Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_594.1226726713980.0
KLLA0B08371g26826610811e-150
Sklu_1578.326826610461e-145
YMR226C26726610451e-145
Kwal_26.916026726610321e-143
CAGL0M11242g2682669991e-138
AFR561W2672679341e-128
KLLA0E09834g2682172285e-22
Kwal_14.15112772102041e-18
KLLA0D15521g2561992031e-18
ABR248W2611922013e-18
Kwal_14.24442881982014e-18
ABR249W2501931994e-18
YIL124W (AYR1)2971961953e-17
ABR247W2502141933e-17
Sklu_268.12442381837e-16
CAGL0G08690g2941831779e-15
Scas_628.62522061732e-14
AER373C3001981733e-14
CAGL0F06919g2501941705e-14
Sklu_2348.52892011707e-14
Scas_662.43072381709e-14
Scas_685.82521941618e-13
YIR035C2541941573e-12
ABR246W2501941539e-12
YIR036C2631981531e-11
AGL060W8911971552e-11
KLLA0F04455g3051981512e-11
Sklu_2380.41601651463e-11
Kwal_23.31072481971503e-11
KLLA0D02596g3472001496e-11
Scas_721.473442091497e-11
CAGL0F06897g2581961468e-11
Kwal_34.160242922071362e-09
Kwal_55.195692882001344e-09
ACR171C2511921326e-09
YNL202W (SPS19)2952721311e-08
ABL163W2922741311e-08
KLLA0E08063g1861491253e-08
KLLA0E13860g8891961303e-08
Kwal_26.79508971961285e-08
Kwal_55.218222832071257e-08
CAGL0L02167g9012031261e-07
KLLA0E24046g2802091212e-07
KLLA0B09812g3462061212e-07
CAGL0J04774g3382081195e-07
Kwal_47.171022852261151e-06
YBR159W3472121152e-06
Kwal_23.45723002561123e-06
ADR059C3512041115e-06
YKL055C (OAR1)2781221097e-06
Sklu_1570.17561561091e-05
YKL071W2562271062e-05
Scas_666.17*2832101062e-05
YKR009C (FOX2)9001931082e-05
Scas_675.103122641062e-05
CAGL0H07513g3522151062e-05
YBR265W (TSC10)3202651052e-05
Sklu_2267.53502061043e-05
Scas_613.182861371026e-05
CAGL0I09328g363871027e-05
AAL089W3282041018e-05
KLLA0C12694g259117982e-04
YDL114W308203982e-04
KLLA0D18909g290207982e-04
Kwal_26.8838323118982e-04
Scas_652.19d1344131982e-04
Scas_478.2920157992e-04
Sklu_1624.3316258964e-04
Scas_641.31287181954e-04
Scas_652.19d341152955e-04
Kwal_27.11910184108926e-04
YLR426W326204938e-04
Kwal_27.12155280161929e-04
ADL292C329244910.001
AEL164C30750910.001
Sklu_2219.3363209890.003
KLLA0A11352g314228870.004
ABR076C271114840.011
AER111W327190840.011
Sklu_2404.1330155790.040
Scas_650.8326177770.088
Kwal_34.16139315235760.10
CAGL0K09152g327122760.11
CAGL0M13013g270126671.2
KLLA0D06127g330234671.4
Sklu_2420.5326119671.4
Scas_566.11346244671.4
KLLA0B04994g39893671.6
YLR100W (ERG27)347121662.1
KLLA0F01749g31354643.0
CAGL0H08019g42538634.2
ACL140C25390624.6
ACR164C86852634.8
Kwal_27.1130170083618.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_594.12
         (267 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_594.12                                                           543   0.0  
KLLA0B08371g complement(747517..748323) highly similar to sp|Q05...   421   e-150
Sklu_1578.3 YMR226C, Contig c1578 1774-2580                           407   e-145
YMR226C (YMR226C) [4182] chr13 complement(721592..722395) NADP+-...   407   e-145
Kwal_26.9160                                                          402   e-143
CAGL0M11242g complement(1105723..1106529) highly similar to sp|Q...   389   e-138
AFR561W [3753] [Homologous to ScYMR226C - SH] complement(1438981...   364   e-128
KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7 Ent...    92   5e-22
Kwal_14.1511                                                           83   1e-18
KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcin...    83   1e-18
ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...    82   3e-18
Kwal_14.2444                                                           82   4e-18
ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...    81   4e-18
YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacet...    80   3e-17
ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...    79   3e-17
Sklu_268.1 , Contig c268 57-791 reverse complement                     75   7e-16
CAGL0G08690g complement(822798..823682) similar to sp|P40471 Sac...    73   9e-15
Scas_628.6                                                             71   2e-14
AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH] (1327314..1...    71   3e-14
CAGL0F06919g complement(677473..678225) similar to sp|P40579 Sac...    70   5e-14
Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement       70   7e-14
Scas_662.4                                                             70   9e-14
Scas_685.8                                                             67   8e-13
YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member ...    65   3e-12
ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...    64   9e-12
YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reducta...    64   1e-11
AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH] complement(...    64   2e-11
KLLA0F04455g complement(428010..428927) similar to sp|P40471 Sac...    63   2e-11
Sklu_2380.4 YIR035C, Contig c2380 9858-10340                           61   3e-11
Kwal_23.3107                                                           62   3e-11
KLLA0D02596g join(complement(219682..219797),complement(218659.....    62   6e-11
Scas_721.47                                                            62   7e-11
CAGL0F06897g complement(675416..676192) highly similar to sp|P40...    61   8e-11
Kwal_34.16024                                                          57   2e-09
Kwal_55.19569                                                          56   4e-09
ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH] (6...    55   6e-09
YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal 2,4-di...    55   1e-08
ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH] complement(...    55   1e-08
KLLA0E08063g complement(726232..726792) some similarities with s...    53   3e-08
KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces...    55   3e-08
Kwal_26.7950                                                           54   5e-08
Kwal_55.21822                                                          53   7e-08
CAGL0L02167g 253055..255760 highly similar to sp|Q02207 Saccharo...    53   1e-07
KLLA0E24046g complement(2136583..2137425) similar to ca|CA3771|C...    51   2e-07
KLLA0B09812g complement(856799..857839) similar to sp|P38286 Sac...    51   2e-07
CAGL0J04774g join(452094..452179,452259..453189) similar to tr|Q...    50   5e-07
Kwal_47.17102                                                          49   1e-06
YBR159W (YBR159W) [344] chr2 (558641..559684) Major 3-ketoreduct...    49   2e-06
Kwal_23.4572                                                           48   3e-06
ADR059C [1800] [Homologous to ScYBR159W - SH] (811943..812998) [...    47   5e-06
YKL055C (OAR1) [3204] chr11 complement(334966..335802) 3-Oxoacyl...    47   7e-06
Sklu_1570.1 YKR009C, Contig c1570 100-2370                             47   1e-05
YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with sim...    45   2e-05
Scas_666.17*                                                           45   2e-05
YKR009C (FOX2) [3265] chr11 complement(453995..456697) Multifunc...    46   2e-05
Scas_675.10                                                            45   2e-05
CAGL0H07513g 734835..735893 highly similar to sp|P38286 Saccharo...    45   2e-05
YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine re...    45   2e-05
Sklu_2267.5 YNL202W, Contig c2267 5903-6955                            45   3e-05
Scas_613.18                                                            44   6e-05
CAGL0I09328g 898234..899325 similar to sp|P38342 Saccharomyces c...    44   7e-05
AAL089W [98] [Homologous to ScYOR246C - SH] complement(184564..1...    44   8e-05
KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces...    42   2e-04
YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the shor...    42   2e-04
KLLA0D18909g complement(1592628..1593500) similar to sp|P32573 S...    42   2e-04
Kwal_26.8838                                                           42   2e-04
Scas_652.19d1                                                          42   2e-04
Scas_478.2                                                             43   2e-04
Sklu_1624.3 YBR265W, Contig c1624 1338-2288                            42   4e-04
Scas_641.31                                                            41   4e-04
Scas_652.19d                                                           41   5e-04
Kwal_27.11910                                                          40   6e-04
YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109) M...    40   8e-04
Kwal_27.12155                                                          40   9e-04
ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [...    40   0.001
AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH] (326834..3...    40   0.001
Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement         39   0.003
KLLA0A11352g complement(983428..984372) similar to sp|P50167 Pic...    38   0.004
ABR076C [667] [Homologous to ScYKL055C (OAR1) - SH] (527756..528...    37   0.011
AER111W [2616] [Homologous to ScYLR426W - SH] complement(846805....    37   0.011
Sklu_2404.13 YKL055C, Contig c2404 24100-25005                         35   0.040
Scas_650.8                                                             34   0.088
Kwal_34.16139                                                          34   0.10 
CAGL0K09152g 909456..910439 highly similar to tr|Q08651 Saccharo...    34   0.11 
CAGL0M13013g complement(1281291..1282103) similar to sp|P35731 S...    30   1.2  
KLLA0D06127g complement(526164..527156) similar to sgd|S0005772 ...    30   1.4  
Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement        30   1.4  
Scas_566.11                                                            30   1.4  
KLLA0B04994g complement(453048..454244) some similarities with s...    30   1.6  
YLR100W (ERG27) [3516] chr12 (341811..342854) 3-Keto sterol redu...    30   2.1  
KLLA0F01749g complement(163821..164762) similar to sp|P38342 Sac...    29   3.0  
CAGL0H08019g 781773..783050 highly similar to sp|P40160 Saccharo...    29   4.2  
ACL140C [909] [Homologous to ScYGR214W (RPS0A) - SH; ScYLR048W (...    28   4.6  
ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH] (640832..64...    29   4.8  
Kwal_27.11301                                                          28   8.8  

