Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_594.41722172284360.0
YMR229C (RRP5)1729172358320.0
Sklu_2383.11720172153720.0
CAGL0M04829g1706172351960.0
Kwal_26.91891726172950230.0
AFR566C1716173548920.0
KLLA0B08239g1729175348440.0
KLLA0F17996g6841991253e-06
Scas_713.426992051234e-06
Kwal_55.210291105931191e-05
AGL184W6831931153e-05
Kwal_56.238756801491127e-05
YER013W (PRP22)1145751111e-04
YBR112C (SSN6)9661701102e-04
YLR117C (CLF1)6871951082e-04
KLLA0B09262g9411451083e-04
Scas_705.559072291073e-04
Kwal_23.36708022441056e-04
ADL344W9101601030.001
CAGL0D02376g695218950.007
CAGL0D01364g1148170950.009
KLLA0B11638g111150930.014
YJR007W (SUI2)30489890.029
Scas_479.230272840.098
Scas_617.930272840.098
Kwal_33.1542230289840.12
AGR320W30289830.16
CAGL0B03795g30379810.27
AAR020W111276820.33
KLLA0D11814g593114800.52
Sklu_2440.18824233771.1
ACR104C29778741.9
KLLA0F14322g71781751.9
KLLA0A01969g798226742.8
KLLA0D06941g29778705.4
Scas_570.11858219715.7
Scas_719.13995110716.2
Scas_686.1966392707.1
Scas_557.745069699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_594.4
         (1722 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_594.4                                                           3254   0.0  
YMR229C (RRP5) [4185] chr13 complement(725933..731122) Protein r...  2251   0.0  
Sklu_2383.1 YMR229C, Contig c2383 993-6155                           2073   0.0  
CAGL0M04829g complement(524685..529805) similar to sp|Q05022 Sac...  2006   0.0  
Kwal_26.9189                                                         1939   0.0  
AFR566C [3758] [Homologous to ScYMR229C (RRP5) - SH] (1449324..1...  1889   0.0  
KLLA0B08239g 729850..735039 similar to sp|Q05022 Saccharomyces c...  1870   0.0  
KLLA0F17996g 1645592..1647646 similar to sgd|S0004107 Saccharomy...    53   3e-06
Scas_713.42                                                            52   4e-06
Kwal_55.21029                                                          50   1e-05
AGL184W [4128] [Homologous to ScYLR117C (CLF1) - SH] complement(...    49   3e-05
Kwal_56.23875                                                          48   7e-05
YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing f...    47   1e-04
YBR112C (CYC8) [302] chr2 complement(462826..465726) General rep...    47   2e-04
YLR117C (CLF1) [3530] chr12 complement(382472..384535) Essential...    46   2e-04
KLLA0B09262g 814303..817128 some similarities with sp|P14922 Sac...    46   3e-04
Scas_705.55                                                            46   3e-04
Kwal_23.3670                                                           45   6e-04
ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH] complement(...    44   0.001
CAGL0D02376g complement(244241..246328) similar to tr|Q12309 Sac...    41   0.007
CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces c...    41   0.009
KLLA0B11638g complement(1020591..1023926) similar to sp|P24384 S...    40   0.014
YJR007W (SUI2) [2909] chr10 (450934..451848) Translation initiat...    39   0.029
Scas_479.2                                                             37   0.098
Scas_617.9                                                             37   0.098
Kwal_33.15422                                                          37   0.12 
AGR320W [4631] [Homologous to ScYJR007W (SUI2) - SH] complement(...    37   0.16 
CAGL0B03795g 376266..377177 highly similar to sp|P20459 Saccharo...    36   0.27 
AAR020W [206] [Homologous to ScYER013W (PRP22) - SH] complement(...    36   0.33 
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    35   0.52 
Sklu_2440.18 YDR416W, Contig c2440 29476-31950                         34   1.1  
ACR104C [1151] [Homologous to ScYPL131W (RPL5) - SH] (541333..54...    33   1.9  
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    33   1.9  
KLLA0A01969g complement(178458..180854) similar to sgd|S0002824 ...    33   2.8  
KLLA0D06941g complement(598560..599453) highly similar to sp|P26...    32   5.4  
Scas_570.11                                                            32   5.7  
Scas_719.13                                                            32   6.2  
Scas_686.19                                                            32   7.1  
Scas_557.7                                                             31   9.2  

>Scas_594.4
          Length = 1722

 Score = 3254 bits (8436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1616/1722 (93%), Positives = 1616/1722 (93%)

Query: 1    MVPPTKRKRDEEFPLAREDATQQPTASSLMRNTEEVSFPRGGSSALTPLELKQVANEAAN 60
            MVPPTKRKRDEEFPLAREDATQQPTASSLMRNTEEVSFPRGGSSALTPLELKQVANEAAN
Sbjct: 1    MVPPTKRKRDEEFPLAREDATQQPTASSLMRNTEEVSFPRGGSSALTPLELKQVANEAAN 60

Query: 61   DVLFGKETSTDVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSVVQHVNFKTLKIGS 120
            DVLFGKETSTDVA                               LSVVQHVNFKTLKIGS
Sbjct: 61   DVLFGKETSTDVAESTTRPKKKKKTGKKSKKDTEEKTEEEDEETLSVVQHVNFKTLKIGS 120

Query: 121  LVLGQISEISKTDMCISFTDGLSGYVNLTHISAPFMTIXXXXXXXXXXXXXXXXXXXXXX 180
            LVLGQISEISKTDMCISFTDGLSGYVNLTHISAPFMTI                      
Sbjct: 121  LVLGQISEISKTDMCISFTDGLSGYVNLTHISAPFMTILEELDDDMDDDDELEKKKTDEE 180

Query: 181  XXXXXXXXXXXXXXXXXIGLPSLENYFKVGQWLRCSVISNTALLPXXXXXXXXXIELSIE 240
                             IGLPSLENYFKVGQWLRCSVISNTALLP         IELSIE
Sbjct: 181  YDSSDDEEEKEKATKDSIGLPSLENYFKVGQWLRCSVISNTALLPKDKKNKKKKIELSIE 240

Query: 241  PSVVNTLTEEDIVRSASVQCAVKSIEDHGAMLDIGIDGFTGFISKKDYPEFEKLLPGAVF 300
            PSVVNTLTEEDIVRSASVQCAVKSIEDHGAMLDIGIDGFTGFISKKDYPEFEKLLPGAVF
Sbjct: 241  PSVVNTLTEEDIVRSASVQCAVKSIEDHGAMLDIGIDGFTGFISKKDYPEFEKLLPGAVF 300

Query: 301  LGNVTKKSDRTVTINLDFSDKKAKITHISSVDAVVPGQVVDLLCQTITNNGIVGKTFGLV 360
            LGNVTKKSDRTVTINLDFSDKKAKITHISSVDAVVPGQVVDLLCQTITNNGIVGKTFGLV
Sbjct: 301  LGNVTKKSDRTVTINLDFSDKKAKITHISSVDAVVPGQVVDLLCQTITNNGIVGKTFGLV 360

Query: 361  PSFISTAHLRVFKEEELKHNFAVGSNIPCRIIAVLITKENDKTLLLSTLPHIKSLKNVLG 420
            PSFISTAHLRVFKEEELKHNFAVGSNIPCRIIAVLITKENDKTLLLSTLPHIKSLKNVLG
Sbjct: 361  PSFISTAHLRVFKEEELKHNFAVGSNIPCRIIAVLITKENDKTLLLSTLPHIKSLKNVLG 420

Query: 421  EVENLTAFPIGHLIDSCTVKGRDSDYLYLAMDDDRVGEVHSSRIGELEKFDKLKARVLGF 480
            EVENLTAFPIGHLIDSCTVKGRDSDYLYLAMDDDRVGEVHSSRIGELEKFDKLKARVLGF
Sbjct: 421  EVENLTAFPIGHLIDSCTVKGRDSDYLYLAMDDDRVGEVHSSRIGELEKFDKLKARVLGF 480

Query: 481  NSIDNLYELSTDPEILKLKYLRSKDIPIGEVLPNCEITAVSSKGIELKIFNGQFKAIVPP 540
            NSIDNLYELSTDPEILKLKYLRSKDIPIGEVLPNCEITAVSSKGIELKIFNGQFKAIVPP
Sbjct: 481  NSIDNLYELSTDPEILKLKYLRSKDIPIGEVLPNCEITAVSSKGIELKIFNGQFKAIVPP 540

Query: 541  MHISDTRLVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKTLVNIEDDDIQLLSNFAIAK 600
            MHISDTRLVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKTLVNIEDDDIQLLSNFAIAK
Sbjct: 541  MHISDTRLVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKTLVNIEDDDIQLLSNFAIAK 600

Query: 601  EIQEKNQKTVATVTAFRPSGCIVAFFGGMTAFLPNAEISEVFVRKPEEHLRLGQTIVVKL 660
            EIQEKNQKTVATVTAFRPSGCIVAFFGGMTAFLPNAEISEVFVRKPEEHLRLGQTIVVKL
Sbjct: 601  EIQEKNQKTVATVTAFRPSGCIVAFFGGMTAFLPNAEISEVFVRKPEEHLRLGQTIVVKL 660

Query: 661  LKIDQENARMLVTCKISNDQAEKKKETIEKLIPGRSMVKVNVVEKTKDSVIVELPETSLR 720
            LKIDQENARMLVTCKISNDQAEKKKETIEKLIPGRSMVKVNVVEKTKDSVIVELPETSLR
Sbjct: 661  LKIDQENARMLVTCKISNDQAEKKKETIEKLIPGRSMVKVNVVEKTKDSVIVELPETSLR 720

Query: 721  GVIYVGHLSDARIEQNRAAIKKIAIGSELKGLVIDKDARTQVFNLSLKQSLIKDAKNEVS 780
            GVIYVGHLSDARIEQNRAAIKKIAIGSELKGLVIDKDARTQVFNLSLKQSLIKDAKNEVS
Sbjct: 721  GVIYVGHLSDARIEQNRAAIKKIAIGSELKGLVIDKDARTQVFNLSLKQSLIKDAKNEVS 780

Query: 781  PLTYADIKSKSKTTPLHGYIKSISNKGLFVAFNGKFVGLVLPSYAVESRDVDISKTFYIN 840
            PLTYADIKSKSKTTPLHGYIKSISNKGLFVAFNGKFVGLVLPSYAVESRDVDISKTFYIN
Sbjct: 781  PLTYADIKSKSKTTPLHGYIKSISNKGLFVAFNGKFVGLVLPSYAVESRDVDISKTFYIN 840

Query: 841  QSVTAYLLRSDDDNERFLLTLRTPSTKDDSSKVTGTETLKPIDPAMKDLKDFTTXXXXXX 900
            QSVTAYLLRSDDDNERFLLTLRTPSTKDDSSKVTGTETLKPIDPAMKDLKDFTT      
Sbjct: 841  QSVTAYLLRSDDDNERFLLTLRTPSTKDDSSKVTGTETLKPIDPAMKDLKDFTTGKVVKV 900

Query: 901  XXXXXXXNQLNVVLADNLHGRIDIAEVFDSFSDIKNATHPLIDFKKGNIIDAKIIGTHDI 960
                   NQLNVVLADNLHGRIDIAEVFDSFSDIKNATHPLIDFKKGNIIDAKIIGTHDI
Sbjct: 901  QIKGIKKNQLNVVLADNLHGRIDIAEVFDSFSDIKNATHPLIDFKKGNIIDAKIIGTHDI 960

Query: 961  KSHRFLPISHHAVKGSVLELSLKPSQMRSKDIKTLSISDVAVGDELTGFVNNYGSNTLWL 1020
            KSHRFLPISHHAVKGSVLELSLKPSQMRSKDIKTLSISDVAVGDELTGFVNNYGSNTLWL
Sbjct: 961  KSHRFLPISHHAVKGSVLELSLKPSQMRSKDIKTLSISDVAVGDELTGFVNNYGSNTLWL 1020

Query: 1021 TVSPTLKAKISLFDLAEDGLKSSEKVEDNFPLGCALPVKVTSIDTEHGVVNVTGRSHTEI 1080
            TVSPTLKAKISLFDLAEDGLKSSEKVEDNFPLGCALPVKVTSIDTEHGVVNVTGRSHTEI
Sbjct: 1021 TVSPTLKAKISLFDLAEDGLKSSEKVEDNFPLGCALPVKVTSIDTEHGVVNVTGRSHTEI 1080

Query: 1081 SFESLKVGDNVPSRIIKIADSYVLLDLGNKIHGIAFITDALDDFSVPLKEAYKGMENDIV 1140
            SFESLKVGDNVPSRIIKIADSYVLLDLGNKIHGIAFITDALDDFSVPLKEAYKGMENDIV
Sbjct: 1081 SFESLKVGDNVPSRIIKIADSYVLLDLGNKIHGIAFITDALDDFSVPLKEAYKGMENDIV 1140

Query: 1141 SAKIVSIDAENKKVNLSLRTESAKTPSISSHTDISQGDVVHGLVKSISDKGIFVYLSRSI 1200
            SAKIVSIDAENKKVNLSLRTESAKTPSISSHTDISQGDVVHGLVKSISDKGIFVYLSRSI
Sbjct: 1141 SAKIVSIDAENKKVNLSLRTESAKTPSISSHTDISQGDVVHGLVKSISDKGIFVYLSRSI 1200

Query: 1201 NAFVPVSKLSDTYLKDWKKFFKPMQYVIGKVVNAEEDSRILLTLRESEVNGDLKILKNYD 1260
            NAFVPVSKLSDTYLKDWKKFFKPMQYVIGKVVNAEEDSRILLTLRESEVNGDLKILKNYD
Sbjct: 1201 NAFVPVSKLSDTYLKDWKKFFKPMQYVIGKVVNAEEDSRILLTLRESEVNGDLKILKNYD 1260

Query: 1261 DIKVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAY 1320
            DIKVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAY
Sbjct: 1261 DIKVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAY 1320

Query: 1321 VLKVNPEKKQLSLSLKASRFGNTNESKVEEKETVDADGDEIMEAVDYNNAPSDNENETEE 1380
            VLKVNPEKKQLSLSLKASRFGNTNESKVEEKETVDADGDEIMEAVDYNNAPSDNENETEE
Sbjct: 1321 VLKVNPEKKQLSLSLKASRFGNTNESKVEEKETVDADGDEIMEAVDYNNAPSDNENETEE 1380

Query: 1381 ILETVSKPKISTDGLSLSTGFDWTASILXXXXXXXXXXXXXXFTETKRNRHKKRKQTIVE 1440
            ILETVSKPKISTDGLSLSTGFDWTASIL              FTETKRNRHKKRKQTIVE
Sbjct: 1381 ILETVSKPKISTDGLSLSTGFDWTASILDQAQAEESSEEDEDFTETKRNRHKKRKQTIVE 1440

Query: 1441 DKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINF 1500
            DKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINF
Sbjct: 1441 DKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINF 1500

Query: 1501 REESEKQNIWMAMLNLENTFGSDETLEDVFKRACQYMDSFTMHNRLLSIYQMSGKIDKAA 1560
            REESEKQNIWMAMLNLENTFGSDETLEDVFKRACQYMDSFTMHNRLLSIYQMSGKIDKAA
Sbjct: 1501 REESEKQNIWMAMLNLENTFGSDETLEDVFKRACQYMDSFTMHNRLLSIYQMSGKIDKAA 1560

Query: 1561 ELFKITAKKFGSENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVRKFAQL 1620
            ELFKITAKKFGSENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVRKFAQL
Sbjct: 1561 ELFKITAKKFGSENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVRKFAQL 1620

Query: 1621 EFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKKKVEDLFERVVSRKITRKQ 1680
            EFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKKKVEDLFERVVSRKITRKQ
Sbjct: 1621 EFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKKKVEDLFERVVSRKITRKQ 1680

Query: 1681 AKFFFNKWLEFEESQNDNKVMEYVKAKATEYVSNHTKEDEAE 1722
            AKFFFNKWLEFEESQNDNKVMEYVKAKATEYVSNHTKEDEAE
Sbjct: 1681 AKFFFNKWLEFEESQNDNKVMEYVKAKATEYVSNHTKEDEAE 1722

