluyveromyces lactis
           MITOCHONDRIAL REPLICATION PROTEIN MTF1 (MITOCHONDRIAL
           TRANSCRIPTION FACTOR MTTFB), start by similarity
          Length = 335

 Score =  261 bits (667), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 128/326 (39%), Positives = 209/326 (64%), Gaps = 11/326 (3%)

Query: 12  SKITQRYGSQYLINPKVFDKIFKKLDFKEY--SSTLKVLDMYPGPCVQSTMFYNKYQPKQ 69
           +KI   YGSQ+  NPKV ++I  KL+ + Y  S +L++LD+Y GP +QS +   + +PK+
Sbjct: 15  NKIHTSYGSQFEKNPKVINQILDKLNLESYYKSESLQILDIYAGPLIQSVILNERLKPKK 74

Query: 70  YVLMESRSQFVKLIKSEFPFPSPLERTERDPYHWESFIEIIEKEKLLVPEKQPLTHIHNS 129
           +VL+E R +FV+L ++       +    ++PY WE+F+E+  ++++L P  Q   HIHN 
Sbjct: 75  HVLLEDRLKFVELYQATLKDHPSMVNYNKNPYKWETFLEMTNEDRVLTPSMQKRDHIHNE 134

Query: 130 FLVVGNVTNRNNESLIMQWFHCIGNRNWLQRFGRVRMLLWVPLSTASKLMAEPKSKLRSK 189
           FL+  N+TN+  E L +Q+  CI N+NW+QRFG V+ML+W+P  TA KL A   +K R++
Sbjct: 135 FLIAANLTNKKGEQLYVQYLQCIANQNWMQRFGLVKMLVWIPQQTARKLFAPFSNKDRNR 194

Query: 190 ASVIREAFTDTRLLAISNIAELKKFDKIVLDESNPIVFGEDSMLKGAGVSSATSIALLEI 249
            +++ E  T+T+L+A S    +KKF    +++ +P++   D+        S   ++L+EI
Sbjct: 195 LTLLSELATNTKLVATSE-NSVKKFLPDCIEKFDPVIIPSDN-------KSPDDLSLVEI 246

Query: 250 NPKNHDLDLENWDYVTKHLMILKQTKLIDALESLGHGAKDYFTEKIEDSTYLNKTPGEMT 309
           NP++H +DL++WD+VT+ LMILK   + + +E LGHGA+D+F  ++ D   L K P E+T
Sbjct: 247 NPRDHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGARDWFISRL-DPVLLKKKPYELT 305

Query: 310 NDDFIYLTKIFANWPFKPDIYMDFVD 335
             +   + K+FA WPFKP + +DF D
Sbjct: 306 YLEIDEIAKVFALWPFKPSLLVDFYD 331

>CAGL0J10824g complement(1054080..1056281) highly similar to
           sp|P38604 Saccharomyces cerevisiae YHR072w ERG7
           lanosterol synthase, start by similarity
          Length = 733

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 44/89 (49%), Gaps = 16/89 (17%)

Query: 4   SVPTTGVLSKITQRYGSQYLINPKVFDKIFKKLDFKEYSSTLKVLDMY-PGPCVQST--- 59
           S P T +LS+I Q          +++ K F K++F ++ +T+  +D+Y P   +  T   
Sbjct: 249 SCPLTDLLSEIRQ----------EIYTKSFDKINFSQHRNTVCGVDLYYPHSKILDTAND 298

Query: 60  --MFYNKYQPKQYVLMESRSQFVKLIKSE 86
             +FY KY   + V M S+     LIK E
Sbjct: 299 VIVFYEKYLRPRLVSMASKKVVYNLIKKE 327

>KLLA0F03168g 294261..295817 similar to sgd|S0005479 Saccharomyces
           cerevisiae YOL119c, start by similarity
          Length = 518

 Score = 32.7 bits (73), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 69/179 (38%), Gaps = 41/179 (22%)

Query: 23  LINPKVFDKIFKKLDFKEYSSTLKVLDMYPGPCVQSTMFYNKYQPKQYVLMESRSQFVKL 82
           +I P   +K FK L F   + T++++ +  G C+  +MF  K  P++   +E +      
Sbjct: 227 VIFPLFLEKSFKNLGF---AWTMRIMALICGVCLTVSMFLIKEDPEKRAAVEPK------ 277

Query: 83  IKSEFPFPSPLERTERDPYHWESFIEIIEKEKLL----------VPEKQPLTHIHNSFLV 132
             +  PF   L    RD + ++S   I+  +K L          V     LT+I +    
Sbjct: 278 -DASTPFHKNLLYNIRDSFDYKS---IVSDQKYLFCVLASCLAEVSTGAVLTYITSYCTT 333