>Scas_594.12
          Length = 267

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/267 (100%), Positives = 267/267 (100%)

Query: 1   MSQGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVI 60
           MSQGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVI
Sbjct: 1   MSQGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVI 60

Query: 61  EAKYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDV 120
           EAKYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDV
Sbjct: 61  EAKYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDV 120

Query: 121 KGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTE 180
           KGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTE
Sbjct: 121 KGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTE 180

Query: 181 SLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLEADDVADLIVYTT 240
           SLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLEADDVADLIVYTT
Sbjct: 181 SLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLEADDVADLIVYTT 240

Query: 241 SRKQNTVIADTLIFPTSQGSAFHVHRD 267
           SRKQNTVIADTLIFPTSQGSAFHVHRD
Sbjct: 241 SRKQNTVIADTLIFPTSQGSAFHVHRD 267

>KLLA0B08371g complement(747517..748323) highly similar to sp|Q05016
           Saccharomyces cerevisiae YMR226c, start by similarity
          Length = 268

 Score =  421 bits (1081), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 205/266 (77%), Positives = 232/266 (87%)

Query: 1   MSQGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVI 60
           MSQG KAAERL  K +FITGASAGIGQATALEY+DA+NG VKL+L ARRL KL++LKE I
Sbjct: 1   MSQGRKAAERLQNKTIFITGASAGIGQATALEYLDAANGNVKLILAARRLAKLEELKEKI 60

Query: 61  EAKYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDV 120
            A+YP++KVYIG+LDVTE E IQPF+DNLPEEFKDIDILINNAGKALGSD VG I  +D+
Sbjct: 61  NAEYPQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDI 120

Query: 121 KGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTE 180
           KGM+DTNV+ LINVTQAVL IF+ KNSGDIVNLGSVAGRDAYPTGSIYCASK AVRAFT+
Sbjct: 121 KGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQ 180

Query: 181 SLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLEADDVADLIVYTT 240
           SLR+ELINT IRVI IAPG VETEFS+VRYKGD +RAK VY G  PL ADD+ADLIVY T
Sbjct: 181 SLRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYADDIADLIVYAT 240

Query: 241 SRKQNTVIADTLIFPTSQGSAFHVHR 266
           SRK NTVIAD L+F ++Q S +H++R
Sbjct: 241 SRKPNTVIADVLVFASNQASPYHIYR 266

>Sklu_1578.3 YMR226C, Contig c1578 1774-2580
          Length = 268

 Score =  407 bits (1046), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/266 (74%), Positives = 229/266 (86%)

Query: 1   MSQGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVI 60
           MSQG +AAERL  K VFITGASAGIGQATALEY DASNG + LVL ARRLEKLQ+LK+ I
Sbjct: 1   MSQGRRAAERLANKTVFITGASAGIGQATALEYCDASNGKINLVLSARRLEKLQELKDKI 60

Query: 61  EAKYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDV 120
             +YP++KVYIG LDVTE E I+PFLD LPEEFKDIDILINNAGKALGSD VG I  +D+
Sbjct: 61  TKEYPEAKVYIGVLDVTETEKIKPFLDGLPEEFKDIDILINNAGKALGSDPVGTIKTEDI 120

Query: 121 KGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTE 180
           +GM++TNVL LIN+TQAVL IF+ KN GDIVNLGSVAGRDAYPTG+IYCASK AVRAFT+
Sbjct: 121 EGMINTNVLALINITQAVLPIFKAKNFGDIVNLGSVAGRDAYPTGAIYCASKHAVRAFTQ 180

Query: 181 SLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLEADDVADLIVYTT 240
           SLR+EL+NT IRVI IAPG VETEFS+VRYKGD +RAK VY+G +PL ADD+ADLIVY T
Sbjct: 181 SLRKELVNTNIRVIEIAPGNVETEFSLVRYKGDTDRAKKVYEGTNPLYADDIADLIVYAT 240

Query: 241 SRKQNTVIADTLIFPTSQGSAFHVHR 266
           SRK NTVIAD L+F ++Q S +H++R
Sbjct: 241 SRKPNTVIADVLVFASNQASPYHIYR 266

>YMR226C (YMR226C) [4182] chr13 complement(721592..722395)
           NADP+-dependent L-allo-threonine dehydrogenase, member
           of the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases [804 bp, 267
           aa]
          Length = 267

 Score =  407 bits (1045), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 194/266 (72%), Positives = 233/266 (87%)

Query: 1   MSQGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVI 60
           MSQG KAAERL +K V ITGASAGIG+ATALEY++ASNG +KL+L ARRLEKL++LK+ I
Sbjct: 1   MSQGRKAAERLAKKTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTI 60

Query: 61  EAKYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDV 120
           + ++P +KV++ +LD+T+ E I+PF++NLP+EFKDIDIL+NNAGKALGSDRVG I  +D+
Sbjct: 61  DQEFPNAKVHVAQLDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDI 120

Query: 121 KGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTE 180
           + + DTNV  LIN+TQAVL IFQ KNSGDIVNLGS+AGRDAYPTGSIYCASKFAV AFT+
Sbjct: 121 QDVFDTNVTALINITQAVLPIFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTD 180

Query: 181 SLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLEADDVADLIVYTT 240
           SLR+ELINTKIRVILIAPG+VETEFS+VRY+G+ E+AK+VY    PL ADDVADLIVY T
Sbjct: 181 SLRKELINTKIRVILIAPGLVETEFSLVRYRGNEEQAKNVYKDTTPLMADDVADLIVYAT 240

Query: 241 SRKQNTVIADTLIFPTSQGSAFHVHR 266
           SRKQNTVIADTLIFPT+Q S  H+ R
Sbjct: 241 SRKQNTVIADTLIFPTNQASPHHIFR 266

>Kwal_26.9160
          Length = 267

 Score =  402 bits (1032), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 193/266 (72%), Positives = 228/266 (85%)

Query: 1   MSQGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVI 60
           MSQG KA+ERL  K V ITGASAGIGQATALEY+DASNG +KL+L ARRLEKL+++K   
Sbjct: 1   MSQGRKASERLAGKTVLITGASAGIGQATALEYLDASNGNIKLILAARRLEKLKEIKSQF 60

Query: 61  EAKYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDV 120
           E  +P++KVYIG+LDVT  + I+PF+DNLPEEFKDIDILINNAGKALGSD VG ID  D+
Sbjct: 61  EKDFPEAKVYIGQLDVTHTDEIKPFIDNLPEEFKDIDILINNAGKALGSDPVGTIDASDI 120

Query: 121 KGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTE 180
           +GM+ TNV+ LIN+TQAVL IF+ KN+GDIVNLGSVAGR+AYPTGSIYCA+K AVRAFT+
Sbjct: 121 EGMIQTNVVALINMTQAVLPIFKAKNAGDIVNLGSVAGREAYPTGSIYCATKHAVRAFTQ 180

Query: 181 SLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLEADDVADLIVYTT 240
           SLR+ELINT IRVI IAPG VETEFS+VRYKGD E+AK VY+G  PL ADD+ADLIVY T
Sbjct: 181 SLRKELINTNIRVIEIAPGNVETEFSLVRYKGDPEKAKKVYEGTTPLYADDIADLIVYAT 240

Query: 241 SRKQNTVIADTLIFPTSQGSAFHVHR 266
           SRK NTVIAD L+F ++Q S +H++R
Sbjct: 241 SRKSNTVIADVLVFASNQASPYHIYR 266

>CAGL0M11242g complement(1105723..1106529) highly similar to
           sp|Q05016 Saccharomyces cerevisiae YMR226c, start by
           similarity
          Length = 268

 Score =  389 bits (999), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 193/266 (72%), Positives = 232/266 (87%)

Query: 1   MSQGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVI 60
           MSQG KAAERL  KI FITGASAGIG+ATA+EY+DASNG+VKLVL ARR+EKL++LK+ +
Sbjct: 1   MSQGRKAAERLQGKIAFITGASAGIGKATAIEYLDASNGSVKLVLGARRMEKLEELKKEL 60

Query: 61  EAKYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDV 120
            A+YP +K++IGKLDVT+ E ++ FL +LPEEFKDIDILINNAGKALGSD+VGDID +D+
Sbjct: 61  LAQYPDAKIHIGKLDVTDFENVKQFLADLPEEFKDIDILINNAGKALGSDKVGDIDPEDI 120

Query: 121 KGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTE 180
            GM++TNVL LIN+TQ +L +F+KKNSGDIVNLGS+AGRDAYPTG+IYCA+K AVRAFT+
Sbjct: 121 AGMVNTNVLALINLTQLLLPLFKKKNSGDIVNLGSIAGRDAYPTGAIYCATKHAVRAFTQ 180

Query: 181 SLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLEADDVADLIVYTT 240
           SLR+ELINT IRVI IAPG+VETEFSVVRYKGD  +A  VY G  PL ADD+ADLIVY+T
Sbjct: 181 SLRKELINTDIRVIEIAPGMVETEFSVVRYKGDKSKADDVYRGTTPLYADDIADLIVYST 240

Query: 241 SRKQNTVIADTLIFPTSQGSAFHVHR 266
           SRK N V+AD L+FPT Q SA H++R
Sbjct: 241 SRKPNMVVADVLVFPTHQASASHIYR 266

>AFR561W [3753] [Homologous to ScYMR226C - SH]
           complement(1438981..1439784) [804 bp, 267 aa]
          Length = 267

 Score =  364 bits (934), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 167/267 (62%), Positives = 223/267 (83%)

Query: 1   MSQGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVI 60
           MS G KAAERL  KIV +TGASAGIG+ATA+ Y DA++G +KL+LVARR EKL  LK+ I
Sbjct: 1   MSLGRKAAERLANKIVLVTGASAGIGRATAINYADATDGAIKLILVARRAEKLTSLKQEI 60