>YMR229C (RRP5) [4185] chr13 complement(725933..731122) Protein
            required for processing of pre-rRNA to 18S and 5.8S rRNA,
            component of U3 snoRNP (also called small subunit
            processome), which is required for 18S rRNA biogenesis
            [5190 bp, 1729 aa]
          Length = 1729

 Score = 2251 bits (5832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1086/1723 (63%), Positives = 1351/1723 (78%), Gaps = 9/1723 (0%)

Query: 1    MVPPTKRKRDEEFPLAREDATQQPTASSLMRNTEEVSFPRGGSSALTPLELKQVANEAAN 60
            MV  TKRKRDE+FPL+RED+T+QP+ SSL+RNTEEVSFPRGG+SALTPLELKQVANEAA+
Sbjct: 1    MVASTKRKRDEDFPLSREDSTKQPSTSSLVRNTEEVSFPRGGASALTPLELKQVANEAAS 60

Query: 61   DVLFGKETSTDVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSVVQHVNFKTLKIGS 120
            DVLFG E+                                      +++HVNFKTLK GS
Sbjct: 61   DVLFGNESVKASEPASRPLKKKKTTKKSTSKDSEASSANSDEARAGLIEHVNFKTLKNGS 120

Query: 121  LVLGQISEISKTDMCISFTDGLSGYVNLTHISAPFMTIXXXXXXXXXXXXXXXXXXXXXX 180
             +LGQIS I+K D+CI+FTDG+SGYVNLTHIS  F +I                      
Sbjct: 121  SLLGQISAITKQDLCITFTDGISGYVNLTHISEEFTSILEDLDEDMDSDTDAADEKKSKV 180

Query: 181  XXXXXXXXXXXXXXXXXIG-LPSLENYFKVGQWLRCSVISNTALLPXXXXXXXXXIELSI 239
                                LP+L  YF +GQWLRCSVI NT+L P         IEL+I
Sbjct: 181  EDAEYESSDDEDEKLDKSNELPNLRRYFHIGQWLRCSVIKNTSLEPSTKKSKKKRIELTI 240

Query: 240  EPSVVNTLTEEDIVRSASVQCAVKSIEDHGAMLDIGIDGFTGFISKKDYPEFEKLLPGAV 299
            EPS VN   +ED+V+S S+QCAVKSIEDHGA LD+G+ GFTGFI+KKD+  FEKLLPGAV
Sbjct: 241  EPSSVNIYADEDLVKSTSIQCAVKSIEDHGATLDVGLPGFTGFIAKKDFGNFEKLLPGAV 300

Query: 300  FLGNVTKKSDRTVTINLDFSDKKAKITHISSVDAVVPGQVVDLLCQTITNNGIVGKTFGL 359
            FLGN+TKKSDR++ +N DFSDKK KIT ISS+DA++PGQ+VDLLC++IT NGI GK FGL
Sbjct: 301  FLGNITKKSDRSIVVNTDFSDKKNKITQISSIDAIIPGQIVDLLCESITKNGIAGKVFGL 360

Query: 360  VPSFISTAHLRVFKEEELKHNFAVGSNIPCRIIAVLITKENDKTLLLSTLPHIKSLKNVL 419
            V   ++ +HLR F EE+LKH F +GS+I CRIIA L  K  DK L+LS LPHI  L++ L
Sbjct: 361  VSGVVNVSHLRTFSEEDLKHKFVIGSSIRCRIIACLENKSGDKVLILSNLPHILKLEDAL 420

Query: 420  GEVENLTAFPIGHLIDSCTVKGRDSDYLYLAMDDDRVGEVHSSRIGELEKFDKLKARVLG 479
               E L AFPIG+  +SC++KGRDS+YLYLA+DDDR+G+VHSSR+GE+E  + L +RVLG
Sbjct: 421  RSTEGLDAFPIGYTFESCSIKGRDSEYLYLALDDDRLGKVHSSRVGEIENSENLSSRVLG 480

Query: 480  FNSIDNLYELSTDPEILKLKYLRSKDIPIGEVLPNCEITAVSSKGIELKIFNGQFKAIVP 539
            ++ +D++Y+LSTDP+ LKLKYLR+ DIPIGE+LP+CEIT+VSS GIELKIFNGQFKA VP
Sbjct: 481  YSPVDDIYQLSTDPKYLKLKYLRTNDIPIGELLPSCEITSVSSSGIELKIFNGQFKASVP 540

Query: 540  PMHISDTRLVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKTLVNIEDDDIQLLSNFAIA 599
            P+HISDTRLVYPERKFKIGSKVKGRV+++N+RG ++VTLKK+LVNIED+++ L+S +  A
Sbjct: 541  PLHISDTRLVYPERKFKIGSKVKGRVISVNSRGNVHVTLKKSLVNIEDNELPLVSTYENA 600

Query: 600  KEIQEKNQKTVATVTAFRPSGCIVAFFGGMTAFLPNAEISEVFVRKPEEHLRLGQTIVVK 659
            K I+EKN+KT+AT+  F+P+GCI++FFGG++ FLPN+EISEVFV++PEEHLRLGQT++VK
Sbjct: 601  KNIKEKNEKTLATIQVFKPNGCIISFFGGLSGFLPNSEISEVFVKRPEEHLRLGQTVIVK 660

Query: 660  LLKIDQENARMLVTCKISNDQAEKKKETIEKLIPGRSMVKVNVVEKTKDSVIVELPETSL 719
            LL +D +  R++ TCK+SN+QA ++K+TIE ++PGR+++ V+V+EKTKDSVIVE+P+  L
Sbjct: 661  LLDVDADRRRIIATCKVSNEQAAQQKDTIENIVPGRTIITVHVIEKTKDSVIVEIPDVGL 720

Query: 720  RGVIYVGHLSDARIEQNRAAIKKIAIGSELKGLVIDKDARTQVFNLSLKQSLIKDAKNEV 779
            RGVIYVGHLSD+RIEQNRA +KK+ IG+EL GLVIDKD RT+VFN+SLK SLIKDAK E 
Sbjct: 721  RGVIYVGHLSDSRIEQNRAQLKKLRIGTELTGLVIDKDTRTRVFNMSLKSSLIKDAKKET 780

Query: 780  SPLTYADIKSKSKTTPLHGYIKSISNKGLFVAFNGKFVGLVLPSYAVESRDVDISKTFYI 839
             PLTY D+K  +K  P+H YIKSIS+KGLFVAFNGKF+GLVLPSYAV+SRD+DISK FYI
Sbjct: 781  LPLTYDDVKDLNKDVPMHAYIKSISDKGLFVAFNGKFIGLVLPSYAVDSRDIDISKAFYI 840

Query: 840  NQSVTAYLLRSDDDNERFLLTLRTPSTKDDSSKVTGTETLKPIDPAMKDLKDFTTXXXXX 899
            NQSVT YLLR+DD N++FLL+L+ P  K +  K   +    P+D ++K   D +      
Sbjct: 841  NQSVTVYLLRTDDKNQKFLLSLKAPKVK-EEKKKVESNIEDPVDSSIKSWDDLSIGSIVK 899

Query: 900  XXXXXXXXNQLNVVLADNLHGRIDIAEVFDSFSDIKNATHPLIDFKKGNIIDAKIIGTHD 959
                    NQLNV+LA NLHGR+DIAEVFD++ +I +   PL ++KK ++I  KIIG HD
Sbjct: 900  AKIKSVKKNQLNVILAANLHGRVDIAEVFDTYEEITDKKQPLSNYKKDDVIKVKIIGNHD 959

Query: 960  IKSHRFLPISHHAVKGSVLELSLKPSQMRSKDIKTLSISDVAVGDELTGFVNNYGSNTLW 1019
            +KSH+FLPI+H   K SVLELS+KPS+++SK++ T S+ ++ +G ELTGFVNN   N LW
Sbjct: 960  VKSHKFLPITHKISKASVLELSMKPSELKSKEVHTKSLEEINIGQELTGFVNNSSGNHLW 1019

Query: 1020 LTVSPTLKAKISLFDLAEDGLKSSEKVEDNFPLGCALPVKVTSIDTEHGVVNVTGRSHTE 1079
            LT+SP LKA+ISL DLA++    SE +E  FPLG AL VKV SID EHG VN  G+SH +
Sbjct: 1020 LTISPVLKARISLLDLADNDSNFSENIESVFPLGSALQVKVASIDREHGFVNAIGKSHVD 1079

Query: 1080 ISFESLKVGDNVPSRIIKIADSYVLLDLGNKIHGIAFITDALDDFSVPLKEAYKGMENDI 1139
            I+  ++KVGD +P R++KIA+ YVLLDLGNK+ GI+FITDAL+DFS+ LKEA++   N++
Sbjct: 1080 INMSTIKVGDELPGRVLKIAEKYVLLDLGNKVTGISFITDALNDFSLTLKEAFEDKINNV 1139

Query: 1140 VSAKIVSIDAENKKVNLSLRTESAKTPSISSHTDISQGDVVHGLVKSISDKGIFVYLSRS 1199
            +   ++S+D +NKK+ LSLR  +AKT SI SH D+ QG++V G+VK+++DKGIFVYLSR 
Sbjct: 1140 IPTTVLSVDEQNKKIELSLRPATAKTRSIKSHEDLKQGEIVDGIVKNVNDKGIFVYLSRK 1199

Query: 1200 INAFVPVSKLSDTYLKDWKKFFKPMQYVIGKVVNAEEDSRILLTLRESEVNGDLKILKNY 1259
            + AFVPVSKLSD+YLK+WKKF+KPMQYV+GKVV  +EDSRI LTLRESE+NGDLK+LK Y
Sbjct: 1200 VEAFVPVSKLSDSYLKEWKKFYKPMQYVLGKVVTCDEDSRISLTLRESEINGDLKVLKTY 1259

Query: 1260 DDIKVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKA 1319
             DIK  +++ G++K+VTDFGVFVKLDNTVNVTGLAH +EIAD+KPEDL++LFGVGDRVKA
Sbjct: 1260 SDIKAGDVFEGTIKSVTDFGVFVKLDNTVNVTGLAHITEIADKKPEDLSALFGVGDRVKA 1319

Query: 1320 YVLKVNPEKKQLSLSLKASRFGNTNE--SKVEEKETVDA----DGDEIMEAVDYNNAPSD 1373
             VLK NPEKKQ+SLSLKAS F    E  S      TVD     D DE+M    +N++ S+
Sbjct: 1320 IVLKTNPEKKQISLSLKASHFSKEAELASTTTTTTTVDQLEKEDEDEVMADAGFNDSDSE 1379

Query: 1374 NENETEEILETVSKPKISTDGLSLSTGFDWTASIL-XXXXXXXXXXXXXXFTETKRNRHK 1432
            ++   +       KP+ S+DGLSLS GFDWTASIL               FTE K+++HK
Sbjct: 1380 SDIGDQNTEVADRKPETSSDGLSLSAGFDWTASILDQAQEEEESDQDQEDFTENKKHKHK 1439

Query: 1433 KRKQTIVEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAE 1492
            +RK+ +V+DKTIDINTRAPESVADFERL+IGNPNSSV+WMNYMAFQLQLSEIEKARELAE
Sbjct: 1440 RRKENVVQDKTIDINTRAPESVADFERLLIGNPNSSVVWMNYMAFQLQLSEIEKARELAE 1499

Query: 1493 RALKTINFREESEKQNIWMAMLNLENTFGSDETLEDVFKRACQYMDSFTMHNRLLSIYQM 1552
            RALKTINFREE+EK NIW+AMLNLENTFG++ETLE+VF RACQYMDS+T+H +LL IY++
Sbjct: 1500 RALKTINFREEAEKLNIWIAMLNLENTFGTEETLEEVFSRACQYMDSYTIHTKLLGIYEI 1559

Query: 1553 SGKIDKAAELFKITAKKFGSENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIE 1612
            S K DKAAELFK TAKKFG E VSIWVSWGDFL SH + QEAR IL NALKALPKR+HIE
Sbjct: 1560 SEKFDKAAELFKATAKKFGGEKVSIWVSWGDFLISHNEEQEARTILGNALKALPKRNHIE 1619

Query: 1613 VVRKFAQLEFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKKKVEDLFERVV 1672
            VVRKFAQLEFAKGDPE GRSLFEGL+ADAPKRID+WNVY+DQE+KA +KKKVEDLFER++
Sbjct: 1620 VVRKFAQLEFAKGDPERGRSLFEGLVADAPKRIDLWNVYVDQEVKAKDKKKVEDLFERII 1679

Query: 1673 SRKITRKQAKFFFNKWLEFEESQNDNKVMEYVKAKATEYVSNH 1715
            ++KITRKQAKFFFNKWL+FEES+ D K +EYVKAKATEYV++H
Sbjct: 1680 TKKITRKQAKFFFNKWLQFEESEGDEKTIEYVKAKATEYVASH 1722

>Sklu_2383.1 YMR229C, Contig c2383 993-6155
          Length = 1720

 Score = 2073 bits (5372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1005/1721 (58%), Positives = 1292/1721 (75%), Gaps = 20/1721 (1%)

Query: 1    MVPPT-KRKRDEEFPLAREDATQQPTASSLMRNTEEVSFPRGGSSALTPLELKQVANEAA 59
            M P   KRKRD+E PL R+D T QP  SSL++++EE SFPRGG+S LTPLELKQVANEAA
Sbjct: 1    MAPSNNKRKRDDESPLTRQDNTSQPVKSSLLQSSEETSFPRGGASVLTPLELKQVANEAA 60

Query: 60   NDVLFGKETSTDVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSVVQHVNFKTLKIG 119
            +DVLF   TS+ V                                 ++V+H++FK L  G
Sbjct: 61   SDVLFDNGTSSAVKPEVERPKKKKKTSKSTTGTKNETDEEEST---TIVEHISFKNLTPG 117

Query: 120  SLVLGQISEISKTDMCISFTDGLSGYVNLTHISAPFMTIXXXXXXXXXXXXXXXXXXXXX 179
            S +LGQIS ++K D+CIS +D L GYV L +IS  F  +                     
Sbjct: 118  SQLLGQISAVNKHDLCISLSDNLCGYVTLANISEQFTNLLEELDENMEKDQDSEDDDSDY 177

Query: 180  XXXXXXXXXXXXXXXXXXIGLPSLENYFKVGQWLRCSVISNTALLPXXXXXXXXXIELSI 239
                                LP L+ YFK GQWLRC+V SNTAL           IEL+I
Sbjct: 178  DSSDEDEHSKNKKNKE----LPDLKKYFKPGQWLRCTVQSNTAL---EAKKKQKRIELTI 230

Query: 240  EPSVVNTLTEEDIVRSASVQCAVKSIEDHGAMLDIGIDGFTGFISKKDYPEFEKLLPGAV 299
            EPS  N L +ED+ R+ +VQC+VKSIEDHGA+LD+GI G TGFISKKDYP  E+LLPG V
Sbjct: 231  EPSATNQLADEDLSRNCTVQCSVKSIEDHGAILDLGIKGITGFISKKDYPGVEELLPGTV 290

Query: 300  FLGNVTKKSDRTVTINLDFSDKKAKITHISSVDAVVPGQVVDLLCQTITNNGIVGKTFGL 359
            FLGNV K+SDRTV +N DF+ K  K++HISS+DAV+PGQ VD LCQ I++NGI GKTFGL
Sbjct: 291  FLGNVAKRSDRTVNVNFDFTSKNNKVSHISSIDAVIPGQSVDFLCQKISSNGIFGKTFGL 350

Query: 360  VPSFISTAHLRVFKEEELKHNFAVGSNIPCRIIAVLITKENDKTLLLSTLPHIKSLKNVL 419
            V  F+  +HLR F  +++KHN+A+GSNI  RI+A L  K+ +K +L+STLPHI SL+  +
Sbjct: 351  VSGFLGASHLRTFSADKIKHNYAIGSNIRARIVATLTNKKGEKIILVSTLPHILSLETKI 410

Query: 420  GEVENLTAFPIGHLIDSCTVKGRDSDYLYLAMDDDRVGEVHSSRIGELEKFDKLKARVLG 479
             E + L AFP+G++++SCTVKGRDS Y YL+MD DR+G+VH SR+G+ +   ++KARV+G
Sbjct: 411  LEADALDAFPVGYILESCTVKGRDSQYFYLSMDQDRIGQVHISRVGDEDPAGEVKARVMG 470