Query: 133 VGN--------VTNRNNESLIMQWFHCIGNRNWLQRF----------GRVRMLLWVPLS 173
           VG         VT  N  S++  +         + RF          G V ++ W+P  
Sbjct: 334 VGYSENTSFLLVTILNTLSIVGGYMFSFLADKVMGRFNVMIMINFLLGFVPLIFWLPFG 392

>CAGL0F07997g complement(785803..788613) weakly similar to sp|P50090
           Saccharomyces cerevisiae YGR238c KEL2 or sp|P38853
           Saccharomyces cerevisiae YHR158c KEL1, hypothetical
           start
          Length = 936

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 37/78 (47%), Gaps = 7/78 (8%)

Query: 242 TSIALLEINPK---NHDLDLENWDYVTKHLMILKQTKLIDALESLGHGAKD-YFTEKIED 297
           T  ALL +N K   N D DL   D   +HL+ +   K+ D L  +G   +D   ++K E 
Sbjct: 774 TGYALLNLNSKASRNKDTDL---DDSNQHLVSIDAEKVADELLLIGDKREDSSASDKSES 830

Query: 298 STYLNKTPGEMTNDDFIY 315
            T       E +N DFIY
Sbjct: 831 FTLTESNQPETSNGDFIY 848

>AGR043W [4353] [Homologous to ScYDR150W (NUM1) - SH]
            complement(787126..798063) [10938 bp, 3645 aa]
          Length = 3645

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 62/142 (43%), Gaps = 12/142 (8%)

Query: 162  GRVRMLLWVPLSTAS-KLMAEPKSKLRSKASVIREAFTDTRLLAISNIAELKKFDKIVLD 220
            GR+  L +VP++ A  + +  P  +   K+  I+    +   L   +I E KK      +
Sbjct: 1543 GRLSDLGYVPVAKAELEELNRPAVERIDKSDTIK--LCEQYQLKPISIEEYKKLK----E 1596

Query: 221  ESNPIVFGEDSMLKGAGVSSATSIALLEINPKNHDLDLENWDYVTKH-----LMILKQTK 275
            +S P+V  ED +++         I     N      +  N D +TKH     ++++ Q +
Sbjct: 1597 DSKPVVHSEDELIQMVSSHGYVVIPESSYNQLKEAAESPNVDAITKHAATHKMVLVDQDE 1656

Query: 276  LIDALESLGHGAKDYFTEKIED 297
                LE+L   + ++ TEK  D
Sbjct: 1657 HNQLLETLARPSIEHLTEKAAD 1678

>Scas_588.17
          Length = 225

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 24 INPKVFDKIFKKLDFKEYSSTLKVLDMYPGPCVQSTMFYNK 64
          I+P   DK+FKK++  +Y    K  D++   CV + M Y K
Sbjct: 47 ISPVQIDKLFKKVNSWDYKKPSKRRDLWKCMCVVNMMDYEK 87

>Scas_686.26
          Length = 527

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 24/53 (45%)

Query: 183 KSKLRSKASVIREAFTDTRLLAISNIAELKKFDKIVLDESNPIVFGEDSMLKG 235
           K +L  +  +I E     R L     AEL KFD  ++D+S P+  G      G
Sbjct: 74  KLELVRQKEIIEEGLKKERQLKEEQQAELDKFDADIIDDSEPVFNGTSEAQAG 126

>KLLA0B10175g 889538..891733 highly similar to sp|P38604
           Saccharomyces cerevisiae YHR072w ERG7 lanosterol
           synthase singleton, start by similarity
          Length = 731

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 39/69 (56%), Gaps = 6/69 (8%)

Query: 24  INPKVFDKIFKKLDFKEYSSTLKVLDM-YPGPCVQSTMF-----YNKYQPKQYVLMESRS 77
           I  +++ + F+ +DFK++ +T+  +D+ YP   V  TM      Y +Y    ++L +S +
Sbjct: 261 IRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNYFISKYERYVRPNWLLKKSTN 320

Query: 78  QFVKLIKSE 86
           +  +L+K E
Sbjct: 321 RVYELVKKE 329

>Scas_702.26
          Length = 1481

 Score = 28.9 bits (63), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 17/81 (20%)

Query: 250 NPKNHDLDLENWDYVTKHLMILKQTKLIDALESLGHG-AKDYFTEKIEDSTYLNKTPGEM 308
           NPK   LD E  DY+  ++ ILK T +I  L    HG  KD F              G+M
Sbjct: 681 NPKIKALDKETSDYLLFYITILK-TLMITQLPKGFHGIEKDIF--------------GKM 725

Query: 309 TNDDFIYLTKIFANWPFKPDI 329
             DD+++   +  N  F+ D+
Sbjct: 726 NQDDYLFANTL-NNLGFQDDV 745

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,934,819
Number of extensions: 538568
Number of successful extensions: 1685
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1692
Number of HSP's successfully gapped: 28
Length of query: 343
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 241
Effective length of database: 13,065,073
Effective search space: 3148682593
Effective search space used: 3148682593
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)