Query: 61  EAKYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDV 120
           E+KYP +K+++G+LDVT+L+ I+PFL+ LPEEF+DIDILINNAGKALG++RVG+I + D+
Sbjct: 61  ESKYPNAKIHVGQLDVTQLDQIRPFLEGLPEEFRDIDILINNAGKALGTERVGEISMDDI 120

Query: 121 KGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTE 180
           + + +TNV+GL+++TQ VL I + KNSGDIVN+GS+AGR+AYP GSIYCA+K AV+AFT 
Sbjct: 121 QEVFNTNVIGLVHLTQEVLPIMKAKNSGDIVNVGSIAGREAYPGGSIYCATKHAVKAFTR 180

Query: 181 SLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLEADDVADLIVYTT 240
           ++R+ELI+TKIRV  IAPG VETEFS+VR +G+ E AK VY G  PL+ DD+AD IVY T
Sbjct: 181 AMRKELISTKIRVFEIAPGSVETEFSMVRMRGNEENAKKVYQGFEPLDGDDIADTIVYAT 240

Query: 241 SRKQNTVIADTLIFPTSQGSAFHVHRD 267
           SR+ NTV+A+ +++P++QGS +  HR+
Sbjct: 241 SRRSNTVVAEMVVYPSAQGSLYDTHRN 267

>KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7
           Enterobacter cloacae Putative oxidoreductase, start by
           similarity
          Length = 268

 Score = 92.4 bits (228), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 108/217 (49%), Gaps = 21/217 (9%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASN---GTVKLVLVARRLEKLQQLKEVIEAKYPKS 67
           + ++++ ITGAS GIG + A     A     GT +   +  +    + +K          
Sbjct: 1   MKKQVILITGASTGIGLSIAETLRSAGYEVFGTSRKGSIPGKEYSFKMIK---------- 50

Query: 68  KVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTN 127
                 LD+T+ E+++  ++ + E+   ID+L+NNAG A     V +      K + +TN
Sbjct: 51  ------LDITDEESVKSAVNEVIEKAGRIDVLVNNAGIAFKWAAVEECSTDLAKTIFETN 104

Query: 128 VLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELI 187
             G+  +T+AVL   +++  G I+N+ S+ G    P G++YC+SK A+  +TESL  E+ 
Sbjct: 105 FFGVHRMTRAVLPHMREQRHGKIINISSMGGIMPIPYGALYCSSKHALEGYTESLDYEVK 164

Query: 188 NTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGV 224
              I V  I P I++T  +      D E A  VYD +
Sbjct: 165 KFGIHVSTIDPHIIKTGMANSNSPADEEMA--VYDSI 199

>Kwal_14.1511
          Length = 277

 Score = 83.2 bits (204), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 113/210 (53%), Gaps = 24/210 (11%)

Query: 14  KIVFITGASAGIGQATALEYMDASNG-TVKLVLVARRLEKLQQ-LKEVIEAKYP-KSKVY 70
           K + ITGA+ GIG+A A++   A  G  + +  + ++ EK Q  LKE+ E +   K+ ++
Sbjct: 3   KTILITGAAQGIGKAIAVDL--ARKGYQLAIADLPQQNEKAQAVLKEIKELQSGVKAPIF 60

Query: 71  IGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLG 130
           +  +DV+  E++   +D +   F   D++INNAG A+ + ++ +   +++  +M  NV G
Sbjct: 61  L-PIDVSNKESVFGVVDKVASHFGAFDVMINNAGIAMVA-KILEATPEELDRIMKINVGG 118

Query: 131 LINVTQAVLHIF-----------------QKKNSGDIVNLGSVAGRDAYPTGSIYCASKF 173
           ++  TQA    F                  KK +G I+N  S+AG +A  +  +YC+SKF
Sbjct: 119 VLYGTQAATRKFVELNRAGDYTPATVKTASKKLTGKIINCCSIAGNEAIGSLGLYCSSKF 178

Query: 174 AVRAFTESLRRELINTKIRVILIAPGIVET 203
           AV+  T++  +EL    I V   APGIV T
Sbjct: 179 AVKCLTQASAKELAPLGITVNAYAPGIVLT 208

>KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcina
           acetivorans Cyclohexanol dehydrogenase, start by
           similarity
          Length = 256

 Score = 82.8 bits (203), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 101/199 (50%), Gaps = 18/199 (9%)

Query: 14  KIVFITGASAGIGQ--ATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYI 71
           KI  +TGAS G+G+  A AL    A+     +V+ +R L ++Q+    I+   P     I
Sbjct: 9   KIALVTGASTGVGEGIARALFVRGAT-----VVITSRHLSEVQETAGNID---PSGSRVI 60

Query: 72  GK-LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVG--DIDIKDVKGMMDTNV 128
           GK +DVT  + ++  +  + EEF  +  L+NNAG   G  + G  D DI   + ++DTN+
Sbjct: 61  GKEVDVTVAKAVEDLIQEIREEFGALHYLVNNAG-ITGPHQTGIEDYDIDSWRQVIDTNI 119

Query: 129 LGLINVTQAVLHIFQKKNSGD----IVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRR 184
            G     +  L + +  +S D    +VNL +V G    P  S Y A+K AV   T+S+  
Sbjct: 120 NGTFYTLKYALPLMESSSSPDSEAAVVNLSAVNGLVGIPGISPYTATKHAVIGITQSVAL 179

Query: 185 ELINTKIRVILIAPGIVET 203
           E     +RV  +APG V T
Sbjct: 180 EYAERNVRVNAVAPGYVST 198

>ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(859663..860448) [786 bp, 261 aa]
          Length = 261

 Score = 82.0 bits (201), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 101/192 (52%), Gaps = 11/192 (5%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           K++ +TGAS GIG AT       S   V +V VAR   KLQ+LK    A++ K   Y+  
Sbjct: 13  KVIIVTGASRGIGAATVDRL--CSTPEVVVVGVARAETKLQELK----ARHGKKFDYVVG 66

Query: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133
            DVT+   +Q  +D +   +  +D ++ NAG A G +R+ D DIK+ + + + N+  ++N
Sbjct: 67  -DVTDERVVQAVIDKVSSGYGRLDAVVANAGVA-GHERIEDADIKEWRRLFEINLFSVVN 124

Query: 134 VTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKIRV 193
           +    L +  +K+ G  + + S+  +   P  + Y +SK A+  F   L  E    +IR 
Sbjct: 125 LASKALPLL-RKSQGAFLVVSSMLSQMGVPAVATYASSKIALNHFAMILAME--EPEIRT 181

Query: 194 ILIAPGIVETEF 205
           I + PG+ +T+ 
Sbjct: 182 IALDPGVAQTDM 193

>Kwal_14.2444
          Length = 288

 Score = 82.0 bits (201), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 107/198 (54%), Gaps = 18/198 (9%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           K+  +TGAS+GIG    L    AS G  K+   ARR ++L+ L +    ++P+  V + K
Sbjct: 5   KVAVVTGASSGIGYE--LTRQLASKG-YKVYAAARREQRLETLAK----EFPELVVPV-K 56

Query: 74  LDVTELETIQPFLDNLPEEF--KDIDILINNAGKAL---GSDRVGDIDIKDVKGMMDTNV 128
           LDV+E E I    + L +E   + +D+L NNAG++     SD   D+    ++     NV
Sbjct: 57  LDVSEPEQIIHLRERLAKELPSQKLDVLYNNAGQSCTFPASDVTNDV----LEQAFKVNV 112

Query: 129 LGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELIN 188
            G +N+ + +L  F  K  G ++  GSVAG   +P GSIY A+K A+ ++   L  E+  
Sbjct: 113 FGPVNLCKELLP-FVIKAKGTVLFTGSVAGLMPFPFGSIYSATKGAIHSYARCLHTEMKP 171

Query: 189 TKIRVILIAPGIVETEFS 206
             +RV+ +  G V+T+ +
Sbjct: 172 FGVRVLNVVTGGVKTDIA 189

>ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(861237..861989) [753 bp, 250 aa]
          Length = 250

 Score = 81.3 bits (199), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 103/193 (53%), Gaps = 11/193 (5%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           K++ +TGAS GIG AT       S   V +V VAR   KLQ+LK    A++ K   Y+  
Sbjct: 2   KVIIVTGASRGIGAATVDRL--CSTPDVVVVGVARAETKLQELK----ARHGKKFDYVVG 55

Query: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133
            DVT+   +Q  +D +  E+  +D ++ NAG +    R+ + DIK+ + + + N+  ++N
Sbjct: 56  -DVTDERVVQAVIDKVSSEYGRLDAVVANAGVSY-QQRIAEADIKEWRRLFEINLFSVVN 113

Query: 134 VTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKIRV 193
           +    L +  +K+ G  + + S   +  +P  + Y +SK A+  F   L  E   T+IR 
Sbjct: 114 LASKALPLL-RKSQGAFIAVTSGLSQMGHPALAAYASSKIALNHFALILAME--ETEIRS 170

Query: 194 ILIAPGIVETEFS 206
           + + PG+V+T+ +
Sbjct: 171 LALDPGLVQTDMT 183

>YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacetone
           phosphate reductase [894 bp, 297 aa]
          Length = 297

 Score = 79.7 bits (195), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 97/196 (49%), Gaps = 11/196 (5%)

Query: 13  EKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIG 72
           +KI  +TGAS GIG     E   A NG + +   ARRLE + QL   I+      K Y  
Sbjct: 9   KKIAVVTGASGGIGYEVTKEL--ARNGYL-VYACARRLEPMAQL--AIQFGNDSIKPY-- 61