Query: 480  FNSIDNLYELSTDPEILKLKYLRSKDIPIGEVLPNCEITAVSSKGIELKIFNGQFKAIVP 539
            +N +D  Y+LSTDP++L+LKYLR+KDIP+GEV+  CEI  VS KGI+L +F  QFKA VP
Sbjct: 471  YNVVDGYYQLSTDPKVLELKYLRTKDIPLGEVISGCEIVTVSDKGIQLTLFGSQFKAFVP 530

Query: 540  PMHISDTRLVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKTLVNIEDDDIQLLSNFAIA 599
            P+HISD +LVYPERKFKIGSKVKGRVLN++NRG + VTLKK+LVN+++D+I+L+SNF   
Sbjct: 531  PLHISDVKLVYPERKFKIGSKVKGRVLNVDNRGRVTVTLKKSLVNLDEDEIKLVSNFKQI 590

Query: 600  KEIQEKNQKTVATVTAFRPSGCIVAFFGGMTAFLPNAEISEVFVRKPEEHLRLGQTIVVK 659
            +++ + ++KT ATV  F+ +GC+V+F G +  FLPN EISE FV++P++HLRLGQT++VK
Sbjct: 591  EKLADNDEKTSATVEFFKTNGCVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVK 650

Query: 660  LLKIDQENARMLVTCKISNDQAEKKKETIEKLIPGRSMVKVNVVEKTKDSVIVELPETSL 719
            +L+ D+E  R+++TCK+S+D A ++K+ IE ++ GRS+V V VV KTKDS ++EL +  L
Sbjct: 651  VLQHDEEKNRVIITCKVSSDAAAQQKDAIENMVIGRSIVTVTVVGKTKDSAVIELVDVGL 710

Query: 720  RGVIYVGHLSDARIEQNRAAIKKIAIGSELKGLVIDKDARTQVFNLSLKQSLIKDAKNEV 779
            RGVIYVGHLSD+RIEQNRA +KK+ +G+EL+GLVIDKD RT+VFNLS K+SLIKDA+N +
Sbjct: 711  RGVIYVGHLSDSRIEQNRAQLKKLRVGTELEGLVIDKDIRTRVFNLSCKKSLIKDAQNGL 770

Query: 780  SPLTYADIKSKSKTTPLHGYIKSISNKGLFVAFNGKFVGLVLPSYAVESRDVDISKTFYI 839
             PL+Y ++K+K  + P+HGY+KS S+KG+FVAF+G+FVGLVLPSYAVESRDVDI K F+I
Sbjct: 771  LPLSYDEVKAKGNSFPMHGYVKSFSDKGIFVAFSGRFVGLVLPSYAVESRDVDILKKFHI 830

Query: 840  NQSVTAYLLRSDDDNERFLLTLRTPSTKDDSSKVTGTETLKPIDPAMKDLKDFTTXXXXX 899
            NQS+TAYLLR+DD+NERFLLTL+ P   +          + PID ++K+L ++       
Sbjct: 831  NQSITAYLLRTDDENERFLLTLKEPKVAEKRQDNGSVNAVNPIDESVKELSEYVVGKVTK 890

Query: 900  XXXXXXXXNQLNVVLADNLHGRIDIAEVFDSFSDIKNATHPLIDFKKGNIIDAKIIGTHD 959
                    NQLNV+LADNLHGR+D++E+FD F +IK+   PL  +KKG++I+ K+IG HD
Sbjct: 891  AKIKAVKKNQLNVLLADNLHGRVDVSEIFDKFENIKDTKAPLSCYKKGDVIEVKVIGYHD 950

Query: 960  IKSHRFLPISHHAVKGSVLELSLKPSQMRSKDIKTLSISDVAVGDELTGFVNNYGSNTLW 1019
            IK+HRFLPISH A K ++LEL+ KPS++  ++  +L+I +V   DEL GFVNN+    LW
Sbjct: 951  IKTHRFLPISHRASKNTILELTAKPSKLTEENESSLTIKNVKENDELVGFVNNFSKGFLW 1010

Query: 1020 LTVSPTLKAKISLFDLAEDGLKSSEKVEDNFPLGCALPVKVTSIDTEHGVVNVTGRSHTE 1079
            LT+SP LKAKIS  +L++DG   +  + ++FPLG AL VK   IDTEH VV+VTGR H+ 
Sbjct: 1011 LTLSPVLKAKISNINLSDDGSTFASDIPESFPLGSALKVKAVDIDTEHNVVSVTGRFHSI 1070

Query: 1080 ISFESLKVGDNVPSRIIKIADSYVLLDLGNKIHGIAFITDALDDFSVPLKEAYKGMENDI 1139
                 +KVGD +P+RII IADSY+LLDLGN + GI+F+T+ALDD+SV LK A++  +N I
Sbjct: 1071 KDITDVKVGDKLPARIIMIADSYLLLDLGNDLKGISFVTEALDDYSVSLKTAFENRKNSI 1130

Query: 1140 VSAKIVSIDAENKKVNLSLRTESAKTPSISSHTDISQGDVVHGLVKSISDKGIFVYLSRS 1199
            V A ++S+D ++KKV LSLR+   K   I S+ D+S+GDVV G +K++SDKGIFVYLS S
Sbjct: 1131 VPATVISVDLKDKKVKLSLRSTKPKDREIKSYKDLSRGDVVRGFIKAVSDKGIFVYLSTS 1190

Query: 1200 INAFVPVSKLSDTYLKDWKKFFKPMQYVIGKVVNAEEDSRILLTLRESEVNGDLKILKNY 1259
            + AFVPVSKL+D+++KDWKKF+KPMQ V GKVVN EE+SRILLTL+ESEVNGDL ILK Y
Sbjct: 1191 VQAFVPVSKLTDSFIKDWKKFYKPMQPVTGKVVNCEEESRILLTLKESEVNGDLNILKGY 1250

Query: 1260 DDIKVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKA 1319
             +I+  EI+ G + NVTDFGVFVKL+NT+NVTGLAH S+IAD + +DL++LFG GD+VKA
Sbjct: 1251 SNIQAGEIFEGYITNVTDFGVFVKLNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKA 1310

Query: 1320 YVLKVNPEKKQLSLSLKASRFGNTNE--SKVEEKETVD-----ADGDEIMEAVDYNNAPS 1372
             VLK NPEKKQ+SL LKAS F    E   +VE+ E  D     ++ DEI+ AVDY N   
Sbjct: 1311 IVLKTNPEKKQVSLGLKASYFKKEVEKNQEVEDVEMEDVAENESEEDEII-AVDYENESE 1369

Query: 1373 DNENETEEILETVSKPKISTDGLSLSTGFDWTASILXXXXXXXXXXXXXXFTETKRNRHK 1432
                  +E     SK  ++ DGLSLSTGFDWTASIL              F  TK++R++
Sbjct: 1370 LEAEPEKEATSQSSKVPVTNDGLSLSTGFDWTASILDQAQEDEESSEDEDFANTKKSRNR 1429

Query: 1433 KRKQT-IVEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELA 1491
            K+ +T  VEDKTIDINTRAPESV+DFERLI+GNPNSSV+WMNYMAFQLQLSE++KARE+A
Sbjct: 1430 KKGRTNAVEDKTIDINTRAPESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIA 1489

Query: 1492 ERALKTINFREESEKQNIWMAMLNLENTFGSDETLEDVFKRACQYMDSFTMHNRLLSIYQ 1551
            ERALKTI+FR+E EK NIW+AMLNLENTFG++ETL+D FKR+CQYMDSFTMHN+L+SIYQ
Sbjct: 1490 ERALKTISFRDELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQ 1549

Query: 1552 MSGKIDKAAELFKITAKKFGSENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKRDHI 1611
            +S K ++AAEL++ TAKKFGS+ VSIWVSWG+FL S  +  EA  +L NALKALPKRDHI
Sbjct: 1550 LSEKFERAAELYRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHI 1609

Query: 1612 EVVRKFAQLEFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKKKVEDLFERV 1671
            EVVRKFAQLEF+KGD E GRSLFEGL+ADAPKRID+WNVY+DQE KA EKKKVEDLFER+
Sbjct: 1610 EVVRKFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERI 1669

Query: 1672 VSRKITRKQAKFFFNKWLEFEESQNDNKVMEYVKAKATEYV 1712
            +S+KITRKQAKFFFNKWL+FEES+ND K  EYVKAKA E+V
Sbjct: 1670 ISKKITRKQAKFFFNKWLQFEESKNDQKAAEYVKAKAAEFV 1710

>CAGL0M04829g complement(524685..529805) similar to sp|Q05022
            Saccharomyces cerevisiae YMR229c RRP5, hypothetical start
          Length = 1706

 Score = 2006 bits (5196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 999/1723 (57%), Positives = 1278/1723 (74%), Gaps = 37/1723 (2%)

Query: 12   EFPLAREDATQQPTASSLMRNTEEVSFPRGGSSALTPLELKQVANEAANDVLFGKE---- 67
            +FPL++ED T+QP  S+L+R TEE+SFPRGGSSALTPLELK VANEAA+DVLFG E    
Sbjct: 6    DFPLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLELKHVANEAAHDVLFGNEKRPL 65

Query: 68   TSTDVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSVVQHVNFKTLKIGSLVLGQIS 127
            T  D                                  ++++H+NF  +K G+++LGQI 
Sbjct: 66   TEDDAGKPKKKKKRSSKKDTETVTDDTTEQRS------AIIEHLNFNNVKEGTILLGQID 119

Query: 128  EISKTDMCISFTDGLSGYVNLTHISAPFMTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 187
             I+K D+ I+FTDGLSG+V+LTHIS    ++                             
Sbjct: 120  SITKNDLRITFTDGLSGFVDLTHISEQLTSLLEDIDEDMDSDSKEDDAEYESSDDESEQK 179

Query: 188  XXXXXXXXXXIGLPSLENYFKVGQWLRCSVISNTALLPXXXXXXXXXIELSIEPSVVNTL 247
                        LP+L +YFKVGQWLRC+V  NTAL P         IEL+IEPSVVN  
Sbjct: 180  -----------SLPNLRHYFKVGQWLRCAVTKNTALKPKNAKQKKR-IELTIEPSVVNNF 227

Query: 248  TEEDIVRSASVQCAVKSIEDHGAMLDIGIDGFTGFISKKDYPEFEKLLPGAVFLGNVTKK 307
              EDI ++  +QC+V+SIEDHGA LD+G+   TGFI+KKD   F++L PG+VF+  +TKK
Sbjct: 228  DVEDINKNTIIQCSVESIEDHGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFISCITKK 287

Query: 308  SDRTVTINLDFSDKKAKITHISSVDAVVPGQVVDLLCQTITNNGIVGKTFGLVPSFISTA 367
            +DR++ ++ DFS KK K+T ISS+D+V+PGQVVDLLC+ IT++GIVGK FG + +FI   
Sbjct: 288  TDRSIVVSQDFSVKKNKMTSISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSISAFIGKP 347

Query: 368  HLRVFKEEELKHNFAVGSNIPCRIIAVLITKENDKTLLLSTLPHIKSLKNVLGEVENLTA 427
            HL+ F EE++KH F++GSNIPCRI+A +I K  D+ L+LSTLPH+ SL N LG +E+L A
Sbjct: 348  HLQTFSEEDIKHKFSLGSNIPCRILASVINKSGDRVLILSTLPHVISLNNTLGSIESLEA 407

Query: 428  FPIGHLIDSCTVKGRDSDYLYLAMDDDRVGEVHSSRIGELEKFDKLKARVLGFNSIDNLY 487
            FPIG +ID   VKGRDS YLYLA+ D  +G VH S +GE+ K DKLK+RV+G++  D ++
Sbjct: 408  FPIGFIIDESVVKGRDSSYLYLAISDKFIGRVHQSNLGEIIKQDKLKSRVIGYDVADCIF 467

Query: 488  ELSTDPEILKLKYLRSKDIPIGEVLPNCEITAVSSKGIELKIFNGQFKAIVPPMHISDTR 547
            EL+TDPE LKLKY+RSKDIP+GEV  NCEI   SS G+ELK+  GQF A VPP+HISD R
Sbjct: 468  ELTTDPEKLKLKYIRSKDIPVGEVFNNCEILKASSSGVELKLLGGQFTAFVPPLHISDIR 527

Query: 548  LVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKTLVNIEDDDIQLLSNFAIAKEIQEKNQ 607
            L+YPERKFKI SK K R+LN++N G I  T+KK+LVN E+ +  ++ +F  AK I+ KN+
Sbjct: 528  LIYPERKFKIASKTKCRILNVDNHGHIIATMKKSLVNDEELEKPVIESFETAKSIKNKNE 587

Query: 608  KTVATVTAFRPSGCIVAFFGGMTAFLPNAEISEVFVRKPEEHLRLGQTIVVKLLKIDQEN 667
            KTV TV +F   GC++ FFGG+T FLP +E+SEVFV++ E+HLRLGQT+ VK+L++D+E 
Sbjct: 588  KTVGTVQSFNGHGCVIMFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEER 647

Query: 668  ARMLVTCKISNDQAEKKKETIEKLIPGRSMVKVNVVEKTKDSVIVELPETSLRGVIYVGH 727
             R++VTCK+SN++A+++K  IE L  G+S+++  VVEKTKDSVIVE+P+  +RGVIYVGH
Sbjct: 648  RRIIVTCKVSNEEAQQQKSIIESLKIGQSIIETVVVEKTKDSVIVEIPDVGIRGVIYVGH 707

Query: 728  LSDARIEQNRAAIKKIAIGSELKGLVIDKDARTQVFNLSLKQSLIKDAKNEVSPLTYADI 787
            +SD RIEQ RA IKKI IGS+L GLVIDKD+RTQ+FNLSLK+SL+KDA+N+  P T+A+I
Sbjct: 708  ISDERIEQCRAEIKKIRIGSKLTGLVIDKDSRTQIFNLSLKKSLMKDAQNKRLPTTFAEI 767

Query: 788  KSKSKTTPLHGYIKSISNKGLFVAFNGKFVGLVLPSYAVESRDVDISKTFYINQSVTAYL 847
                KT PLHGY+KSIS+ G+FVAF GKFVGLVLPSYAVESR VDI K FY NQSVTAYL
Sbjct: 768  TKFKKTDPLHGYVKSISSTGVFVAFTGKFVGLVLPSYAVESRQVDIEKAFYSNQSVTAYL 827

Query: 848  LRSDDDNERFLLTLRTPSTKDDSSKVTGTETLKPIDPAMKDLKDFTTXXXXXXXXXXXXX 907
            LR+DDDNERFLLTL+ P  +  +  ++       ID ++K +KD                
Sbjct: 828  LRTDDDNERFLLTLKAPKVEKAAETISAENI---IDTSIKSVKDIKLGKILDAKIKGVKK 884

Query: 908  NQLNVVLADNLHGRIDIAEVFDSFSDIKNATHPLIDFKKGNIIDAKIIGTHDIKSHRFLP 967
            NQLN++LADN+HGR+DI+EVFD+++DIK+  HPL  +K  + +  KIIG HD+KSH+ LP
Sbjct: 885  NQLNIILADNVHGRVDISEVFDNYNDIKDKKHPLSHYKANDKVRVKIIGHHDLKSHKSLP 944

Query: 968  ISHHAVKGSVLELSLKPSQMRSKDIKTLSISDVAVGDELTGFVNNYGSNTLWLTVSPTLK 1027
            I+H+ VKG+V EL++KPSQ++SKD+K L I D+ VGDE+  FVNNY ++TLWLTV+PT+K
Sbjct: 945  ITHNFVKGTVFELTMKPSQLKSKDVKELDIRDITVGDEIIAFVNNYQNSTLWLTVTPTIK 1004

Query: 1028 AKISLFDLAEDGLKSSEKVEDNFPLGCALPVKVTSIDTEHGVVNVTGRSHTEISFESLKV 1087
            AK+S+FDL+E+ L + + VED+FPLG  L V VT  D    ++ VT R+    S + LKV
Sbjct: 1005 AKLSIFDLSEETLMNIKNVEDDFPLGSVLKVNVTGKDQNKSILQVTQRNGKINSIDDLKV 1064

Query: 1088 GDNVPSRIIKIADSYVLLDLGNKIHGIAFITDALDDFSVPLKEAYKGMENDIVSAKIVSI 1147
            G +   +I+K+   Y+L++L NKI GI+   +AL+DF+ PL + + G EN+ V AKI S+
Sbjct: 1065 GGHTIGKIVKVTPKYLLIELENKITGISTALEALNDFTEPLDQVFAGKENEFVKAKITSV 1124

Query: 1148 DAENKKVNLSLRTESAKTPSISSHTDISQGDVVHGLVKSISDKGIFVYLSRSINAFVPVS 1207
             A+ KKV L L  + +    I+SH+D+  G+VV+GLVK+++DKG+FV+L +S+ AFVPVS
Sbjct: 1125 IADEKKVQLQLAEDESTVQKITSHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVPVS 1184

Query: 1208 KLSDTYLKDWKKFFKPMQYVIGKVVNAEEDSRILLTLRESEVNGDLKILKNYDDIKVNEI 1267
            KLSD+YLK+WKKF+KPMQ V+GK+V+  ED RILLTLRE+EVNGDLK+LKNY DIK  +I
Sbjct: 1185 KLSDSYLKEWKKFYKPMQPVVGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPGDI 1244

Query: 1268 YNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAYVLKVNPE 1327
            +NG+V+NVTDFGVFVKLDNT NVTGLAH +EIAD+ PED+ S+FGVGDRVKAYVLK NPE
Sbjct: 1245 FNGTVRNVTDFGVFVKLDNTANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSNPE 1304

Query: 1328 KKQLSLSLKASRFGNTNESKVEEKET------VDADGDEIMEAVDYNNAPSDNENETEEI 1381
            KKQLSLSLKAS F NTNE+  E+ E+      +D D DE+M+     N+ S+  ++ EE 
Sbjct: 1305 KKQLSLSLKASHF-NTNETITEKAESQPQPRKIDEDQDELMDDEVVYNSESEASDD-EEA 1362

Query: 1382 LETVSKPKISTD-GLSLSTGFDWTASIL-XXXXXXXXXXXXXXFTE-TKRNRHKKRKQTI 1438
              + S   IS D GLSLS GFDWT SIL               F E  +    KK+ + +
Sbjct: 1363 HSSKSTTVISNDGGLSLSAGFDWTTSILDQANASSDSESDEEDFMESKRSKNKKKKSKNL 1422

Query: 1439 VEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTI 1498
            VEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEI+KARELAERALKTI
Sbjct: 1423 VEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTI 1482

Query: 1499 NFREESEKQNIWMAMLNLENTFGSDETLEDVFKRACQYMDSFTMHNRLLSIYQMSGKIDK 1558
            N+REE+EK NIW+AMLNLENTFGS+ETLEDVF R+CQYMDSFTMH++L+ IYQ+S K DK
Sbjct: 1483 NYREEAEKLNIWIAMLNLENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDK 1542

Query: 1559 AAELFKITAKKFGSENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVRKFA 1618
            A+ELFKIT KKFGSE  SIWVSW  F+ S  +  +   ILS+ALK+LPKR+HIEVVRKFA
Sbjct: 1543 ASELFKITTKKFGSEKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFA 1602

Query: 1619 QLEFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKK-KVEDLFERVVSRKIT 1677
            QLEF++G+PE GRSLFEGL+ADAPKRIDIWNVYLDQEIK  + K +VE+LFERV+  KIT
Sbjct: 1603 QLEFSEGNPERGRSLFEGLLADAPKRIDIWNVYLDQEIKQKDNKSRVEELFERVIKMKIT 1662

Query: 1678 RKQAKFFFNKWLEFEESQNDNKVMEYVKAKATEYVSNHTKEDE 1720
            RKQAKFFFNKWL+FEES ND K+ +YVKAKA+EYV  HT++DE
Sbjct: 1663 RKQAKFFFNKWLQFEESNNDEKMTDYVKAKASEYVEKHTQKDE 1705

>Kwal_26.9189
          Length = 1726

 Score = 1939 bits (5023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 954/1729 (55%), Positives = 1247/1729 (72%), Gaps = 25/1729 (1%)

Query: 1    MVPPTKRKRDEEFPLAREDATQQPTASSLMRNTEEVSFPRGGSSALTPLELKQVANEAAN 60
            M    KRKR EE PL R+D TQQP+ SSL++N +E SFPRGG+SALTPLELKQVANEAA 
Sbjct: 1    MSSGQKRKRVEESPLTRQDQTQQPS-SSLLQNADEGSFPRGGASALTPLELKQVANEAAG 59

Query: 61   DVLFGKETSTDVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSVVQHVNFKTLKIGS 120
            DVLFG E++   A                               ++V+ H+NF+ L +G+
Sbjct: 60   DVLFGAESAAP-APVSDSQRPKKKKKTHQKSATKAADEDSEDSSVTVIDHLNFRNLPVGT 118

Query: 121  LVLGQISEISKTDMCISFTDGLSGYVNLTHISAPFMTIXXXXXXXXXXXXXXXXXXXXXX 180
            L+LGQIS+++K D+C+S +D L G+V L  IS PF  +                      
Sbjct: 119  LLLGQISQVNKHDLCVSLSDNLCGFVTLPSISEPFTKLLEDLDESMNSDGEEEVNGSEAE 178

Query: 181  XXXXXXXXXXXXXXXXXIG-LPSLENYFKVGQWLRCSVISNTALLPXXXXXXXXXIELSI 239
                                LP L+ +F  GQWLRCSV SN+AL           IELSI
Sbjct: 179  YDSDEESSKASRAQDTKGKELPDLQRFFSQGQWLRCSVQSNSAL--DKDNKKSKRIELSI 236

Query: 240  EPSVVNTLTEEDIVRSASVQCAVKSIEDHGAMLDIGIDGFTGFISKKDYPEFEKLLPGAV 299
            EPS+ N L EED+VR+ +VQCAVKSIEDHGA+LD+GI+G TGFISKKDY     LLPG+V
Sbjct: 237  EPSITNQLVEEDLVRNCTVQCAVKSIEDHGAILDLGIEGITGFISKKDYALLPNLLPGSV 296

Query: 300  FLGNVTKKSDRTVTINLDFSDKKAKITHISSVDAVVPGQVVDLLCQTITNNGIVGKTFGL 359
            FL NV KKS RT T+N DF +KK+K++HISS+DA++PGQ VD LCQ  T+NG++GK FGL
Sbjct: 297  FLANVAKKSGRTATVNFDFKNKKSKVSHISSIDAIIPGQAVDFLCQKKTSNGVIGKVFGL 356

Query: 360  VPSFISTAHLRVFKEEELKHN--FAVGSNIPCRIIAVLITKENDKTLLLSTLPHIKSLKN 417
            V  F++ +    F     K++  ++VGSN   RI+A L+ K  +K +++S LPHI S   
Sbjct: 357  VDGFLNVSQQSAFYSSGKKNDEAYSVGSNTRVRILATLMNKAGEKFVVVSELPHILSFAT 416

Query: 418  VLGEVENLTAFPIGHLIDSCTVKGRDSDYLYLAMDDDRVGEVHSSRIGELEKFDKLKARV 477
               E   L AFP+G++ + C + GRDS Y YL +++D VG+VH S+IG  E   K++ARV
Sbjct: 417  EALERPALNAFPVGYIFEDCDLMGRDSQYFYLKINNDLVGQVHISKIGTEEPSGKVRARV 476

Query: 478  LGFNSIDNLYELSTDPEILKLKYLRSKDIPIGEVLPNCEITAVSSKGIELKIFNGQFKAI 537
            LG+N++D  Y+LSTDP+ L +KYLR+ DIP+G ++P+CEIT VS KGI+L I  GQFKA 
Sbjct: 477  LGYNNLDGYYQLSTDPKTLSVKYLRTSDIPVGTIIPSCEITQVSDKGIQLSILGGQFKAS 536

Query: 538  VPPMHISDTRLVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKTLVNIEDDDIQLLSNFA 597
            VPP+HISD RLVYPERKFKIGSKVK  +++ NNRG ++V+LKK+LVN++ +++QL S+F 
Sbjct: 537  VPPLHISDIRLVYPERKFKIGSKVKAILISANNRGHLFVSLKKSLVNLDREEVQLASSFQ 596

Query: 598  IAKEIQEKNQKTVATVTAFRPSGCIVAFFGGMTAFLPNAEISEVFVRKPEEHLRLGQTIV 657
                I     K  ATV  F+ +GC+V+F GG+  FLPN+EISE FV++P++HLRLGQT++
Sbjct: 597  DIDRIATDGLKVAATVDIFKTNGCVVSFLGGLRGFLPNSEISEAFVKRPQDHLRLGQTVI 656

Query: 658  VKLLKIDQENARMLVTCKISNDQAEKKKETIEKLIPGRSMVKVNVVEKTKDSVIVELPET 717
            VK+L+ + +  R++VTCK+S++ A ++KE IE +I GRS++KV VVEKTKDS++VE    
Sbjct: 657  VKVLQHNAQQNRVIVTCKVSSEAASQQKEAIENMIVGRSIIKVAVVEKTKDSLVVEQVGV 716

Query: 718  SLRGVIYVGHLSDARIEQNRAAIKKIAIGSELKGLVIDKDARTQVFNLSLKQSLIKDAKN 777
             LRGV+YVGHLSD+RIEQNRA +KKI IG+E +GLVIDKDART+VFNLS K+SLIKDA+ 
Sbjct: 717  GLRGVVYVGHLSDSRIEQNRAQLKKIKIGNEFEGLVIDKDARTRVFNLSCKKSLIKDAEK 776

Query: 778  EVSPLTYADIKSKSKTTPLHGYIKSISNKGLFVAFNGKFVGLVLPSYAVESRDVDISKTF 837
             + P+ Y D+K +   + ++GY+KS+S KG+FVAFNG+FVGLVLPSYAV+SRDVD++  F
Sbjct: 777  SLLPVNYQDVKERGTHSAMNGYVKSVSEKGVFVAFNGQFVGLVLPSYAVDSRDVDLASKF 836

Query: 838  YINQSVTAYLLRSDDDNERFLLTLRTPSTKDDSSKVTGTE-TLKPIDPAMKDLKDFTTXX 896
            Y NQSVT YLLR+DD NERFLLT++ P  +  S  +      + P+D ++KDL DF+   
Sbjct: 837  YSNQSVTVYLLRTDDANERFLLTMKEPKNEKSSKPIPEVRGAVNPVDSSIKDLSDFSVGK 896

Query: 897  XXXXXXXXXXXNQLNVVLADNLHGRIDIAEVFDSFSDIKNATHPLIDFKKGNIIDAKIIG 956
                       NQLNVVL+DNLHGRIDI+EVFD   DI +   PL  FKKG+++D K+IG
Sbjct: 897  ITKAMVKAVKRNQLNVVLSDNLHGRIDISEVFDKIEDISDTKSPLATFKKGDLLDVKVIG 956

Query: 957  THDIKSHRFLPISHHAVKGSVLELSLKPSQMRSKDIKTLSISDVAVGDELTGFVNNYGSN 1016
             HD+K+H+FLP+SH + K  +LEL+ KPS++       ++I +V VGD + GFVNN   +
Sbjct: 957  YHDVKTHKFLPVSHRSSKNVLLELTAKPSRLNGAG--GVAIDNVKVGDSIVGFVNNISKD 1014

Query: 1017 TLWLTVSPTLKAKISLFDLAEDGLKSSEKVEDNFPLGCALPVKVTSIDTEHGVVNVTGRS 1076
             LWLTVSP LKAKI  FDL ++  + +  +ED FPLG AL   V  ID +   ++V+GRS
Sbjct: 1015 ILWLTVSPVLKAKIDFFDLTDESSQHNANIEDAFPLGSALRATVVKIDQDRNTLSVSGRS 1074

Query: 1077 HTEISFESLKVGDNVPSRIIKIADSYVLLDLGNKIHGIAFITDALDDFSVPLKEAYKGME 1136
            H+    + + VGDN+P+R++ +ADSY+LL++G  + G+AF+TDALDD++  LK+ Y   +
Sbjct: 1075 HSVSDIKDINVGDNLPARLLNVADSYLLLEVGKDVKGVAFVTDALDDYTKSLKDVYGNQK 1134

Query: 1137 NDIVSAKIVSIDAENKKVNLSLRTESAKTPSISSHTDISQGDVVHGLVKSISDKGIFVYL 1196
            N+I SAK++S+D +N K+NLSLR+E A+  ++ +H D+ +G +V GLVK  +DKGIFVYL
Sbjct: 1135 NNIFSAKVISVDTKNGKLNLSLRSEDAQDGNVKTHKDLKRGQIVRGLVKKATDKGIFVYL 1194

Query: 1197 SRSINAFVPVSKLSDTYLKDWKKFFKPMQYVIGKVVNAEEDSRILLTLRESEVNGDLKIL 1256
            S S+ AFVPVSKL+D+Y+K+WKKF++PMQ V+GK+VN ++DS IL TL+ESEVNG L IL
Sbjct: 1195 SSSLQAFVPVSKLTDSYIKEWKKFYRPMQSVVGKIVNCDDDSHILATLKESEVNGTLNIL 1254

Query: 1257 KNYDDIKVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDR 1316
            KNY DIKV EI+ GSVKNVTDFG+FVKLDNT+NVTGLAH SE+AD    DL+++FG GD+
Sbjct: 1255 KNYADIKVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDK 1314

Query: 1317 VKAYVLKVNPEKKQLSLSLKASRFG-NTNES-KVEEKETVD-----------ADGDEIME 1363
            VKA VLKVN EKKQLSL LKAS F  N N S K+E  + V            +  ++++E
Sbjct: 1315 VKAVVLKVNAEKKQLSLGLKASYFKENKNTSPKLENSDVVSEDEVDDERDVDSASEDLVE 1374

Query: 1364 AVDYNNAPSDNENETEEILETVSKPKISTDGLSLSTGFDWTASILXXXXXXXXXXXXXXF 1423
             +   + P + E+  E+      K  +STDGLSLS GFDWT SIL              F
Sbjct: 1375 EIGQESEPEEMEDIAEDENHNGGKA-LSTDGLSLSAGFDWTTSIL-DQAQDEDSSDEEDF 1432

Query: 1424 TETKRNRHKKRKQTIVEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSE 1483
            TETK+++ KKR    VED+TIDINTRAPESV DFER+I+GNPNSSV+WMN+MAFQLQL E
Sbjct: 1433 TETKKSKKKKRSVGGVEDQTIDINTRAPESVGDFERMIMGNPNSSVVWMNFMAFQLQLGE 1492

Query: 1484 IEKARELAERALKTINFREESEKQNIWMAMLNLENTFGSDETLEDVFKRACQYMDSFTMH 1543
            I+KAR++AERALKTI+FREE+EK NIW+ MLNLENTFG++ +L +VF RACQYMDS+ +H
Sbjct: 1493 IDKARDVAERALKTISFREEAEKMNIWIGMLNLENTFGNESSLNEVFSRACQYMDSYVIH 1552

Query: 1544 NRLLSIYQMSGKIDKAAELFKITAKKFGSENVSIWVSWGDFLTSHGKAQEARGILSNALK 1603
             +L++IYQMS  IDKAA LFK TAKKFGSE V IWVSWG+FL   G+A EA  +L++ALK
Sbjct: 1553 TKLINIYQMSHNIDKAAALFKATAKKFGSEKVPIWVSWGEFLIDQGQADEAHQVLASALK 1612

Query: 1604 ALPKRDHIEVVRKFAQLEFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKKK 1663
            +LP+R HIEVVRKFAQLEFAKGD E GRSLFEGL+AD PKRID+WNVY+DQEIKA +KKK
Sbjct: 1613 SLPRRHHIEVVRKFAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKK 1672

Query: 1664 VEDLFERVVSRKITRKQAKFFFNKWLEFEESQNDNKVMEYVKAKATEYV 1712
            VEDLFER+V+RK+TRKQAKFFF KWLEFEES +D K  EYVKAKA+E+V
Sbjct: 1673 VEDLFERIVNRKLTRKQAKFFFGKWLEFEESADDQKTAEYVKAKASEFV 1721

>AFR566C [3758] [Homologous to ScYMR229C (RRP5) - SH]
            (1449324..1454474) [5151 bp, 1716 aa]
          Length = 1716