Query: 73  KLDVTELETIQPFLDNLPEEFKD--IDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLG 130
           KLD+++ E I  F   L     D  +D+L NNAG++     +   D   V+     NV G
Sbjct: 62  KLDISKPEEIVTFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATDAA-VEQCFKVNVFG 120

Query: 131 LINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTK 190
            IN+ +  L  F  K  G IV  GS+AG  ++P GSIY ASK A+  +   L  E+    
Sbjct: 121 HINMCRE-LSEFLIKAKGTIVFTGSLAGVVSFPFGSIYSASKAAIHQYARGLHLEMKPFN 179

Query: 191 IRVILIAPGIVETEFS 206
           +RVI    G V T+ +
Sbjct: 180 VRVINAITGGVATDIA 195

>ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(858589..859341) [753 bp, 250 aa]
          Length = 250

 Score = 79.0 bits (193), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 111/214 (51%), Gaps = 11/214 (5%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           ++V +TGAS GIG+AT  +    ++  V +V VAR   KLQ+LK    A++ K   Y+  
Sbjct: 2   RVVIVTGASRGIGEATVEKLCPTAD--VVVVGVARAETKLQKLK----ARHGKKFDYVVG 55

Query: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133
            DVT+   +Q  +D +  E+  +D ++ NAG +   +R+   DIK+ + + + N+  ++N
Sbjct: 56  -DVTDERVVQAVIDKVSSEYGRLDAVVANAGVSR-HERIATADIKEWRRLFEINLFSVVN 113

Query: 134 VTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKIRV 193
           +    L +  +++ G ++ + S   +  +P  + Y +SK A+  F   L  E    +IR 
Sbjct: 114 LVSKALPLL-RESQGTVIVVSSGLSQMGHPALAAYASSKIALNHFALILAME--EPEIRT 170

Query: 194 ILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPL 227
           I + PG V+T+         +E A S  + V  L
Sbjct: 171 IALDPGAVQTDMLAEGINAADEAAGSQDNAVREL 204

>Sklu_268.1 , Contig c268 57-791 reverse complement
          Length = 244

 Score = 75.1 bits (183), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 115/238 (48%), Gaps = 18/238 (7%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQL--KEVIEAKYPKSK 68
           L+ + V +TGA++GIG+A   + +      +   L  + L  L++      +   YP   
Sbjct: 2   LSNRKVIVTGAASGIGKAIVNQCLQEGASVIACDLNEQALLVLKESLNDSTVLDTYP--- 58

Query: 69  VYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNV 128
                +DV + E +  F   +  E  D+D L+NNAG  L +  + D    ++  ++D NV
Sbjct: 59  -----MDVRKYEEVAAFFAYVETEHSDVDGLVNNAGIYL-AKHILDYQEDEIDKVLDINV 112

Query: 129 LGLINVTQAV-LHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELI 187
            G I  +Q     +F  +  G IVNL SV+G++   + +IY +SK A+   T+S      
Sbjct: 113 KGYIYFSQMFGKKLFHSQRKGVIVNLSSVSGQEG-SSDAIYGSSKAAILGLTKSCAMNF- 170

Query: 188 NTKIRVILIAPGIVETEF--SVVRYKGDNERAKSVYDGVHPLEADDVADLIVYTTSRK 243
           +  IRV  +AP +V T    S+  ++     +  + D   P+  +DVAD +V+  S K
Sbjct: 171 SPYIRVNAVAPTMVNTSMMDSIPEWRKKEYLSHQLIDT--PVLPEDVADTVVFLLSDK 226

>CAGL0G08690g complement(822798..823682) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 294

 Score = 72.8 bits (177), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 90/183 (49%), Gaps = 11/183 (6%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           K+  +TGAS+GIG     E   A  G  K+   ARR   ++ L       + K  +    
Sbjct: 8   KVAVVTGASSGIGYEVTKEL--ARKG-FKVFACARRTAPIEPLVN----SFGKELIVPHH 60

Query: 74  LDVTELETIQPFLDNLPEEFKD--IDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGL 131
           LD++EL+ +  F + L  E  +  +DIL NNAG++     + D+    ++     NV G 
Sbjct: 61  LDISELDEVLKFKEFLASELPEQKLDILYNNAGQSCTFPAL-DVSNDVMEQCFKVNVFGH 119

Query: 132 INVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKI 191
           IN+T+ +   +     G ++  GS+AG    P GSIY A+K A+  +  +L  EL    +
Sbjct: 120 INMTRELAQ-YLINAKGTVIFTGSIAGFSTLPFGSIYAATKAAIHEYARTLHLELKPFGV 178

Query: 192 RVI 194
           RVI
Sbjct: 179 RVI 181

>Scas_628.6
          Length = 252

 Score = 71.2 bits (173), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 106/206 (51%), Gaps = 10/206 (4%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVY 70
           ++ K++ +TG S GIG+A   + +  ++  V +  +AR    L++LK    +K+ +   Y
Sbjct: 1   MSPKVIIVTGVSRGIGRAIVNKIIGLNSNAV-VFGIARTSAPLKELK----SKHGEKFFY 55

Query: 71  IGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLG 130
           I   DVT    ++  +    ++F  +D ++ NAG       VG +D +  K + D N   
Sbjct: 56  IVG-DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFS 114

Query: 131 LINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTK 190
           ++++ Q+ L   +  N  + V + S A   AY   + Y ASK A+ +F  S+  E    K
Sbjct: 115 IVSLVQSTLPFMENTNR-NYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE--KPK 171

Query: 191 IRVILIAPGIVETEFSV-VRYKGDNE 215
           ++ I +APG+V+T+  V +R K  NE
Sbjct: 172 VKTISVAPGVVDTQMQVDIREKYGNE 197

>AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH]
           (1327314..1328216) [903 bp, 300 aa]
          Length = 300

 Score = 71.2 bits (173), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 97/198 (48%), Gaps = 11/198 (5%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           K+V +TGAS+GIG     E   A+ G V +   AR +E ++ L++    K    KV   +
Sbjct: 15  KVVLVTGASSGIGYELTKEL--ANRGYV-VYAAARSIEPIEALRD----KCGPEKVIPVQ 67

Query: 74  LDVTELETIQPFLDNLPEEFK--DIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGL 131
           LDVT+ E +      + +E     +  L NNAG++     V D+  + ++     NV   
Sbjct: 68  LDVTDEEQVTKLRRRMSKEIPGGKLHALFNNAGQSCTMPAV-DVTPEMIEKCFRVNVFAP 126

Query: 132 INVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKI 191
           +N+T+    +  + + G IV  GS+AG   +P GS+Y A+K AV  +   L  EL    +
Sbjct: 127 MNITREFAPLLIRAH-GTIVFTGSLAGIIPFPFGSVYSATKAAVHQYARVLHLELKPFGV 185

Query: 192 RVILIAPGIVETEFSVVR 209
           RVI    G V T  +  R
Sbjct: 186 RVINAVTGGVATNIADTR 203

>CAGL0F06919g complement(677473..678225) similar to sp|P40579
           Saccharomyces cerevisiae YIR035c or sp|P40580
           Saccharomyces cerevisiae YIR036c, start by similarity
          Length = 250

 Score = 70.1 bits (170), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 99/194 (51%), Gaps = 11/194 (5%)

Query: 13  EKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIG 72
           +K+V +TGAS GIG+A     +   +  V +  +AR  + L+ LK+ + A++     Y+ 
Sbjct: 2   KKVVLVTGASRGIGEAIVKNILALDSNAV-VYGIARNEDALKSLKDTVGARFQ----YLA 56

Query: 73  KLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLI 132
             D+T+ + I   ++ +  E   ID ++ NAG      +VG   + + K + D N   +I
Sbjct: 57  G-DITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSII 115

Query: 133 NVTQAVL-HIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKI 191
           ++    L H+  +K+ G+ + + S A    Y     Y +SK AV   T SL  E  N  I
Sbjct: 116 HLINKTLPHL--EKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE--NKAI 171

Query: 192 RVILIAPGIVETEF 205
           + I +APG+V+T+ 
Sbjct: 172 KTIAVAPGVVDTKM 185

>Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement
          Length = 289

 Score = 70.1 bits (170), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 99/201 (49%), Gaps = 12/201 (5%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVY 70
           L +K+  +TGAS+GIG    +  + AS G   +   ARR   ++ L+E    ++P+ KV 
Sbjct: 2   LEKKVALVTGASSGIGYE--ITKLLASKGYT-VYAAARRTTPIKPLEE----EFPE-KVI 53

Query: 71  IGKLDVTELETIQPFLDNLPEEFKD--IDILINNAGKALGSDRVGDIDIKDVKGMMDTNV 128
              LDV++L+ IQ        +  D  + IL NNAG++     V D+    ++     NV
Sbjct: 54  AVSLDVSDLQQIQDLKARFSRDLPDSKLHILYNNAGQSCTFPAV-DVGNDKIEQCFKVNV 112

Query: 129 LGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELIN 188
            G +N+ +  +  F     G IV  GS+AG   +P GSIY ++K A+  +   L  E+  
Sbjct: 113 FGPMNLCRE-MSDFVINARGTIVFTGSLAGIVPFPFGSIYSSTKAAIHQYARVLHVEMKP 171

Query: 189 TKIRVILIAPGIVETEFSVVR 209
             ++VI    G V T  +  R
Sbjct: 172 FGVKVINAITGGVATNIADTR 192

>Scas_662.4
          Length = 307

 Score = 70.1 bits (170), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 114/238 (47%), Gaps = 25/238 (10%)

Query: 12  NEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRL----EKLQQLKEVIEAKYPKS 67
           + K   +TGAS+GIG     E   A NG + +   ARRL    + +  L   +  +  K+
Sbjct: 8   SRKTAIVTGASSGIGYEITKEL--ARNGFI-VYACARRLGPIDDLINDLAPELTTELAKA 64

Query: 68  KVYIGKLDVTELETIQPFLDNLPEEFKD--IDILINNAGKALGSDRVGDIDIKDVKGMMD 125
            +   +LD+++ + ++ F   L +E  +  +D+L NNAG++     + D+    ++    
Sbjct: 65  VIKPYQLDISKEDEVKQFRVFLEKELPNGKLDLLYNNAGQSCTFPAL-DVTNDVMEQCFK 123

Query: 126 TNVLGLINVTQAVL-HIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRR 184
            NV G +N+ + +  ++ Q +  G IV  GS+AG   +P GSIY A+K A+  +   L  
Sbjct: 124 VNVFGHVNMCRELASYLIQAR--GTIVFTGSLAGITPFPFGSIYSATKAAIHEYARVLHL 181

Query: 185 ELINTKIRVILIAPGIVETEFSVVRYKGDN------------ERAKSVYDGVHPLEAD 230
           E+    +RVI +  G V T  +  R   D+            E  +S+    HP+ AD
Sbjct: 182 EMKPFGVRVINVVTGGVATNIADTRPLPDDSVYNFPEGRKAFEYRQSMAKNHHPMPAD 239

>Scas_685.8
          Length = 252

 Score = 66.6 bits (161), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 93/194 (47%), Gaps = 9/194 (4%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           K++ +TG S GIG++        S+  + +  +AR    L+ LKE    ++     Y+  
Sbjct: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAI-VYGIARSEAPLKALKETYGDRF----FYVTG 57

Query: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133
            D+T+   +Q  +D   +E   ID ++ NAG       V  IDI   K + D N   +++
Sbjct: 58  -DITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVS 116

Query: 134 VTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKIRV 193
           +T   L  + KK +G+IV + S A    + +   Y ASK  +  F  ++  E     ++ 
Sbjct: 117 LTSITLP-YLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVKC 173

Query: 194 ILIAPGIVETEFSV 207
           + +APGIV+T   V
Sbjct: 174 LSVAPGIVDTSMQV 187

>YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member of
           the short-chain alcohol dehydrogenase family [765 bp,
           254 aa]
          Length = 254

 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 94/194 (48%), Gaps = 9/194 (4%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           K++ +TG S GIG++           TV +  VAR    L++LKE    KY     Y+  
Sbjct: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTV-VYGVARSEAPLKKLKE----KYGDRFFYVVG 57

Query: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133
            D+TE   ++  ++   +    ID L+ NAG       V +ID+   K + D N   +++
Sbjct: 58  -DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVS 116

Query: 134 VTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKIRV 193
           +    L   +K N G++V + S A    + +   Y +SK A+  F  +L  E    +++ 
Sbjct: 117 LVGIALPELKKTN-GNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKA 173

Query: 194 ILIAPGIVETEFSV 207
           I +APGIV+T+  V
Sbjct: 174 IAVAPGIVDTDMQV 187

>ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(857415..858167) [753 bp, 250 aa]
          Length = 250

 Score = 63.5 bits (153), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 102/194 (52%), Gaps = 12/194 (6%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           +++ +TGAS GIG+AT  +   A +  V +V VAR  + L+ LKE   +K+     Y+  
Sbjct: 3   RVIIVTGASRGIGEATVEKLCTAPD--VVVVGVARAEKTLKVLKERYGSKFD----YVAG 56

Query: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133
            DVT+   +Q  LD +  ++  +D +I NAG +   +R+ + DI+  K   +  V  +  
Sbjct: 57  -DVTDESVVQAVLDKVSSDYGRLDAIIANAGVSR-FERIAEADIQQWKRTFEIIVSAVSL 114

Query: 134 VTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKIRV 193
           V++A+  +  +K+ G ++ + S   +  Y   +   +SK A+  F   L  E     +R 
Sbjct: 115 VSKALPML--RKSQGTVIVVTSGLSKVGYRASASSASSKIALNHFIRILAAE--EPALRA 170

Query: 194 ILIAPGIVETEFSV 207
           + +APG+V T+ +V
Sbjct: 171 VAVAPGVVRTDMTV 184

>YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reductase
           in the short-chain dehydrogenase/reductase (SDR) family
           of proteins [792 bp, 263 aa]
          Length = 263

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 95/198 (47%), Gaps = 12/198 (6%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           K++ ITGAS GIG       ++  +  + +  VAR    LQ L+     +Y   K     
Sbjct: 3   KVILITGASRGIGLQLVKTVIEEDDECI-VYGVARTEAGLQSLQR----EYGADKFVYRV 57

Query: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAG-----KALGSDRVGDIDIKDVKGMMDTNV 128
           LD+T+   ++  ++ + ++   +D ++ NAG     K++ S    + DIK  + + D N 
Sbjct: 58  LDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSI-SQSNSEHDIKQWERLFDVNF 116

Query: 129 LGLINVTQAVLHIFQKKN-SGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELI 187
             ++++    L + +     G+IV + S A    Y   S Y  SK A+  F   +  E  
Sbjct: 117 FSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEP 176

Query: 188 NTKIRVILIAPGIVETEF 205
           + K+R + IAPG+V+T+ 
Sbjct: 177 SDKVRAVCIAPGVVDTQM 194

>AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH]
           complement(595270..597945) [2676 bp, 891 aa]
          Length = 891

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 99/197 (50%), Gaps = 10/197 (5%)

Query: 3   QGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEA 62
           QG    + L +K+V ITGA AG+G++ AL +  A  G     +V   L+    +   I +
Sbjct: 309 QGSVQVKSLKDKVVIITGAGAGLGRSHALWF--AKYGA---RVVVNDLKGADGVVAEINS 363

Query: 63  KYPKSKVYIGKLD-VTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVK 121
           +Y + +      + VT+   +   ++   + F+ +D+L+NNAG       V   D  +  
Sbjct: 364 QYGEGRAVADSHNIVTDAAAV---VETAMKAFERVDVLVNNAGILRDRSFVKMTD-DEWN 419

Query: 122 GMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTES 181
            ++  ++L +  +++AV  IF ++ SG IVN  S +G       + Y A+K AV  F++S
Sbjct: 420 SVLQVHLLSVFALSKAVWPIFMQQRSGVIVNTTSTSGIYGNFGQANYSAAKAAVLGFSKS 479

Query: 182 LRRELINTKIRVILIAP 198
           L  E     IRV +IAP
Sbjct: 480 LAIEGAKRGIRVYVIAP 496

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 88/194 (45%), Gaps = 12/194 (6%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLV-----LVARRLEKLQQLKEVIEAKYP 65
            N+++V ITGA  G+G+  AL+Y  A  G   +V      +       +   +V+E    
Sbjct: 5   FNDRVVIITGAGGGLGREYALDY--AKRGAKVVVNDLGGTLGGSGHDTRAADKVVEEIRK 62

Query: 66  KSKVYIGKLD-VTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMM 124
                +   D VT+ + I   +    + F  +D+++NNAG  L       +  K+   ++
Sbjct: 63  AGGTAVANYDTVTDGDKI---VKTAIDAFGRVDVIVNNAG-ILRDGSFAKMTEKNFSAVV 118

Query: 125 DTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRR 184
           D ++ G   + +A     +++  G IVN  S AG       + Y A+K  +   +E+L +
Sbjct: 119 DVHLNGSYKLCKAAWPYMRQQKYGRIVNTASPAGLYGNFGQTNYSAAKLGLVGLSETLAK 178

Query: 185 ELINTKIRVILIAP 198
           E     I+V +IAP
Sbjct: 179 EGHKYNIKVNVIAP 192

>KLLA0F04455g complement(428010..428927) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 305

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 92/198 (46%), Gaps = 18/198 (9%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLK-EVIEAKYPKSKVYIG 72
           K   +TGAS+GIG     E +        +   ARR   +++L+ E  +   P+      
Sbjct: 5   KYALVTGASSGIGYEVTKELLRRG---WYVYACARRTHPMEELRAEFGDRCIPR------ 55

Query: 73  KLDVTELETIQPFLDNLPEEFKD--IDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLG 130
           KLDV+    I      L +E  D  + +L NNAG++     + D+  + +      NV G
Sbjct: 56  KLDVSNQNDITQLKLKLEQELPDQKLHLLYNNAGQSCSLPAI-DVSEEIIDNTFRVNVYG 114

Query: 131 LINVTQ--AVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELIN 188
            IN  +  A L I  K   G IV  GS+AG   +P G++Y ASK A+  +   L  EL  
Sbjct: 115 PINSCREFAPLIINAK---GTIVFTGSLAGICPFPFGAVYSASKAAIHQYARVLHGELGP 171

Query: 189 TKIRVILIAPGIVETEFS 206
             +RVI +  G V T+ +
Sbjct: 172 LGVRVINMITGGVATDIA 189

>Sklu_2380.4 YIR035C, Contig c2380 9858-10340
          Length = 160

 Score = 60.8 bits (146), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 85/165 (51%), Gaps = 17/165 (10%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           K+V +TGAS GIGQA      +  N  V +V +AR    L  +K V   K+   +  IG 
Sbjct: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKF---EYIIG- 58

Query: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133
            D+++ E ++ +++   ++F  ID ++ NAG       V +ID+   K + D N   +++
Sbjct: 59  -DISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIVS 117

Query: 134 -VTQAVLHIFQKKNSGDIVNLGS---------VAGRDAYPTGSIY 168
            V+ ++ H+  KK +G+IV + S         + GR   PT +IY
Sbjct: 118 LVSLSLPHL--KKFNGNIVFVSSGASTKPYVCIMGRSRKPTSTIY 160