 Score = 1889 bits (4892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 931/1735 (53%), Positives = 1238/1735 (71%), Gaps = 44/1735 (2%)

Query: 6    KRK-RDEEFPLAREDATQQPTASSLMRNTEEVSFPRGGSSALTPLELKQVANEAANDVLF 64
            KRK  +E+ P   E A +Q  + S++ +  +V+FPRGG+SALTPLELKQVANEAA+DVLF
Sbjct: 8    KRKLNNEQRP--EEAAGRQMASKSVLASGGDVAFPRGGASALTPLELKQVANEAASDVLF 65

Query: 65   GKETSTDVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSVVQHVNFKTLKIGSLVLG 124
            G++                                       +V+H++FK L  G+++LG
Sbjct: 66   GRDDGKPAEERPRKKKKTSKASKEDAVAGKEDRT-------DIVEHLSFKGLTSGTVLLG 118

Query: 125  QISEISKTDMCISFTDGLSGYVNLTHISAPFMTIXXXXXXXXXXXXXXXXXXXXXXXXXX 184
            Q+  +++TD+CI+ TDGL GYV LT+ISAPF ++                          
Sbjct: 119  QLCGVNRTDLCIALTDGLRGYVPLTNISAPFTSLLEQLDQSMDSGSEDEDDDSDDEQRDK 178

Query: 185  XXXXXXXXXXXXXIGLPSLENYFKVGQWLRCSVISNTALLPXXXXXXXXXIELSIEPSVV 244
                           LP L  YF +GQWLRC V+ N+AL           IELSIEPS V
Sbjct: 179  PHTITE---------LPELSKYFTLGQWLRCVVVKNSAL--DSQKKKNSRIELSIEPSKV 227

Query: 245  NTLTEEDIVRSASVQCAVKSIEDHGAMLDIGIDGFTGFISKKDYPEFEKLLPGAVFLGNV 304
            N    ED+ +  +VQCAVKSIEDHGA+LD+G+   TGFIS KD  +   ++PG+VFL N+
Sbjct: 228  NLFETEDLAKHTTVQCAVKSIEDHGALLDLGVQDVTGFISNKDLSKMGDVMPGSVFLANI 287

Query: 305  TKKSDRTVTINLDFSDKKAKITHISSVDAVVPGQVVDLLCQTITNNGIVGKTFGLVPSFI 364
            TK+ DRT T+N +F+ K +K++ ISSVDAV+PG  +D LC+ ITN+GI+GK FG++  F+
Sbjct: 288  TKRGDRTATVNFEFTAKNSKVSQISSVDAVIPGHTIDFLCEKITNHGIIGKAFGVLDGFL 347

Query: 365  STAHLRVFKEEELKHNFAVGSNIPCRIIAVLITKENDKTLLLSTLPHIKSLKNVLGEVEN 424
            S +  RVF   ++KH +A+GSNI  RIIA L TK+ +K +L+S LPHI SL+  L E E 
Sbjct: 348  SESQARVFSVTDMKHKYAIGSNIKVRIIATLRTKQGNKVILVSALPHILSLERNLLETEA 407

Query: 425  LTAFPIGHLIDSCTVKGRDSDYLYLAMDDDRVGEVHSSRIGELEKFDKLKARVLGFNSID 484
            + AFP+G++ D+C + GRDS YLY+++ D+R+G++H S+ G+    + +KARV G+N++D
Sbjct: 408  MHAFPVGYVFDNCKLLGRDSQYLYVSLSDERIGQIHISKAGDAITQEAVKARVTGYNTVD 467

Query: 485  NLYELSTDPEILKLKYLRSKDIPIGEVLPNCEITAVSSKGIELKIFNGQFKAIVPPMHIS 544
              Y+L++DP++L   YLRS DIP+G +L  CEITAVS  GIEL +F+GQFKA V P+HIS
Sbjct: 468  GYYQLTSDPKLLAKPYLRSADIPVGTILSGCEITAVSGNGIELSLFDGQFKAFVAPLHIS 527

Query: 545  DTRLVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKTLVNIEDDDIQLLSNFAIAKEIQE 604
            D RLVYPERKFKIGSKVKGRVL+++N+G +YVTLKK+LV+  D DI L+S+F    ++ E
Sbjct: 528  DIRLVYPERKFKIGSKVKGRVLHVDNKGRVYVTLKKSLVSANDSDIPLVSDFEQIAKLAE 587

Query: 605  KNQKTVATVTAFRPSGCIVAFFGGMTAFLPNAEISEVFVRKPEEHLRLGQTIVVKLLKID 664
            ++ KT+ATV +F+PSGC+V F G + AFLPN EISE FV++ ++HLRLGQT+VVK+L+  
Sbjct: 588  EDGKTLATVESFKPSGCVVTFLGNLKAFLPNKEISEAFVQRAQDHLRLGQTVVVKVLEHV 647

Query: 665  QENARMLVTCKISNDQAEKKKETIEKLIPGRSMVKVNVVEKTKDSVIVELPETSLRGVIY 724
             + ++++VT K+S++ +EK+K  I  L+ GRS+V V VVEKTKDSV+VEL +  LRGVIY
Sbjct: 648  AKQSKVIVTRKVSSEDSEKQKAAINDLVVGRSIVDVTVVEKTKDSVVVELNDVGLRGVIY 707

Query: 725  VGHLSDARIEQNRAAIKKIAIGSELKGLVIDKDARTQVFNLSLKQSLIKDAKNEVSPLTY 784
            VGHLSD+++EQNRA +KK+ IGS L+G+V+DKD +T+VFN+S K+SLIKDA  ++ PLT+
Sbjct: 708  VGHLSDSKLEQNRALLKKLRIGSSLQGVVMDKDVKTRVFNMSCKKSLIKDASKDILPLTF 767

Query: 785  ADIKSKSKTTPLHGYIKSISNKGLFVAFNGKFVGLVLPSYAVESRDVDISKTFYINQSVT 844
             DIK K   TP+HGY+KSIS++G+FVAF GKFVGLVLPSYA ESRDVDI K FYINQSVT
Sbjct: 768  VDIKDKDPNTPMHGYVKSISDRGIFVAFTGKFVGLVLPSYATESRDVDIFKKFYINQSVT 827

Query: 845  AYLLRSDDDNERFLLTLRTPST---KDDSSKVTGTETLKPIDPAMKDLKDFTTXXXXXXX 901
             YLLR+D++NERFLLT+  P T   K+DS+       + P+D ++K +  ++        
Sbjct: 828  VYLLRTDEENERFLLTMSPPQTSNKKEDSNH--DVAAVNPVDASVKIISQYSVGTVTKAR 885

Query: 902  XXXXXXNQLNVVLADNLHGRIDIAEVFDSFSDIKNATHPLIDFKKGNIIDAKIIGTHDIK 961
                   QLNVVLADNLHGR+D +E++D+F +I+N   PL  FK G++ID K+IG HD K
Sbjct: 886  VKSVKKTQLNVVLADNLHGRVDASEIYDTFEEIENPKEPLAKFKSGDVIDVKVIGFHDSK 945

Query: 962  SHRFLPISHHAVKGSVLELSLKPSQMRSKDIKTLSISDVAVGDELTGFVNNYGSNTLWLT 1021
            +H+FLPISH     +VLELS K S ++    + +  S +  GDEL GFVNN+    +WLT
Sbjct: 946  THKFLPISHRTGVNTVLELSAKKSALKGA-YQPIEFSGMKNGDELIGFVNNFAKGFIWLT 1004

Query: 1022 VSPTLKAKISLFDLAEDGLKSSEKVEDNFPLGCALPVKVTSIDTEHGVVNVTGRSHTEIS 1081
            +SP LKAKI  F+L++DG   +  ++++FPLGCAL VKV  +D  H +V+V+ R H    
Sbjct: 1005 LSPALKAKIPDFELSDDGSVFTGNLDESFPLGCALKVKVKELDPAHKIVSVSARKHAITD 1064

Query: 1082 FESLKVGDNVPSRIIKIADSYVLLDLGNKIHGIAFITDALDDFSVPLKEAYKGMENDIVS 1141
             + +KV D +P+RI+K+ADSY+LLDLGN++ G+AF+TDAL++FS+ L+  Y+     ++ 
Sbjct: 1065 IKDIKVADKLPARIVKVADSYLLLDLGNRLTGVAFVTDALNEFSLSLRSVYEDKIGSMIL 1124

Query: 1142 AKIVSIDAENKKVNLSLRTESAKTPSISSHTDISQGDVVHGLVKSISDKGIFVYLSRSIN 1201
            A +V +D ENKK+NLSLRTE A    I SH D+ QGDVV G +KS++DKGIFVYLSR++ 
Sbjct: 1125 ASVVGVDVENKKINLSLRTEDATDRYILSHKDLKQGDVVRGFIKSVTDKGIFVYLSRTLQ 1184

Query: 1202 AFVPVSKLSDTYLKDWKKFFKPMQYVIGKVVNAEEDSRILLTLRESEVNGDLKILKNYDD 1261
            AFVPVSKL+D Y+K+WKKF+K MQ + GKVVN E DSRILLT++ESEVNG+LKILK+Y D
Sbjct: 1185 AFVPVSKLTDAYIKEWKKFYKTMQPITGKVVNCESDSRILLTMKESEVNGELKILKSYAD 1244

Query: 1262 IKVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAYV 1321
            +K  +I++GSVKNVTDFGVFVKL NT+NVTGLAH SEI+D K +DL+ LFG GD+VKA +
Sbjct: 1245 LKSGDIFDGSVKNVTDFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAII 1304

Query: 1322 LKVNPEKKQLSLSLKASRF--GNTNESKVEEKETVD-----------ADGDEIMEAVDYN 1368
            LK NPEK Q+SL LKAS F   + +E + E  E+++           +D DE ME ++Y 
Sbjct: 1305 LKTNPEKNQVSLGLKASYFQKAHDDEDEAEPAESIEEANGEEINGEASDEDEAMEDIEYE 1364

Query: 1369 NAPSDNENETEEILETVSKPKISTDGLSLSTGFDWTASILXXXXXXXXXXXXXXFTETKR 1428
            + P+D    + E      K  + T GLSLS GFDWT SIL                 T +
Sbjct: 1365 HTPAD--APSHETSSKAHKEAVPT-GLSLSAGFDWTGSILDPEQGKTMRMSSEDDDFTFK 1421

Query: 1429 NRHKKRKQTIVEDKT-IDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIEKA 1487
               K  K +   D+     +T+APESV DFERLI+GNPNSSVIWMNYMAFQLQLSE+EKA
Sbjct: 1422 KAKKNNKASRCNDRQDCRHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKA 1481

Query: 1488 RELAERALKTINFREESEKQNIWMAMLNLENTFGSDETLEDVFKRACQYMDSFTMHNRLL 1547
            RELAERALKTI+FREE EK NIW+AMLNLENTFG+DETLEDVF+RACQYMD++T+H +L+
Sbjct: 1482 RELAERALKTISFREEHEKLNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLI 1541

Query: 1548 SIYQMSGKIDKAAELFKITAKKFGSENVSIWVSWGDFLTSHGKAQEARGILSNALKALPK 1607
            SIY MS K DKA EL+K  AKKFGSENVS+WVSWG+FL +H +  EAR +L+ ALK+LP+
Sbjct: 1542 SIYAMSSKDDKAVELYKAAAKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPR 1601

Query: 1608 RDHIEVVRKFAQLEFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKKKVEDL 1667
            R HI+VVRKFAQLEFAKGDPE GR+LFEGL+ADAPKRIDIWNVYLDQEIK++ + + + L
Sbjct: 1602 RSHIDVVRKFAQLEFAKGDPEQGRALFEGLLADAPKRIDIWNVYLDQEIKSSNRARADAL 1661

Query: 1668 FERVVSRKITRKQAKFFFNKWLEFEESQNDNKVMEYVKAKATEYVSNHTKEDEAE 1722
            FERV+  K++RKQAKFFFNKWL+  ES +D + +EY+KA+A +YV  H    +AE
Sbjct: 1662 FERVLVAKLSRKQAKFFFNKWLQLAESTDDQRGVEYIKARAADYVRKHDSVPDAE 1716

>KLLA0B08239g 729850..735039 similar to sp|Q05022 Saccharomyces
            cerevisiae YMR229c RRP5 processing of pre-ribosomal RNA,
            start by similarity
          Length = 1729

 Score = 1870 bits (4844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 941/1753 (53%), Positives = 1228/1753 (70%), Gaps = 61/1753 (3%)

Query: 1    MVPPTKRKRDEEFPLAREDATQQPTASSLMRNTEEVSFPRGGSSALTPLELKQVANEAAN 60
            + P +KRKRD+E PL R+DAT+ P  S+L + +EE+SFPRGGSSAL+PLE+KQV NE   
Sbjct: 2    VAPQSKRKRDDESPLVRQDATEAPAKSALSK-SEEISFPRGGSSALSPLEVKQVGNEVVA 60

Query: 61   DVLFGKETSTDVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSVVQHVNFKTLKIGS 120
            DVLFGK+ S   A                               L  ++H   K +  G+
Sbjct: 61   DVLFGKDESATGAEGPTKKKKKNAKNNFDQITTGDDEEKEDKTDL--IEHFGMKQMTKGT 118

Query: 121  LVLGQISEISKTDMCISFTDGLSGYVNLTHISAPFMTIXXXXXXXXXXXXXXXXXXXXXX 180
            +VLGQI  ISK ++ IS  DGL GYV+LT IS     I                      
Sbjct: 119  IVLGQIQSISKHELKISLVDGLHGYVSLTDISEQMTKILENLDESMESDDEKNEDSEYDS 178

Query: 181  XXXXXXXXXXXXXXXXXIGLPSLENYFKVGQWLRCSVISNTALLPXXXXXXXXXIELSIE 240
                               LP L  YFK+GQWLRC V +N+AL           ++LSIE
Sbjct: 179  SDDESDITTPKE-------LPDLNKYFKIGQWLRCMVQNNSAL----ESNKNKKLDLSIE 227

Query: 241  PSVVNTLTEEDIVRSASVQCAVKSIEDHGAMLDIGIDGFTGFISKKDYPEFEKLLPGAVF 300
            PSVVN   ++D+ ++  +QC++KSIEDHGA+LDIGI+  TGFISKKD PEF  LLPG VF
Sbjct: 228  PSVVNVFEDDDLAKNCPLQCSLKSIEDHGAILDIGIENLTGFISKKDIPEFSSLLPGMVF 287

Query: 301  LGNVTKKSDRTVTINLDFSDKKAKITHISSVDAVVPGQVVDLLCQTITNNGIVGKTFGLV 360
            L  VTK+S RTV +NLD + K  K+  ISS+DA+VPGQ +D L QTITN+G++GK FGL+
Sbjct: 288  LATVTKRSGRTVNVNLDLASKNTKVEKISSIDAIVPGQSIDFLPQTITNHGVIGKAFGLI 347

Query: 361  PSFISTAHLRVFKEEELKHNFAVGSNIPCRIIAVLITKENDKTLLLSTLPHIKSLKNVLG 420
             +F+   H   F  E+LKH++++G  +  RI+A  I K  DK  ++ST PHI SL   L 
Sbjct: 348  TAFLPLPHSNFFTVEDLKHHYSIGDLVNARILATTIVKSGDKVAVVSTQPHIISLHPKLQ 407

Query: 421  EVENLTAFPIGHLIDSCTVKGRDSDYLYLAMDDDRVGEVHSSRIGELEKFDKLKARVLGF 480
            E E L +FP+G++ DSCTVKGRDS + Y+++++++VG++H S+ GE E    +KAR+LG+
Sbjct: 408  ETEALESFPVGYIFDSCTVKGRDSQFFYVSINNEQVGQIHLSKAGETEPTGTVKARILGY 467

Query: 481  NSIDNLYELSTDPEILKLKYLRSKDIPIGEVLPNCEITAVSSKGIELKIFNGQFKAIVPP 540
            N++D LY L++DP +L +KYLRS DIP GEVL  CEI  VS KGIELKIFN QFKA VPP
Sbjct: 468  NNVDKLYTLTSDPALLDVKYLRSSDIPAGEVLSACEIVTVSGKGIELKIFNDQFKAFVPP 527

Query: 541  MHISDTRLVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKTLVNIEDDDIQLLSNFAIAK 600
            +HISDTRLVYPERKFKIGSKVKGRVLN+++ G + VTLKK++VN +++ + L+      +
Sbjct: 528  LHISDTRLVYPERKFKIGSKVKGRVLNVDSVGRVTVTLKKSIVNADEESVTLVCKNDDIQ 587

Query: 601  EIQEKNQKTVATVTAFRPSGCIVAFFGGMTAFLPNAEISEVFVRKPEEHLRLGQTIVVKL 660
             ++ +  KT+ TV  F+P+GC+++FF  + AF+PN EISE FV+KP+EHLRLGQ+++VK+
Sbjct: 588  TVESQELKTIGTVEIFKPNGCVISFFNNIKAFVPNKEISEAFVKKPQEHLRLGQSVLVKI 647

Query: 661  LKIDQENARMLVTCKISNDQAEKKKETIEKLIPGRSMVKVNVVEKTKDSVIVELPETSLR 720
            L  D E  R++ +CKIS + + K+K  IE L+ G+S++   V+EKTKDSVIVE  ++ LR
Sbjct: 648  LNHDFERNRIIASCKISAESSSKQKSAIESLVVGKSIIDAIVIEKTKDSVIVESKDSGLR 707

Query: 721  GVIYVGHLSDARIEQNRAAIKKIAIGSELKGLVIDKDARTQVFNLSLKQSLIKDAKNEVS 780
            GVIY GHLSD RIEQNRA+ KK+ I SE++GLV+DKD RT VFN+S K+SLIKDA++   
Sbjct: 708  GVIYTGHLSDDRIEQNRASQKKLKINSEVRGLVLDKDIRTHVFNMSCKKSLIKDAEDGTL 767

Query: 781  PLTYADIKSKSKTTPLHGYIKSISNKGLFVAFNGKFVGLVLPSYAVESRDVDISKTFYIN 840
            PL+++DIK+K KT P+HGY+KS+S++G+FVAFNGKFVGLVLPSYA E+RD+DI K +YIN
Sbjct: 768  PLSFSDIKNKDKTEPMHGYVKSVSDRGVFVAFNGKFVGLVLPSYAAETRDIDIHKKYYIN 827

Query: 841  QSVTAYLLRSDDDNERFLLTLRTPSTKDDSSKVTGTETLKPIDPAMKDLKDFTTXXXXXX 900
            QSVT YLLR+D+++ERFLLT+    T  D  K+  +  + P+D ++KDL DFT       
Sbjct: 828  QSVTVYLLRTDEEHERFLLTILKQKT--DVKKINSS-VINPVDKSIKDLSDFTIGKVTKA 884

Query: 901  XXXXXXXNQLNVVLADNLHGRIDIAEVFDSFSDIKNATHPLIDFKKGNIIDAKIIGTHDI 960
                   NQLNV LADN+HGRI I+EVFDSF DIK    PL  +KK + +  ++IG HDI
Sbjct: 885  TITSVKKNQLNVTLADNVHGRISISEVFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDI 944

Query: 961  KSHRFLPISHHAVKGSVLELSLKPSQMRSKDIKTLSISDVAVGDELTGFVNNYGSNTLWL 1020
            KS +FLPISH   K  ++ELS KPS + S  +    + D        GF+NNY ++T WL
Sbjct: 945  KSRKFLPISHTTSKSHLVELSAKPSSLTSP-VSEKKLKDFTPEQTTFGFINNYSNDTAWL 1003

Query: 1021 TVSPTLKAKISLFDLAEDGLKSSEKVEDNFPLGCALPVKVTSIDTEHGVVNVTGRSHTEI 1080
            T++PT+KAK+ +F+++++G   S  +E+ +P+G A+ V V SIDTEH  + V+ RSH   
Sbjct: 1004 TITPTVKAKLPIFEISDEGHDFSLPIEEKYPIGTAVRVTVKSIDTEHDSLVVSARSHAIS 1063

Query: 1081 SFESLKVGDNVPSRIIKIADSYVLLDLGNKIHGIAFITDALDDFSVPLKEAYKGMENDIV 1140
            S   +K GD +P+R+I + D+YVLL LG  + G++FITDALDD+S+ LK+ Y   + +IV
Sbjct: 1064 SISEIKEGDVLPARVISVQDTYVLLSLGKDVTGVSFITDALDDYSLSLKDVYDSKKKNIV 1123

Query: 1141 SAKIVSIDAENKKVNLSLRTESAKTPSISSHTDISQGDVVHGLVKSISDKGIFVYLSRSI 1200
            SA ++++D +N K+NLSLR+ S K  +I S +++ +GD+V G VKSI+DKG+F+ LS  +
Sbjct: 1124 SATVLNVDIDNNKINLSLRSSSPKDRTIISSSELKRGDIVRGFVKSITDKGVFISLSSVL 1183

Query: 1201 NAFVPVSKLSDTYLKDWKKFFKPMQYVIGKVVNAEEDSRILLTLRESEVNGDLKILKNYD 1260
             AFVPVSKL+D ++KDWKKFF+  Q V+GKVVN + D R+LLTLRESEVNG L +LK+Y 
Sbjct: 1184 QAFVPVSKLTDAFIKDWKKFFRRGQSVVGKVVNCDNDDRVLLTLRESEVNGQLNVLKSYS 1243

Query: 1261 DIKVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAY 1320
            DI V +I+ GSVKNVTDFGVFVKLD TVNVTGLAH SE+AD K ++L +LFG GD+VKA 
Sbjct: 1244 DINVGDIFQGSVKNVTDFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAI 1303

Query: 1321 VLKVNPEKKQLSLSLKASRFGNTNESK-------------VEEKETVDADGDE------- 1360
            VLK NPEKKQ+SL LKAS F N                  V++ +    DG +       
Sbjct: 1304 VLKTNPEKKQISLGLKASYFTNEKPETVEEGNEEEEELEGVDDLDIDMEDGQKESDASDK 1363

Query: 1361 ----------IMEAVDYNNAPSDNENETEEILETVSKPK----ISTDGLSLSTGFDWTAS 1406
                      IM+   + ++ S+ E+ T        +PK    +STDGLSLSTGFDWTAS
Sbjct: 1364 DEDKDEDQDEIMDDAQFGHSDSEAEDTT--------RPKNSAPVSTDGLSLSTGFDWTAS 1415

Query: 1407 ILXXXXXXXXXXXXXXFTETKRNRHKKRKQTIVEDKTIDINTRAPESVADFERLIIGNPN 1466
            IL                   R + KK+ Q IV+DKT+DINTR PESV DFERLI+GNPN
Sbjct: 1416 ILDQAQDEEESSEEDEDFIKSRKQKKKKTQ-IVQDKTVDINTRIPESVGDFERLIMGNPN 1474

Query: 1467 SSVIWMNYMAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNLENTFGSDETL 1526
            SSV+WMNYMAF LQLSE+EKARE+ ERALKTINFREESEK NIW+A LNLENTFG++ET+
Sbjct: 1475 SSVVWMNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNLENTFGTEETV 1534

Query: 1527 EDVFKRACQYMDSFTMHNRLLSIYQMSGKIDKAAELFKITAKKFGSENVSIWVSWGDFLT 1586
            EDVF +ACQYMDSFTMH +LLSIYQMS KI+KA ELFKITAKKFGSE VSIWV+WG+FL 
Sbjct: 1535 EDVFTKACQYMDSFTMHMKLLSIYQMSEKIEKAKELFKITAKKFGSEKVSIWVAWGEFLI 1594

Query: 1587 SHGKAQEARGILSNALKALPKRDHIEVVRKFAQLEFAKGDPEGGRSLFEGLIADAPKRID 1646
             +    EA  +L N+LK+LP R+HIEVVRKFAQLEF+KGDPE GRSLFEGL+ADAPKR+D
Sbjct: 1595 DNNLIDEAHEVLGNSLKSLPTRNHIEVVRKFAQLEFSKGDPEQGRSLFEGLLADAPKRVD 1654

Query: 1647 IWNVYLDQEIKANEKKKVEDLFERVVSRKITRKQAKFFFNKWLEFEESQNDNKVMEYVKA 1706
            +WNVY+DQEIK  EK K EDLFERV+++KITRKQAKFFFNKWL+FEE ++D K+++YVKA
Sbjct: 1655 LWNVYIDQEIKHGEKSKAEDLFERVITKKITRKQAKFFFNKWLQFEEQKDDQKLVDYVKA 1714

Query: 1707 KATEYVSNHTKED 1719
            KA EYV  +   D
Sbjct: 1715 KAAEYVKKNKSAD 1727

>KLLA0F17996g 1645592..1647646 similar to sgd|S0004107 Saccharomyces
            cerevisiae YLR117c CLF1, start by similarity
          Length = 684

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 76/199 (38%), Gaps = 27/199 (13%)

Query: 1457 FERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNL 1516
            +ER ++ +     +W+ Y+  +++   I  AR L +RA   +          +W   L L
Sbjct: 86   YERALLVDHGFIPLWIQYIDSEIKWKNINHARNLLDRATNAL-----PRVDKLWFKYLLL 140

Query: 1517 ENTFGSDETLEDVFKRACQY------MDSFT-MHNRLLSIYQMSGKIDKAAELFKITAKK 1569
            E + G+   +  ++ R C +       DSF     R L+   +     K           
Sbjct: 141  EESLGNQGIVRGIYTRWCSFEPGPDAWDSFIEFETRCLNFENVRNIYSKFV--------- 191

Query: 1570 FGSENVSIWVSWGDFLTSHGKAQEARGILSNALKAL------PKRDHIEVVRKFAQLEFA 1623
                 +  W+ W  F  +HG     R + S AL  L      P  D   V+  FA  E +
Sbjct: 192  LVHPQIDTWLKWVRFEQTHGDISSVRTVFSFALDTLTSFSGTPLVDIERVIGSFASWEAS 251

Query: 1624 KGDPEGGRSLFEGLIADAP 1642
            +G+ E  R+L+   +   P
Sbjct: 252  QGEYERSRTLYRLAVERWP 270

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 1607 KRDHIEVVR--KFAQLEFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKKKV 1664
            KR+ +++ +  ++AQ EF + D    RS++E  +      I +W  Y+D EIK       
Sbjct: 57   KRNRLDLRQWMRYAQFEFDQKDIRRARSIYERALLVDHGFIPLWIQYIDSEIKWKNINHA 116

Query: 1665 EDLFERVVS 1673
             +L +R  +
Sbjct: 117  RNLLDRATN 125

>Scas_713.42
          Length = 699

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 84/205 (40%), Gaps = 36/205 (17%)

Query: 1457 FERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNL 1516
            FER ++ N +   +W+ Y+  +L+L  I  AR L +RA+ T+          +W   L +
Sbjct: 94   FERALLVNNSYIPLWIRYIDAELKLKCINHARNLLDRAITTL-----PRVDKLWYKYLFV 148

Query: 1517 ENTFGSDETLEDVFKRAC----------QYMDSFTMHNRLLSIYQMSGKIDKAAELFKIT 1566
            E +  + + +  +F++ C           Y+D  T  N   ++ ++  K         I 
Sbjct: 149  EESLQNWDVVRSLFRKWCSLEPGINAWKSYVDFETRQNNWNNVREVYSK------YVAIH 202

Query: 1567 AKKFGSENVSIWVSWGDFLTSHGKAQEARGILSNALKALP---------KRDHIEVVRKF 1617
             K      V+ W+SW  F   HG     R + S     L          K D IE    F
Sbjct: 203  PK------VATWLSWVKFEMVHGDVSTIRTVFSLGSDVLNEYEKTDPGFKEDCIEFAIAF 256

Query: 1618 AQLEFAKGDPEGGRSLFEGLIADAP 1642
            A  E ++ + +  R++++ LI   P
Sbjct: 257  ANWEASQMEYDRSRAIYKILIDKWP 281

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 49/271 (18%), Positives = 116/271 (42%), Gaps = 22/271 (8%)

Query: 1470 IWMNYMAF-QLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNLENTFGSDETLED 1528
            +W+ Y+A+ +L +++I   R L ++ +  I   +      IW+     E       T   
Sbjct: 372  LWVRYLAYIELSINDIVSCRNLFKKLINEIIPHKSFTFGKIWIMYSEFEIRQNDIGTARK 431

Query: 1529 VFKRACQYMDSFTMHNRLLSIYQMSGKIDKAAELFKITAKKFGSENVSIWVSWGDFLTSH 1588
            +  R+        +  R + I     + D+   L++    +F   N+  W+++ +   + 
Sbjct: 432  ILGRSLGLCPKPKVFRRYIEIEISLREFDRVRRLYE-KFLEFDPSNLKTWIAYAELEQNL 490

Query: 1589 GKAQEARGIL------SNALKALPKRDHIEVVRKFAQLEFAKGDPEGGRSLFEGLIADAP 1642
               + AR I       +N + ++     + V+++F + E    +    R L+E  +  + 
Sbjct: 491  DDEERARSIFNILLDDANDVISMSDSSKVIVIKRFIEFETDMEEYNNARELYEHYLQLSN 550

Query: 1643 KRIDIWNVY--------LDQEIKANEKKKVEDLFERVVSR--KITRKQAKFFFNKWLEFE 1692
               ++W  Y         D ++KA  +K  E+  E V  +  ++ +++ +  F + L++ 
Sbjct: 551  FSPEVWTSYAMYESATPTDDQLKALREKMDENEDEEVDFKIEEVNKERCRAIFERALKYF 610

Query: 1693 ESQNDNK----VMEYVKAKATEYVSNHTKED 1719
            + Q+D      ++E +K    EY  +HT+++
Sbjct: 611  KEQDDKPKRILMLEALKGYEDEYGDSHTRQE 641

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 66/145 (45%), Gaps = 7/145 (4%)

Query: 1575 VSIWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVRKFAQLEFAKGDPEGGRSLF 1634
            + +W+ + D          AR +L  A+  LP+ D +    K+  +E +  + +  RSLF
Sbjct: 105  IPLWIRYIDAELKLKCINHARNLLDRAITTLPRVDKLWY--KYLFVEESLQNWDVVRSLF 162

Query: 1635 EGLIADAPKRIDIWNVYLDQEIKANEKKKVEDLFERVVSRKITRKQAKFFFNKWLEFEES 1694
                +  P  I+ W  Y+D E + N    V +++ + V+  I  K A +    W++FE  
Sbjct: 163  RKWCSLEPG-INAWKSYVDFETRQNNWNNVREVYSKYVA--IHPKVATWL--SWVKFEMV 217

Query: 1695 QNDNKVMEYVKAKATEYVSNHTKED 1719
              D   +  V +  ++ ++ + K D
Sbjct: 218  HGDVSTIRTVFSLGSDVLNEYEKTD 242

>Kwal_55.21029
          Length = 1105

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 57/93 (61%), Gaps = 5/93 (5%)

Query: 1247 SEVNGDLKILKNYDDIKV-NEIYNGSVKNVTDFGVFVKLDNTVN--VTGLAHNSEIADQK 1303
            S+ + DL I +N D+  V ++IY+GSVK +T FG F+++  T +    GL H SE+A+++
Sbjct: 159  SKTHTDLGI-QNMDESPVLDKIYSGSVKKITTFGCFIRIQGTKDPRCDGLLHISEMANRR 217

Query: 1304 PEDLASLFGVGDRVKAYVLKVNPEKKQLSLSLK 1336
             ED + L  +  +V   V+++    K +SL +K
Sbjct: 218  LEDPSELVSLNQQVYVKVIRIQNNGK-ISLRMK 249

>AGL184W [4128] [Homologous to ScYLR117C (CLF1) - SH]
            complement(350805..352856) [2052 bp, 683 aa]
          Length = 683

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 78/193 (40%), Gaps = 13/193 (6%)

Query: 1457 FERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNL 1516
            FER +   P   V+W+ Y+  +L+  ++  AR L  RA   +          +W   + +
Sbjct: 83   FERALAVAPGDVVVWLRYVDCELRARDVNHARNLLVRATALL-----PRVDKLWYKYVLM 137

Query: 1517 ENTFGSDETLEDVFKRACQYMDSFTMHNRLLSIYQMSGKIDKAAELFKITAKKFGSENVS 1576
            E + G  E +  V+ + C    +    +  +      G+++   E++  +         +
Sbjct: 138  EESLGQVELVRGVYTKWCTLEPAAAAWDAFVDFETRQGQVEHVREVY--SRYVMVHPVAA 195