>Kwal_23.3107
          Length = 248

 Score = 62.4 bits (150), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 97/197 (49%), Gaps = 9/197 (4%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYP-KSKV 69
           L  K+  ITG +  +G+ TA+E        + L   + + ++ ++L + + +KY  K ++
Sbjct: 3   LEGKVALITGGTKNLGRLTAIELASRHKANLFLHYNSTQGDE-KKLADELSSKYNVKVEL 61

Query: 70  YIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGM-MDTNV 128
           Y G L     + ++   +    +F  IDI INN GK L    V ++  ++   M +  N 
Sbjct: 62  YQGNLG--SAKNVEKLFEAAKAKFGSIDIAINNVGKVLKKPMV-EVTEEEFDEMDLVNNK 118

Query: 129 LGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELIN 188
           +    + QA  H+    + G I++L +       P  ++Y  +K AV  +T+S  +ELI 
Sbjct: 119 IAFFFIAQATKHV---SSGGSIISLVTSLLAAYTPFYAVYQGTKSAVEFYTKSASKELIE 175

Query: 189 TKIRVILIAPGIVETEF 205
            ++ V  IAPG ++T F
Sbjct: 176 KRVSVNCIAPGPMDTPF 192

>KLLA0D02596g
           join(complement(219682..219797),
           complement(218659..219586)) similar to sgd|S0004418
           Saccharomyces cerevisiae YLR426w, start by similarity
          Length = 347

 Score = 62.0 bits (149), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 93/200 (46%), Gaps = 20/200 (10%)

Query: 13  EKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIG 72
           + +  ITG S G+G       M +    +K+V+       L  +   ++    K ++   
Sbjct: 83  DPVCVITGGSLGLGNELVKSLM-SDIPDIKIVI-------LDVVDPKLDLSITKDRIEFL 134

Query: 73  KLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLI 132
           + D++  E ++  +  +  +F  +D+LINNA       R+ D+   ++  +   NVL  I
Sbjct: 135 RCDLSSDEEVENAIKTIKNKFPKVDLLINNAAIRGRFSRLADMPCVEMNKIFHANVLSTI 194

Query: 133 NVTQAVLHIFQKKNSGD-----IVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELI 187
            + QA    F  K S +     +VN+ S  G  +    S Y ASK A+ ++ ES   EL+
Sbjct: 195 RLIQA----FHPKKSANNDFYYVVNIASALGIMSPARASTYAASKAALISYHESWTYELL 250

Query: 188 N---TKIRVILIAPGIVETE 204
           N     +R +L+ PG ++T+
Sbjct: 251 NDNAMNVRTLLVLPGQMDTQ 270

>Scas_721.47
          Length = 344

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 103/209 (49%), Gaps = 23/209 (11%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           K   +TGAS GIG+  A +   A+ G   LVL++R L KL+ LKE  E KY   KV I  
Sbjct: 63  KYCVVTGASDGIGKEFANQM--AARG-FNLVLISRTLSKLEALKEEFEKKY-GIKVEILA 118

Query: 74  LDVTE-----LETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKD--VKGMMDT 126
           +D++       E I+    +LP     I +LINN G++  S  V  ++ ++  ++ ++  
Sbjct: 119 IDISSDSQDNYEFIKGLCKDLP-----ITVLINNVGQS-HSIPVPFLETEEEELRNIITI 172

Query: 127 NVLGLINVTQAVLHIFQK------KNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTE 180
           N    + +TQ +  I  K      K+ G I+ +GS  G    P  + Y  SK  ++ ++ 
Sbjct: 173 NNTATLLITQIIAPIISKTVKETKKSRGLILTMGSFGGLIPTPLLATYSGSKAFLQQWST 232

Query: 181 SLRRELINTKIRVILIAPGIVETEFSVVR 209
           SL  EL    I V L+   +V +  S +R
Sbjct: 233 SLAGELQKDNIDVELVLSYLVTSSMSKIR 261

>CAGL0F06897g complement(675416..676192) highly similar to sp|P40579
           Saccharomyces cerevisiae YIR035c, hypothetical start
          Length = 258

 Score = 60.8 bits (146), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 100/196 (51%), Gaps = 11/196 (5%)

Query: 13  EKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIG 72
           +K++ +TG S GIG++  ++ + + +  V +  +AR    L+ LK+    ++  +   +G
Sbjct: 6   QKVILVTGVSRGIGKSI-VDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYT---VG 61

Query: 73  KLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLI 132
             D+T  +T++ ++++  E    I+ LI NAG       + +ID+   K + + N   ++
Sbjct: 62  --DITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIV 119

Query: 133 NVTQAVL-HIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKI 191
           ++    L H+  KK  G  + + S A    + +   Y +SK A+  F  +L  E     +
Sbjct: 120 SLVDIALPHL--KKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE--EKAV 175

Query: 192 RVILIAPGIVETEFSV 207
           R + +APGIV+T+  V
Sbjct: 176 RALAVAPGIVDTDMQV 191

>Kwal_34.16024
          Length = 292

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 97/207 (46%), Gaps = 23/207 (11%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYP-KSKVYIG 72
           K+V +TGA+  IG+A    +  A      + +V  + +    L  ++  KY  +++ Y  
Sbjct: 40  KLVIVTGAAGVIGRAICEGFASAG---ADVCVVDYKYDA--DLATLLAQKYGVEARAY-- 92

Query: 73  KLDVTELETIQPFLDNLPEEF--KDIDILINNAGKAL--GSDRVGDIDIKDVKGMMDTNV 128
           ++D+T  E ++  +  + ++F  +DID  I NAG A   GS        +  + +MD NV
Sbjct: 93  QVDITNDEDVRACIQAVQKDFPSRDIDTFIANAGVAWTHGSVLNESATPEAWRRVMDVNV 152

Query: 129 LGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDA----YPTGSIYCASKFAVRAFTESLRR 184
            G  +  Q V H+F+++  G ++   S++   A    Y T   Y ASK AVR        
Sbjct: 153 QGTFHCAQEVAHVFKRQGHGCLILTASMSSHIANVPNYQT--CYNASKAAVRHMARGFAV 210

Query: 185 ELINT-----KIRVILIAPGIVETEFS 206
           E  +      +IR   ++PG  +T  S
Sbjct: 211 EFAHLTEPAGRIRCNSVSPGYTDTILS 237

>Kwal_55.19569
          Length = 288

 Score = 56.2 bits (134), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 95/200 (47%), Gaps = 12/200 (6%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVY 70
           L  K+  I+GAS+GIG A A+ +  A  G    V      + +Q  KE+ E    ++K Y
Sbjct: 36  LRGKVACISGASSGIGGAVAVAFAQA--GADIAVWYNSNDKLIQTAKELSETYGVRAKAY 93

Query: 71  IGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGD-----IDIKDVKGMMD 125
             K  VT+   ++  +  + ++F  IDI + NAG       + +     +  K+ + + +
Sbjct: 94  --KCPVTDEAKVKETILQVEKDFSKIDIFVANAGVPWSEGPLIEAEERGVATKEWEKVFN 151

Query: 126 TNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGR--DAYPTGSIYCASKFAVRAFTESLR 183
           T+  G+   ++ +  IF+K+  G +V   S++G   +     + Y A+K  V   + SL 
Sbjct: 152 TDFQGVYYCSKVIGAIFKKQGRGSLVITASMSGHVVNVPQLQACYNAAKAGVIHLSRSLA 211

Query: 184 RELINTKIRVILIAPGIVET 203
            E      RV  I+PG ++T
Sbjct: 212 VEWAGFA-RVNSISPGYIDT 230

>ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH]
           (654580..654909,654959..655384) [756 bp, 251 aa]
          Length = 251

 Score = 55.5 bits (132), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 89/192 (46%), Gaps = 11/192 (5%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           +++ +TG S GIG+ + +E +     TV L  VAR    LQ+L+    A Y +   Y+  
Sbjct: 3   RLIIVTGVSRGIGR-SVVEKVCRQPDTVVLG-VARSEAALQELR----ATYGEQFEYVVG 56

Query: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133
            DV   E  Q  L      +  ID ++ NAG       V  ID+   + + + N   ++ 
Sbjct: 57  -DVAS-EDAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVG 114

Query: 134 VTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKIRV 193
           +    L +  KK  G +V + S A   AY     Y +SK A+  F  +L  E     +R 
Sbjct: 115 LVGRALPLL-KKAGGSVVFVSSGASTKAYSAWGAYGSSKAALNHFAMTLAAE--EPAVRA 171

Query: 194 ILIAPGIVETEF 205
           + +APG+V+T+ 
Sbjct: 172 VAVAPGVVDTQM 183

>YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal
           2,4-dienoyl-CoA reductase [888 bp, 295 aa]
          Length = 295

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 114/272 (41%), Gaps = 20/272 (7%)

Query: 1   MSQGPKAAERLNEKIVFITGASAGIG--QATALEYMDASNGTVKLVLVARRLEKLQQLKE 58
           +++G    +    K+ F+TG +  I   Q  AL  +       K  +V R  E+ +Q  +
Sbjct: 15  VTEGSWRPDLFKGKVAFVTGGAGTICRVQTEALVLLG-----CKAAIVGRDQERTEQAAK 69

Query: 59  VIE--AKYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDID 116
            I   AK   + + I  +DV   E ++  +    E+F  ID +I  A      D   ++ 
Sbjct: 70  GISQLAKDKDAVLAIANVDVRNFEQVENAVKKTVEKFGKIDFVIAGAAGNFVCD-FANLS 128

Query: 117 IKDVKGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVR 176
               K ++D ++LG  N  +A L    KK+ G I+ + +       P      A+K  + 
Sbjct: 129 PNAFKSVVDIDLLGSFNTAKACLKEL-KKSKGSILFVSATFHYYGVPFQGHVGAAKAGID 187

Query: 177 AFTESLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLE----ADDV 232
           A  ++L  EL    IR   IAPG ++    + R  G   + K++     PL+      D+
Sbjct: 188 ALAKNLAVELGPLGIRSNCIAPGAIDNTEGLKRLAGKKYKEKALAK--IPLQRLGSTRDI 245

Query: 233 ADLIVYTTSRKQNTVIADTLIFPTSQGSAFHV 264
           A+  VY  S   + V    L+     G  +H+
Sbjct: 246 AESTVYIFSPAASYVTGTVLVV---DGGMWHL 274

>ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH]
           complement(93017..93895) [879 bp, 292 aa]
          Length = 292

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 115/274 (41%), Gaps = 24/274 (8%)

Query: 1   MSQGPKAAERLNEKIVFITGASAGIG--QATALEYMDASNGTVKLVLVARRLEKLQQLK- 57
           +  GP        K+VF+TG +  I   QA A+  + A     K  ++ R +EK ++   
Sbjct: 10  VQNGPWRDGVFQGKVVFVTGGAGTICRVQAEAMVLLGA-----KAAIIGRNVEKTKKAAA 64

Query: 58  EVIEAKYPKSKVY-IGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDID 116
           E+ E       V  IG +DV E+  ++  ++     F  ID +I  A     +D   ++ 
Sbjct: 65  EIAELGDSADCVLGIGGVDVREVADMKRAVEQTVAAFGRIDYVIAGAAGNFLADMT-NLS 123

Query: 117 IKDVKGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVR 176
            +  K ++D +++G  N  +A L    K N G ++ + +       P  +   A+K  V 
Sbjct: 124 SRAFKTVLDIDLVGSYNTVKATLSELAK-NKGAVLFVSATLHYTGTPLQAHVSAAKAGVD 182

Query: 177 AFTESLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVH--PLE----AD 230
           A +  L  EL    IR   IAPG++     V R  G       V D V   PL+      
Sbjct: 183 ALSNVLAVELGPLGIRCNCIAPGLIGGTEGVDRLSG----GLPVTDAVKKIPLQRPGLTK 238

Query: 231 DVADLIVYTTSRKQNTVIADTLIFPTSQGSAFHV 264
           D+AD  VY  S   +      L+     G A+H+
Sbjct: 239 DIADGTVYLFSPAASYTTGTILVV---DGGAWHL 269

>KLLA0E08063g complement(726232..726792) some similarities with
           sp|P40579 Saccharomyces cerevisiae YIR035c, hypothetical
           start
          Length = 186

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 79/149 (53%), Gaps = 7/149 (4%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           K+  +TG S GIG ++ +E + +   T  ++ +AR  +KL++LK     K+     YI  
Sbjct: 3   KVFLVTGVSRGIG-SSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFD----YICG 57

Query: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133
            DV++ ETI   ++ +  ++K +D ++ NAG     + V +I I   K + D N   +++
Sbjct: 58  -DVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVS 116

Query: 134 VTQAVLHIFQKKNSGDIVNLGSVAGRDAY 162
           +    L + ++ N G+IV + S A   +Y
Sbjct: 117 LVGHALPLLKQSN-GNIVLVSSGASTKSY 144

>KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces
           cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase, peroxisomal
           singleton, start by similarity
          Length = 889

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 89/196 (45%), Gaps = 8/196 (4%)

Query: 3   QGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEA 62
            GP   + L  K+V ITG+ +G+G++ A  +  A  G     +V   +     + + I  
Sbjct: 303 NGPIPIKSLRGKVVIITGSGSGLGKSHAQWF--ARYGA---KVVINDIRDPSAVVDEINK 357

Query: 63  KYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKG 122
           KY          D+  ++  Q  +    ++F  +DIL+NNAG  L       +   +   
Sbjct: 358 KYGSGSAVADTHDI--VKEAQQVVQTAVDKFGRVDILVNNAG-ILRDRSFAKMTEDEWNA 414

Query: 123 MMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESL 182
           +++ ++     +++AV  IF K+ SG I+N  S +G         Y A+K A+  F+ +L
Sbjct: 415 VINVHLFSTFALSKAVWPIFLKQKSGYIINTTSTSGIYGNFGQCNYAAAKAAILGFSRTL 474

Query: 183 RRELINTKIRVILIAP 198
             E     I V +IAP
Sbjct: 475 ALEGTKRGITVNVIAP 490

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 88/195 (45%), Gaps = 20/195 (10%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEK--LQQLKEVIEAKYPKSK 68
             +++V ITGA  G+G+  ALEY     G V +  + R      +Q++K++         
Sbjct: 5   FKDRVVIITGAGGGLGRVYALEYAK-RGGKVVVNDLGRSAADSVVQEIKKLG-------- 55

Query: 69  VYIGKLD-VTELETIQ----PFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGM 123
              G+ D V   +++       ++     F  +DILINNAG  L       +  K  + +
Sbjct: 56  ---GEGDAVANYDSVSDNGAAIVETAISNFGRVDILINNAG-ILRDSSFAKMSEKQFQQV 111

Query: 124 MDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLR 183
           +D ++ G   +T+A     +K+  G I+N  S AG       + Y A+K  +  F ESL 
Sbjct: 112 IDVHLNGAFKLTRAAWPHMRKQKFGRIINTCSPAGLYGNFGQANYSAAKLGLLGFGESLA 171

Query: 184 RELINTKIRVILIAP 198
           +E     I V  IAP
Sbjct: 172 KEGYKYNINVNSIAP 186

>Kwal_26.7950
          Length = 897

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 95/196 (48%), Gaps = 8/196 (4%)

Query: 3   QGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEA 62
           QG    E L  K+V ITGA AG+G++ AL +  A  G     +V   ++    +   IE 
Sbjct: 314 QGQTRIESLKGKVVIITGAGAGLGRSHALTF--AKYGA---KVVVNDIKDPHTVVSEIEK 368

Query: 63  KYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKG 122
            Y ++     K DV  ++     + +  + F  +DIL+NNAG  L       +  ++ + 
Sbjct: 369 LYGRNSAVADKHDV--VKDPGEIVKSAFQTFGRVDILVNNAG-VLRDRSFAKMSDEEWEI 425

Query: 123 MMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESL 182
           ++  ++     + +AV  IF K+ SG I+N  S +G       + Y A+K AV  F+++L
Sbjct: 426 VLKVHLFSTFGLCKAVWPIFVKQKSGYIINTTSTSGIYGNFGQANYAAAKAAVLGFSKTL 485

Query: 183 RRELINTKIRVILIAP 198
             E     IRV ++AP
Sbjct: 486 ALEGSKHNIRVNIVAP 501

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 83/196 (42%), Gaps = 14/196 (7%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTV------KLVLVARRLEKLQQLKEVIEAKY 64
             +++V ITGA  G+G+  ALE+       V       L            +   I  KY
Sbjct: 8   FKDRVVVITGAGGGLGKVYALEFAKRGAKVVVNDLGGSLGGEGHNSRAADVVVSEIREKY 67

Query: 65  PKSKVYIGKLDVTE--LETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKG 122
            K++       VTE     +Q  +DN    F  +DI+INNAG  L      ++       
Sbjct: 68  -KTQAAANYDSVTENAAAIVQTAVDN----FGRVDIIINNAG-ILRDSSFANMSDSAFAS 121

Query: 123 MMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESL 182
           ++D ++ G  N+T+A     + +  G IVN  S AG       + Y A+K  +  F+E+L
Sbjct: 122 VVDVHLTGAYNLTRAAWPHMKNQKFGRIVNTCSPAGLYGNFGQANYSAAKMGLVGFSETL 181

Query: 183 RRELINTKIRVILIAP 198
            +E     I V  I P
Sbjct: 182 AQEGFKYNIYVNCIVP 197

>Kwal_55.21822
          Length = 283

 Score = 52.8 bits (125), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 95/207 (45%), Gaps = 17/207 (8%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYP-KSKV 69
           L  K+  +TGAS+GIG   A+ +  A      + +       + +L   I  KY  K K 
Sbjct: 28  LKGKVAAVTGASSGIGYDVAVAFAQAG---ADVAMWYNSNPHITELVGEISEKYGVKVKA 84

Query: 70  YIGKLDVTELETIQPFLDNLPEEF-KDIDILINNAGKALGSDRVGDIDIKD-------VK 121
           Y  K  VT  + +   +D + ++F   IDI++ NAG A     + D+  KD         
Sbjct: 85  Y--KCSVTSSKDVASTIDQIKKDFGGKIDIMVGNAGVAWSEGPLIDLVEKDEEKCDAEWN 142

Query: 122 GMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGR--DAYPTGSIYCASKFAVRAFT 179
            ++D ++ G+  V + +  +F+++  G  +   S++G   +     + Y A+K  V   +
Sbjct: 143 KVIDVDLNGIYRVAKNIGRVFKEQGHGSFIITASMSGHVVNVPQMQTAYNAAKAGVLHMS 202

Query: 180 ESLRRELINTKIRVILIAPGIVETEFS 206
           +SL  E      RV  ++PG + TE +
Sbjct: 203 KSLAVEWAGFA-RVNTVSPGYIATEIT 228

>CAGL0L02167g 253055..255760 highly similar to sp|Q02207
           Saccharomyces cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase peroxisomal, start by
           similarity
          Length = 901

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 86/203 (42%), Gaps = 29/203 (14%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKL--QQLKEVIEAKYPKSK 68
            N ++V ITGA  G+G+  ALEY             A+R  K+    L   +      SK
Sbjct: 7   FNGRVVVITGAGGGLGKVYALEY-------------AKRGAKVVVNDLGGTLGGSGHDSK 53