Query: 1577 IWVSWGDFLTSHGKAQEARGILS---NALKALPKRDHIEV---VRKFAQLEFAKGDPEGG 1630
             W+ W  F   HG A   R + S   + L A    D  EV   V  FA+ E  + + E  
Sbjct: 196  TWLKWVAFERKHGDAGTVRRVYSLACDTLTAFAGADVHEVEQLVVSFAEWEATQQELERS 255

Query: 1631 RSLFEGLIADAPK 1643
            R++    ++  P+
Sbjct: 256  RAVLSVAVSRWPE 268

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 2/69 (2%)

Query: 1607 KRDHIEVVR--KFAQLEFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKKKV 1664
            KR+ ++V +  ++A  E+ + D    RS+FE  +A AP  + +W  Y+D E++A +    
Sbjct: 54   KRNRLDVRQWLRYAAFEYEQRDMRRARSVFERALAVAPGDVVVWLRYVDCELRARDVNHA 113

Query: 1665 EDLFERVVS 1673
             +L  R  +
Sbjct: 114  RNLLVRATA 122

>Kwal_56.23875
          Length = 680

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 62/149 (41%), Gaps = 7/149 (4%)

Query: 1457 FERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNL 1516
            FER +  N     +W+ Y+  +L+   I  AR L +RA    N     EK  +W+  + +
Sbjct: 82   FERALQVNNQYVPLWIKYIDSELKAKNINHARNLLDRA---CNLLPRVEK--LWLKYVIV 136

Query: 1517 ENTFGSDETLEDVFKRACQYMDSFTMHNRLLSIYQMSGKIDKAAELFKITAKKFGSENVS 1576
            E + G+   +  +F R C    S   ++  +      G+ +KA +++        +  V 
Sbjct: 137  EESLGNVSLVRSLFSRWCSLSPSKNAYDAYVGFETRCGEFEKARKVYSGYVSVHPA--VD 194

Query: 1577 IWVSWGDFLTSHGKAQEARGILSNALKAL 1605
             W+ W  F   HG     R + S  L  L
Sbjct: 195  TWLKWVAFEKRHGSLDTTRQVFSLGLDTL 223

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 29/58 (50%)

Query: 1616 KFAQLEFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKKKVEDLFERVVS 1673
            ++A+ E  + D    RS+FE  +    + + +W  Y+D E+KA       +L +R  +
Sbjct: 64   RYAKFEIGQHDMRRARSIFERALQVNNQYVPLWIKYIDSELKAKNINHARNLLDRACN 121

>YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing factor
            of DEAH box family, required for release of mature mRNA
            from the spliceosome [3438 bp, 1145 aa]
          Length = 1145

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 1264 VNEIYNGSVKNVTDFGVFVKLDNTV--NVTGLAHNSEIADQKPEDLASLFGVGDRVKAYV 1321
            ++++Y G V+N+T FG FV++  T   N  GL H SE++DQ+  D   +   G  +   V
Sbjct: 177  LHKVYEGKVRNITTFGCFVQIFGTRMKNCDGLVHISEMSDQRTLDPHDVVRQGQHIFVEV 236

Query: 1322 LKVNPEKKQLSLSLK 1336
            +K+    K +SLS+K
Sbjct: 237  IKIQNNGK-ISLSMK 250

>YBR112C (CYC8) [302] chr2 complement(462826..465726) General
            repressor of RNA polymerase II transcription that is
            brought to target promoters by sequence-specific
            DNA-binding proteins, Sko1p-Ssn6p-Tup1p complex undergoes
            Hog1p-dependent conversion to a transcriptional activator
            [2901 bp, 966 aa]
          Length = 966

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 74/170 (43%), Gaps = 11/170 (6%)

Query: 1457 FERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNL 1516
            +ER ++ NP  S +W       L L ++++A    ++AL  ++         +W  +  L
Sbjct: 103  YERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLS---NPNVPKLWHGIGIL 159

Query: 1517 ENTFGSDETLEDVFKRACQYMDSFTMHN----RLLSIYQMSGKIDKAAELFKITAKKFGS 1572
             + +GS +  E+ F +  +    F   N    RL  IY+  GK  +A E F+    +  +
Sbjct: 160  YDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILPQPPA 219

Query: 1573 --ENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVRKFAQL 1620
              +   IW   G  L S G+ Q A+    + L     + H +V+++   L
Sbjct: 220  PLQEWDIWFQLGSVLESMGEWQGAKEAYEHVLAQ--NQHHAKVLQQLGCL 267

>YLR117C (CLF1) [3530] chr12 complement(382472..384535) Essential
            pre-mRNA splicing factor that plays a role in the
            initiation of DNA replication, has tetratricopeptide
            (TPR) repeats and has similarity to Drosophila crooked
            neck (crn) protein, component of Prp19p-associated
            complex [2064 bp, 687 aa]
          Length = 687

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/195 (18%), Positives = 77/195 (39%), Gaps = 16/195 (8%)

Query: 1457 FERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNL 1516
            FER ++ + +   +W+ Y+  +L++  I  AR L  RA+ T+          +W   L +
Sbjct: 88   FERALLVDSSFIPLWIRYIDAELKVKCINHARNLMNRAISTL-----PRVDKLWYKYLIV 142

Query: 1517 ENTFGSDETLEDVFKRACQYMDSFTMHNRLLSIYQMSGKIDKAAELFKITAKKFGSENVS 1576
            E +  + E +  ++ + C         N  +         +   E++  +        + 
Sbjct: 143  EESLNNVEIVRSLYTKWCSLEPGVNAWNSFVDFEIRQKNWNGVREIY--SKYVMAHPQMQ 200

Query: 1577 IWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEV---------VRKFAQLEFAKGDP 1627
             W+ W  F   HG  +  R + S A+  +    ++++         V  FA  E A+ + 
Sbjct: 201  TWLKWVRFENRHGNTEFTRSVYSLAIDTVANLQNLQIWSDMEVAKLVNSFAHWEAAQQEY 260

Query: 1628 EGGRSLFEGLIADAP 1642
            E   +L++  I   P
Sbjct: 261  ERSSALYQIAIEKWP 275

 Score = 38.1 bits (87), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 3/75 (4%)

Query: 1577 IWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVRKFAQLEFAKGDPEGGRSLFEG 1636
            IW+ +  FL  H    +AR IL  A+   PK    +  + + +LE    + +  R ++E 
Sbjct: 406  IWLMYAKFLIRHDDVPKARKILGKAIGLCPK---AKTFKGYIELEVKLKEFDRVRKIYEK 462

Query: 1637 LIADAPKRIDIWNVY 1651
             I   P  + IW+ Y
Sbjct: 463  FIEFQPSDLQIWSQY 477

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 66/143 (46%), Gaps = 7/143 (4%)

Query: 1572 SENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVRKFAQLEFAKGDPEGGR 1631
            S  + +W+ + D          AR +++ A+  LP+ D +    K+  +E +  + E  R
Sbjct: 96   SSFIPLWIRYIDAELKVKCINHARNLMNRAISTLPRVDKLWY--KYLIVEESLNNVEIVR 153

Query: 1632 SLFEGLIADAPKRIDIWNVYLDQEIKANEKKKVEDLFERVVSRKITRKQAKFFFNKWLEF 1691
            SL+    +  P  ++ WN ++D EI+      V +++ + V   +   Q + +  KW+ F
Sbjct: 154  SLYTKWCSLEPG-VNAWNSFVDFEIRQKNWNGVREIYSKYV---MAHPQMQTWL-KWVRF 208

Query: 1692 EESQNDNKVMEYVKAKATEYVSN 1714
            E    + +    V + A + V+N
Sbjct: 209  ENRHGNTEFTRSVYSLAIDTVAN 231

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 6/98 (6%)

Query: 1616 KFAQLEFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKKKVEDLFERVVSRK 1675
            ++AQ E  + D    RS+FE  +      I +W  Y+D E+K        +L  R +S  
Sbjct: 70   RYAQFEIEQHDMRRARSIFERALLVDSSFIPLWIRYIDAELKVKCINHARNLMNRAIS-- 127

Query: 1676 ITRKQAKFFFNKWLEFEESQNDNKVMEYVKAKATEYVS 1713
             T  +    + K+L  EES N+   +E V++  T++ S
Sbjct: 128  -TLPRVDKLWYKYLIVEESLNN---VEIVRSLYTKWCS 161

>KLLA0B09262g 814303..817128 some similarities with sp|P14922
            Saccharomyces cerevisiae YBR112c CYC8 general repressor
            of transcription singleton, hypothetical start
          Length = 941

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 62/145 (42%), Gaps = 9/145 (6%)

Query: 1457 FERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNL 1516
            ++R +  NP    IW       L L E++ A    ++AL  ++         +W  +  L
Sbjct: 165  YQRALSANPELGDIWATLGHCYLMLDELQNAYAAYQQALYHLS---NPNIPKLWHGIGIL 221

Query: 1517 ENTFGSDETLEDVFKRACQYMDSFTMHN----RLLSIYQMSGKIDKAAELFKITAKKFGS 1572
             + +GS +  E+ F +  +    F   N    RL  IY+  GK ++A E F+    +  +
Sbjct: 222  YDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILPQPPA 281

Query: 1573 --ENVSIWVSWGDFLTSHGKAQEAR 1595
              +   +W   G  L S G+ Q AR
Sbjct: 282  PLQEWDVWFQLGSVLESMGEWQGAR 306

>Scas_705.55
          Length = 907

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 92/229 (40%), Gaps = 17/229 (7%)

Query: 1457 FERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNL 1516
            +ER +  NP  S +W       L L ++++A    ++AL  ++         +W  +  L
Sbjct: 113  YERALSINPELSDVWATLGHCYLMLDDLQRAYNSYQQALYHLS---NPNVPKLWHGIGIL 169

Query: 1517 ENTFGSDETLEDVFKRACQYMDSFTMHN----RLLSIYQMSGKIDKAAELFKITAKKFGS 1572
             + +GS +  E+ F +  +    F   N    RL  IY+  GK  +A E F+    +  +
Sbjct: 170  YDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWTQALECFRYILNQPPA 229

Query: 1573 --ENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVRKFAQLEFAKG----D 1626
              +   IW   G  L S  + Q AR    + L  L   +H +V+++   L         D
Sbjct: 230  PLQEWDIWFQLGSVLESMNEWQGAREAYEHVL--LQNENHAKVLQQLGCLYGMNNVSFYD 287

Query: 1627 PEGG-RSLFEGLIADAPKRIDIWNVYLDQEIKANEKKKVEDLFERVVSR 1674
            P+     L + L  D P     W       +  N+     D F++ V+R
Sbjct: 288  PQKALNYLLKSLEVD-PNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNR 335

>Kwal_23.3670
          Length = 802

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 98/244 (40%), Gaps = 17/244 (6%)

Query: 1386 SKPKISTDGLSLSTGFDWTASILXXXXXXXXXXXXXXFTET-KRNRHKKRKQTIVED--K 1442
            S+P ++ D L+ ST   W +                 +  T + N    +  T +    +
Sbjct: 52   SQPPLAVDPLTQSTAETWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYR 111

Query: 1443 TIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINFRE 1502
            + D+  RA E    ++R +  NP    IW       L L ++++A    ++AL  ++   
Sbjct: 112  SRDMFQRAAEL---YQRALTVNPELGDIWATLGHCYLMLDDLQRAYAAYQQALYHLS--- 165

Query: 1503 ESEKQNIWMAMLNLENTFGSDETLEDVFKRACQYMDSFTMHN----RLLSIYQMSGKIDK 1558
                  +W  +  L + +GS +  E+ F +  +    F   N    RL  IY+  GK ++
Sbjct: 166  NPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQ 225

Query: 1559 AAELFK--ITAKKFGSENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVRK 1616
            A E F+  +T      +   +W   G  L S  + Q AR    + L  L    H +V+++
Sbjct: 226  ALECFRYILTQPPAPLQEWDVWFQLGSVLESMSEWQGAREAYEHVL--LQNERHAKVLQQ 283

Query: 1617 FAQL 1620
               L
Sbjct: 284  LGCL 287

>ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH]
            complement(103567..106299) [2733 bp, 910 aa]
          Length = 910

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 70/160 (43%), Gaps = 12/160 (7%)

Query: 1442 KTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINFR 1501
            ++ D+  RA E    ++R +  NP    +W       L L ++++A    ++AL  ++  
Sbjct: 107  RSRDVFQRAAEL---YQRALAVNPELGDVWATLGHCYLMLDDLQRAYAAYQQALYHLS-- 161

Query: 1502 EESEKQNIWMAMLNLENTFGSDETLEDVFKRACQYMDSFTMHN----RLLSIYQMSGKID 1557
                   +W  +  L + +GS +  E+ F +  +    F   N    RL  IY+  GK +
Sbjct: 162  -NPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKVNEIYFRLGIIYKHQGKWN 220

Query: 1558 KAAELFKITAKKFGS--ENVSIWVSWGDFLTSHGKAQEAR 1595
            +A E F+    +  +  +   +W   G  L S G+ Q AR
Sbjct: 221  QALECFRYILPQPPAPLQEWDVWFQLGSVLESMGEWQGAR 260

>CAGL0D02376g complement(244241..246328) similar to tr|Q12309
            Saccharomyces cerevisiae YLR117c CLF1, start by
            similarity
          Length = 695

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 83/218 (38%), Gaps = 54/218 (24%)

Query: 1471 WMNYMAFQLQLSEIEKARELAERALKT--------INFREESEK-------QNI------ 1509
            WM Y  F+++  ++ +AR + ERAL+         I + E   K       +NI      
Sbjct: 64   WMRYAVFEIEQHDMRRARSIFERALRVHISYVPLWIRYIESELKLGYINHARNILERAIT 123

Query: 1510 --------WMAMLNLENTFGSDETLEDVFKRAC------QYMDSFTMHNRLLSIYQMSGK 1555
                    W   L +E +    + + ++F++ C         DSFT             +
Sbjct: 124  KLPRVDKLWYKYLIVEESLAHFDIVRNLFQKWCSLEPAAHVWDSFT---------DFEVR 174

Query: 1556 IDKAAELFKITAKK-FGSENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKR------ 1608
             ++  ++  I +K        S W  W +F   +G  +  R + S AL AL         
Sbjct: 175  QERYEDVRNIYSKYVLIHPQFSTWRKWINFEVRYGSTKTVRSVYSLALDALIAYSESRNE 234

Query: 1609 ---DHIEVVRKFAQLEFAKGDPEGGRSLFEGLIADAPK 1643
               D I ++ +F++ E  + +    +SL E  I   PK
Sbjct: 235  LVDDCINLIVEFSKWEALQKEYIRSKSLLEIAIQKWPK 272

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 3/79 (3%)

Query: 1577 IWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVRKFAQLEFAKGDPEGGRSLFEG 1636
            IW+ + +F       ++AR IL  +L   PKR   +  + +  LE    + +  R L+E 
Sbjct: 402  IWILYAEFEIRQDNLEKARSILGRSLGLCPKR---KTFKYYIDLETKLREFDRVRILYEN 458

Query: 1637 LIADAPKRIDIWNVYLDQE 1655
             +   P  +D W  Y++ E
Sbjct: 459  FLKFDPLNLDTWRAYVEFE 477

>CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces
            cerevisiae YBR112c CYC8 general repressor of
            transcription, hypothetical start
          Length = 1148

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 70/170 (41%), Gaps = 11/170 (6%)

Query: 1457 FERLIIGNPNSSVIWMNYMAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNL 1516
            +E  +  NP  S +W       L L ++++A    ++AL  ++         +W  +  L
Sbjct: 105  YECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLS---NPNVPKLWHGIGIL 161

Query: 1517 ENTFGSDETLEDVFKRACQYMDSFTMHN----RLLSIYQMSGKIDKAAELFK--ITAKKF 1570
             + +GS +  E+ F +  +    F   N    RL  IY+  GK  +A E F+  +     
Sbjct: 162  YDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILAQPPT 221

Query: 1571 GSENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVRKFAQL 1620
              +   IW   G  L S G+ Q AR    + L  L    H +V ++   L
Sbjct: 222  PLQEWDIWFQLGSVLESMGEWQGAREAYEHVL--LQNDHHAKVFQQLGCL 269

>KLLA0B11638g complement(1020591..1023926) similar to sp|P24384
            Saccharomyces cerevisiae YER013w PRP22 pre-mRNA splicing
            factor, start by similarity
          Length = 1111

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 7/50 (14%)

Query: 1264 VNEIYNGSVKNVTDFGVFVKL---DNTVNVTGLAHNSEIADQ---KPEDL 1307
            ++++Y G V+NVT FG FV++    NT NV GL H SE++     KPED+
Sbjct: 178  LDKVYPGKVQNVTKFGCFVRIFGVRNT-NVDGLVHVSELSSSHVDKPEDV 226

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 12/96 (12%)

Query: 610 VATVTAFRPSGCIVAFFG----GMTAFLPNAEISEVFVRKPEEHLRLGQTIVVKLLKIDQ 665
           V  VT F   GC V  FG     +   +  +E+S   V KPE+ +   Q + VK++KI Q
Sbjct: 186 VQNVTKF---GCFVRIFGVRNTNVDGLVHVSELSSSHVDKPEDVVHRNQDVFVKVIKI-Q 241

Query: 666 ENARMLVTCK----ISNDQAEKKKETIEKLIPGRSM 697
            N ++ +  K     +  +A  +  T EK+IP R +
Sbjct: 242 NNGKISLAMKGIDQSTGMEAATRGRTKEKVIPKRKL 277

>YJR007W (SUI2) [2909] chr10 (450934..451848) Translation initiation
            factor eIF2alpha subunit [915 bp, 304 aa]
          Length = 304

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 48/89 (53%), Gaps = 2/89 (2%)

Query: 1263 KVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAYVL 1322
            ++++I   +V+ + + G +VKL    N+ G+   SE++ ++   +  L  VG    A VL
Sbjct: 15   EIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVL 74

Query: 1323 KVNPEKKQLSLSLKASRFGNTNESKVEEK 1351
            +V+ EK  + LS +  R  + +  K EEK
Sbjct: 75   RVDKEKGYIDLSKR--RVSSEDIIKCEEK 101

>Scas_479.2
          Length = 302

 Score = 37.0 bits (84), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%)

Query: 1263 KVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAYVL 1322
            +V++I   +V+ + + G +VKL    N+ G+   SE++ ++   +  L  VG    A VL
Sbjct: 15   EVDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVL 74

Query: 1323 KVNPEKKQLSLS 1334
            +V+ EK  + LS
Sbjct: 75   RVDKEKGYIDLS 86

>Scas_617.9
          Length = 302

 Score = 37.0 bits (84), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%)

Query: 1263 KVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAYVL 1322
            +V++I   +V+ + + G +VKL    N+ G+   SE++ ++   +  L  VG    A VL
Sbjct: 15   EVDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVL 74

Query: 1323 KVNPEKKQLSLS 1334
            +V+ EK  + LS
Sbjct: 75   RVDKEKGYIDLS 86

>Kwal_33.15422
          Length = 302

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 1263 KVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAYVL 1322
            +V+++   +V+ + + G +VKL    N+ G+   SE++ ++   +  L  VG      VL
Sbjct: 15   EVDDVVMVNVQQIAEMGAYVKLLEYDNIEGMVLLSELSRRRIRSIQKLIRVGRNEVVVVL 74

Query: 1323 KVNPEKKQLSLSLKASRFGNTNESKVEEK 1351
            +V+ EK  + LS +  R  + +  K EE+
Sbjct: 75   RVDKEKGYIDLSKR--RVSSEDIMKCEER 101

>AGR320W [4631] [Homologous to ScYJR007W (SUI2) - SH]
            complement(1330185..1331093) [909 bp, 302 aa]
          Length = 302

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 1263 KVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAYVL 1322
            +V+++   +V+ + + G +VKL    N+ G+   SE++ ++   +  L  VG      VL
Sbjct: 15   EVDDVVMVNVQQIAEMGAYVKLLEYDNIEGMVLLSELSRRRIRSIHKLIRVGKNEVVVVL 74

Query: 1323 KVNPEKKQLSLSLKASRFGNTNESKVEEK 1351
            +V+ EK  + LS +  R  + +  K EE+
Sbjct: 75   RVDKEKGYIDLSKR--RVSSEDMIKCEER 101

>CAGL0B03795g 376266..377177 highly similar to sp|P20459 Saccharomyces
            cerevisiae YJR007w SUI2, translation initiation factor
            eIF2, start by similarity
          Length = 303

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 2/79 (2%)

Query: 1273 KNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAYVLKVNPEKKQLS 1332
            + + + G +VKL    N+ G+   SE++ ++   +  L  VG    A VL+V+ EK  + 
Sbjct: 25   QQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYID 84

Query: 1333 LSLKASRFGNTNESKVEEK 1351
            LS +  R  + +  K EEK
Sbjct: 85   LSKR--RVSSEDIIKCEEK 101

>AAR020W [206] [Homologous to ScYER013W (PRP22) - SH]
            complement(376250..379588) [3339 bp, 1112 aa]
          Length = 1112

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 8/76 (10%)

Query: 1265 NEIYNGSVKNVTDFGVFVK-LDNTVNVTGLAHNSEIADQK---PEDLASLFGVGDRVKAY 1320
             +IY   ++N+  FG F + L    +  GL H S+++  +   P D+ S   VGD V   
Sbjct: 183  GKIYRAVIRNIKPFGCFARVLGTKRSCEGLIHISQLSHSRVGSPNDVVS---VGDHVYVK 239

Query: 1321 VLKVNPEKKQLSLSLK 1336
            + KV    K LSLS++
Sbjct: 240  ITKVQDNGK-LSLSMR 254

>KLLA0D11814g complement(1007240..1009021) similar to sp|P39073
            Saccharomyces cerevisiae YPL042c SSN3 cyclin-dependent
            CTD kinase, start by similarity
          Length = 593

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 51/114 (44%), Gaps = 13/114 (11%)

Query: 1556 IDKAAELFKITAKKFGSENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKRDHIEVVR 1615
            ID   E  ++       +N++ W     + T+ GK + A  IL   L+  P +  I+ + 
Sbjct: 429  IDSYPEYLQLAKMPKYRDNLTAW-----YQTAGGKDKTALDILYRLLQYDPIK-RIDAID 482

Query: 1616 KFAQLEFAKGDPEGGRSLFEGL-IADAPKRI-----DIWNVYLDQEIKANEKKK 1663
                + F  GDP    ++FEGL     P+RI     DI NV  D   +AN  +K
Sbjct: 483  ALDHVYFTNGDPPVCENVFEGLNYKYPPRRIHTNDNDITNVGNDNN-QANHSQK 535

>Sklu_2440.18 YDR416W, Contig c2440 29476-31950
          Length = 824

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 94/233 (40%), Gaps = 26/233 (11%)

Query: 1471 WMNYMAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNLENTFGSDETLEDVF 1530
            W  Y    +   + + ARE+ +RA + + +    + +++W+    +E      E    V 
Sbjct: 429  WCRYAKLYINKQDYDTAREIFDRATR-VPYSHLIDLEDVWICWAEMELDIDGLEKAALVI 487

Query: 1531 KRACQYMDSFTMHNRLLSIYQMSGKIDKAAELFKITAKKFGSENVSIWVSWGDFLTSHGK 1590
            K A +   S  +   +L  YQ S K +  A+    ++ K       +W  + D L S   
Sbjct: 488  KTALKVPQSPEL---VLEKYQRSKKRELPAQTVVFSSLK-------LWSFYLDLLESTCD 537

Query: 1591 AQEA----RGILSNALK---ALPKRDHIEVVRKFAQLEFAKGDPEGGRSLFEGLIADAPK 1643
             ++A    R     A+    A P      +   +A     +   E    ++E  I   P 
Sbjct: 538  NKDAIPSTRAAYEQAISLKIATPL-----IFINYAHFLQEQKLWEESFKIYERAIDTFPS 592

Query: 1644 --RIDIWNVYLDQEIKAN-EKKKVEDLFERVVSRKITRKQAKFFFNKWLEFEE 1693
                +IWN+YL + +K    K+++ DLFE+ +         K F+  + +FEE
Sbjct: 593  DTSFEIWNIYLAEGLKNGLSKERMRDLFEQAMKLAQDGLDCKPFYTLYSDFEE 645

>ACR104C [1151] [Homologous to ScYPL131W (RPL5) - SH]
           (541333..542226) [894 bp, 297 aa]
          Length = 297

 Score = 33.1 bits (74), Expect = 1.9,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 7/78 (8%)

Query: 784 YADIKSKSKTTP--LHGYIKSISNKGLFVAFN-GKFVGLVLPSYAVESRDVDISKTFYIN 840
           Y DI  +  TT   + G +K  S+ GL+V  +  +F G     +  E  D D+ +T+   
Sbjct: 145 YLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRFPGW---DFESEELDADLLRTYIFG 201

Query: 841 QSVTAYLLR-SDDDNERF 857
             V+AY+   +DDD ER+
Sbjct: 202 GHVSAYMEELADDDEERY 219

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
            Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 1477 FQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNLEN----TFGSDETLEDVFKR 1532
            + L LS+    + +  R LKT+ F   + KQ I   +LNL N    TF   +  + + + 
Sbjct: 537  YWLILSDNSNVKPINSRILKTVQFMPLNNKQLIENCLLNLLNEPKETFNWYKYKKLLKRW 596

Query: 1533 ACQYMDSFTMHNRLLSIYQMS 1553
               +MD   + +RL+S YQ+S
Sbjct: 597  VTIWMDDNDIFSRLISHYQLS 617

>KLLA0A01969g complement(178458..180854) similar to sgd|S0002824
            Saccharomyces cerevisiae YDR416w SYF1 synthetic lethal
            with CDC40, start by similarity
          Length = 798

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 96/226 (42%), Gaps = 22/226 (9%)

Query: 1470 IWMNYMAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNLENTFGSDETLEDV 1529
            +W  Y   +L   +IEK+  L ++A   + F+   + +N+W+        +    +++D 
Sbjct: 414  LWCQYC--RLFEEDIEKSEVLLDKA-TNVPFKFLVDLENVWLYWCE----YRLKRSIDDA 466

Query: 1530 FKRACQYMDSFTMHNRLLSIYQMSGKIDKAAELFKITAKKFGSENVSIWVSWGDFLTSHG 1589
             K     ++    H  LL  ++  G+    A +F  ++K+       +W  + D L   G
Sbjct: 467  IKVLSVVLEIPDNHELLLQKFE-KGESPAQAAIF--SSKR-------LWAMYLDLLEVKG 516

Query: 1590 KAQEARGILSNALKALPKRDHIEVVRKFAQLEFAKGDPEGGRSLFEGLIADAPKRID--I 1647
                A      A+  L K     +   +A L  + G      ++FE  +   P  +   I
Sbjct: 517  NYGTAVNAYETAI--LIKAATPAMFINYALLNESSGHQAEALAVFERSVEIFPPSVSKSI 574

Query: 1648 WNVYLDQEIKAN-EKKKVEDLFERVVSRKITRKQAKFFFNKWLEFE 1692
            W++YLD  +KA+  K++  D+FE  +    +      FF K+ +FE
Sbjct: 575  WDIYLDVALKADITKEQKRDIFESAIKLAASGVACVSFFEKYSDFE 620

>KLLA0D06941g complement(598560..599453) highly similar to sp|P26321
           Saccharomyces cerevisiae YPL131w RPL1 60S large subunit
           ribosomal protein L5.e singleton, start by similarity
          Length = 297

 Score = 31.6 bits (70), Expect = 5.4,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 7/78 (8%)

Query: 784 YADIKSKSKTT--PLHGYIKSISNKGLFVAFN-GKFVGLVLPSYAVESRDVDISKTFYIN 840
           Y D+  +  TT   + G +K  S+ GL+V  +  +F G     +  E  D D+ +T+   
Sbjct: 145 YLDVGLQRTTTGARIFGALKGASDGGLYVPHSENRFPGW---DFEAEELDADLLRTYIFG 201

Query: 841 QSVTAYLLR-SDDDNERF 857
             V+ Y+   +DDD ER+
Sbjct: 202 GHVSQYMEELADDDEERY 219

>Scas_570.11
          Length = 858

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 45/219 (20%), Positives = 95/219 (43%), Gaps = 17/219 (7%)

Query: 1472 MNYMAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNLENTFGSDETLEDVFK 1531
            +NY  F    + I ++ ++ ERA+       + E  NI++A +    +  S E + ++F+
Sbjct: 600  INYSHFLQHHNMIMESYQIYERAIPLFTAETQYELWNIYLAEVVNPLSPLSKEHIRELFE 659

Query: 1532 RACQYMDSFTMHNRLLSIY-----QMSGKIDKAAELFKITAKKFGSENVSIWVSWGDFLT 1586
             A + +  F +  + + I      +  G + ++ ++    A+  G   + +    G +  
Sbjct: 660  HAIRTLLPFGIDCKSIFILYSDFEEKQGLLKRSVDILWKGAQTNGQGTIHLKSRLGLWNL 719

Query: 1587 SHGKAQE------ARGILSNALKALPKRDHIEVVRKFAQLEFAKGDPEGGRSLFE---GL 1637
               KAQ       +R I  + ++ +P       +  FA  E + G+    R + E    L
Sbjct: 720  CLFKAQSHLGLSVSRQIYEDCIQQVPNSKSAPYIIGFADAETSGGEITRSREILEYGARL 779

Query: 1638 IADAPKRIDIWNVYLDQEIKANEKKKVEDLFERVVSRKI 1676
            I  A K   +WN +   E+K  +K+  +D+ +  + RK+
Sbjct: 780  IPPA-KNTSLWNYWETFELKHGDKETYKDMLK--LKRKL 815

>Scas_719.13
          Length = 995

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 5/110 (4%)

Query: 545 DTRLVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKTLVNIEDDDIQLLSNFA-IAKEIQ 603
           D R   P     I  K+    L++ N  L   TL   L+N    D+Q  ++ A +   + 
Sbjct: 548 DDRFWQPRGHIYISFKLPHTHLSLLNSML--TTLYVQLINDSLKDLQYDASCANLHASLT 605

Query: 604 EKNQKTVATVTAFRPSGCIVA--FFGGMTAFLPNAEISEVFVRKPEEHLR 651
           + NQ    TV+ F     I+   F  G+ +F PN++  ++F  K  +HL+
Sbjct: 606 KTNQGLDITVSGFNDKLIILLTRFLQGIKSFKPNSDRFQIFKDKTIQHLQ 655

>Scas_686.19
          Length = 663

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 12/92 (13%)

Query: 346 TITNN--GIVGKTFGLVPSFISTAHLRVFKEEELKH--------NFAVGSNIPCRIIAVL 395
           +ITN+   ++ K    +PS++ T  L+ F  +  K         +F + + I C I   +
Sbjct: 444 SITNHSSAVLRKELEELPSYLLTTFLQTFLSKNCKQPNEEIRMVSFTLFTRILCLIPEAV 503

Query: 396 ITKENDKTLLLSTLPHIKSLKNVLGEVENLTA 427
             K   +TL  S+ PH+KS  +VLG +++L +
Sbjct: 504 TFKFILETLTASSYPHVKS--SVLGILKDLMS 533

>Scas_557.7
          Length = 450

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 6/69 (8%)

Query: 1182 GLVKSISDKGIFV-YLSRSINAFV--PVSKLSDTYLKDWKKFFKPMQYVIG---KVVNAE 1235
            GLVK ++ + + V    R I  F+  P +   +T LK W++F KP+ Y  G   +VV A+
Sbjct: 63   GLVKPLAQEALPVDKKPRKITVFIAPPPNDYLETSLKIWRRFIKPVLYYSGLDYEVVEAD 122

Query: 1236 EDSRILLTL 1244
                I + +
Sbjct: 123  RQGIIRMKV 131

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 52,245,340
Number of extensions: 2278881
Number of successful extensions: 8763
Number of sequences better than 10.0: 78
Number of HSP's gapped: 8891
Number of HSP's successfully gapped: 126
Length of query: 1722
Length of database: 16,596,109
Length adjustment: 116
Effective length of query: 1606
Effective length of database: 12,580,421
Effective search space: 20204156126
Effective search space used: 20204156126
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)