Query: 69  ---------VYIGKLDVTELETI----QPFLDNLPEEFKDIDILINNAGKALGSDRVGDI 115
                    V  G   V   +++    +  ++   + F  IDILINNAG  L       +
Sbjct: 54  AADVVVDEIVKSGGTAVANYDSVNDNGEQIVETAIKAFGRIDILINNAG-ILRDVSFAKM 112

Query: 116 DIKDVKGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAV 175
             K+   ++D ++ G   +T+A     +++  G I+N  S AG       + Y A+K  +
Sbjct: 113 TEKEFSAVLDVHLTGAYRLTKAAWPYMRQQKFGRIINTASPAGLFGNFGQANYSAAKLGL 172

Query: 176 RAFTESLRRELINTKIRVILIAP 198
             F E+L +E     I V  IAP
Sbjct: 173 VGFAETLAKEGYKYNINVNSIAP 195

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 93/197 (47%), Gaps = 10/197 (5%)

Query: 3   QGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEA 62
           QG      L +K+V ITGA  G+G++ AL +  A  G     +V   ++    +   I +
Sbjct: 313 QGSIKITSLKDKVVIITGAGGGLGKSHALWF--AKYGA---RVVVNDIKDPNTVVNEINS 367

Query: 63  KYPKSKVYIGKLD-VTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVK 121
           KY + +      + VTE   +   ++   + +  +D+L+NNAG       +   D ++  
Sbjct: 368 KYGEGRAIPDTHNVVTEANQV---IETAMKAYGRVDVLVNNAGILRDRSFLKMTD-QEWF 423

Query: 122 GMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTES 181
            ++  ++     +++AV  IF K+  G I+N  S +G       + Y A+K A+  F+ +
Sbjct: 424 AVVQVHLYSTFLLSKAVWPIFLKQKGGHIINTTSTSGIYGNFGQANYAAAKAAILGFSRT 483

Query: 182 LRRELINTKIRVILIAP 198
           +  E     IRV +IAP
Sbjct: 484 IAVEGAKRGIRVNIIAP 500

>KLLA0E24046g complement(2136583..2137425) similar to
           ca|CA3771|CaSOU1 Candida albicans Sorbitol utilization
           protein Sou1p [Candida albicans], hypothetical start
          Length = 280

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 95/209 (45%), Gaps = 24/209 (11%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKL------VLVARRLEKLQQLKEVIEAKY 64
           L  K+  +TGAS+GIG A A E +  +  ++ +       LV R +E        + AKY
Sbjct: 28  LKGKVAVVTGASSGIGYAVA-EGLAQAGASLAVWYNSNAALVERAVE--------LSAKY 78

Query: 65  PKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRV-----GDIDIKD 119
              KV   +  VTE   ++  ++++ +EF  ID+ I NAG       +        D  +
Sbjct: 79  -NVKVVAYQCPVTEEAKVKKTIEDVIQEFGKIDVFIANAGVPWTKGPLVEAAESGTDTDE 137

Query: 120 VKGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGR--DAYPTGSIYCASKFAVRA 177
              ++ T+  G+    + V   F+++ SG +V   S++G   +     + Y A+K  V  
Sbjct: 138 WNKVIHTDFNGVYYCAKYVGAQFKRQGSGSMVITASMSGHIVNIPQLQACYNAAKAGVIH 197

Query: 178 FTESLRRELINTKIRVILIAPGIVETEFS 206
           F +SL  E      RV  ++PG + T  S
Sbjct: 198 FAKSLAVEWAGFA-RVNTVSPGYIATPIS 225

>KLLA0B09812g complement(856799..857839) similar to sp|P38286
           Saccharomyces cerevisiae YBR159w singleton, start by
           similarity
          Length = 346

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 100/206 (48%), Gaps = 26/206 (12%)

Query: 18  ITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGKLDVT 77
           +TGAS GIG+  A +   A  G   L+L++R   KL +LK+ IE +  K  V I  +DV+
Sbjct: 70  VTGASDGIGKEYAKQL--AKRG-FNLILISRTESKLVELKKEIETEC-KIDVKILAIDVS 125

Query: 78  E-----LETIQPFLDNLPEEFKDIDILINNAGKA----LGSDRVGDIDIKDVKGMMDTNV 128
                    I+     LP     + +LINN GK+    +  D+  + +++D+  + +T  
Sbjct: 126 SDSKENYTLIREVASGLP-----VTVLINNVGKSHSIPVPFDQTEESELRDIITINNTAT 180

Query: 129 LGLINVTQAVLHIFQK-----KNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLR 183
           L    +TQ +L   +      K  G I+ +GS  G    P  + Y  SK  +++++ +L 
Sbjct: 181 L---MITQTLLPQLKASVKTLKCRGLILTMGSFGGLLPTPFLATYSGSKAFLQSWSNALA 237

Query: 184 RELINTKIRVILIAPGIVETEFSVVR 209
            EL +  I V L+   +V +  S +R
Sbjct: 238 GELSSDSIDVELVLSYLVTSAMSKIR 263

>CAGL0J04774g join(452094..452179,452259..453189) similar to
           tr|Q06417 Saccharomyces cerevisiae YLR426w
          Length = 338

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 96/208 (46%), Gaps = 20/208 (9%)

Query: 3   QGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEA 62
           Q  K+   L++ IV ITG S G+G+    + + + N             K+  L   ++ 
Sbjct: 59  QTWKSLNELHDPIVLITGGSNGLGRCIIHKLLRSYNNI-----------KVINLDLDVQY 107

Query: 63  KYPKSKVYIGKLDVTELETIQPFLDNLPEEFKD-IDILINNAGKALGSDRVGDIDIKDVK 121
              +++V   + D+   + ++  L  +  E++D I++LI NAG     +   D  I +++
Sbjct: 108 WSEEARVINIECDLVNADGLELALKKIKLEYEDKINLLICNAGVRSRFNWFEDTPIDEMQ 167

Query: 122 GMMDTNVLGLINVTQAVLHIFQKKNSGD--IVNLGSVAGRDAYPTGSIYCASKFAVRAFT 179
            +M+ N      + QA++    + N     IV + SV G  A    + Y ASK A+ A  
Sbjct: 168 RIMNINTWSTARILQAII---PRDNQRQLYIVTISSVLGILAPSKVASYAASKAAITALH 224

Query: 180 ESLRRELINT---KIRVILIAPGIVETE 204
            S+  + +      IR +L+ PG ++T+
Sbjct: 225 NSMTNDFLVRGIGNIRTLLVLPGQIDTQ 252

>Kwal_47.17102
          Length = 285

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 96/226 (42%), Gaps = 44/226 (19%)

Query: 10  RLNEKIVFITGASAGIGQATALEYMDASNGTVKL---VLVARRLEKLQQLKEVIEAKYPK 66
           +++  +  +TG S G+G+A   E++      +KL    L++  +E  ++        +P 
Sbjct: 29  KIDNAVCVVTGGSNGLGRAIVQEFL------LKLPNVTLISLDIEPPKK-------SFP- 74

Query: 67  SKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDT 126
             VY    D++    +   L  +     D+ +LINNAG         ++  +    +   
Sbjct: 75  -NVYHYTCDLSNSSDVDQTLKIVKRNHGDVTVLINNAGIRAKYQNFRELSKEVADKVFQV 133

Query: 127 NVLGLINVTQAVLHIFQKKNSGDI-----VNLGSVAGRDAYPTGSIYCASKFAVRAFTES 181
           NV   + + Q +        +GD+     V + S  G  A   GS Y ASK A  AF E+
Sbjct: 134 NVFTPMRLVQEL-----SPKAGDLRQFYAVTVASALGVCAPARGSCYGASKAAAIAFHEA 188

Query: 182 LRRELINT-KIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHP 226
             +EL  T +IR +L+ PG ++T               +++ G HP
Sbjct: 189 WAQELDETSRIRTLLVTPGQLDT---------------TMFGGFHP 219

>YBR159W (YBR159W) [344] chr2 (558641..559684) Major 3-ketoreductase
           of the fatty acid elongase system involved in synthesis
           of very long chain fatty acids [1044 bp, 347 aa]
          Length = 347

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 101/212 (47%), Gaps = 26/212 (12%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73
           K   ITGAS GIG+  A +   A  G   LVL++R   KL+ L++ +E ++    V I  
Sbjct: 63  KYCAITGASDGIGKEFARQM--AKRG-FNLVLISRTQSKLEALQKELEDQH-HVVVKILA 118

Query: 74  LDVTE-----LETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDI--KDVKGMMDT 126
           +D+ E      E+I+     LP     I +L+NN G++  S  V  ++   K+++ ++  
Sbjct: 119 IDIAEDKESNYESIKELCAQLP-----ITVLVNNVGQS-HSIPVPFLETEEKELRNIITI 172

Query: 127 NVLGLINVTQ----AVLHIFQKKNS-----GDIVNLGSVAGRDAYPTGSIYCASKFAVRA 177
           N    + +TQ     ++   + +N      G I+ +GS  G    P  + Y  SK  ++ 
Sbjct: 173 NNTATLLITQIIAPKIVETVKAENKKSGTRGLILTMGSFGGLIPTPLLATYSGSKSFLQG 232

Query: 178 FTESLRRELINTKIRVILIAPGIVETEFSVVR 209
           ++ SL  EL    I V LI   +V +  S +R
Sbjct: 233 WSNSLAGELSKDAIDVELIISYLVTSSMSKIR 264

>Kwal_23.4572
          Length = 300

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 105/256 (41%), Gaps = 27/256 (10%)

Query: 4   GPKAAERLNEKIVFITGASAGI--GQATALEYMDASNGTVKLVLVARRLEK-LQQLKEVI 60
           GP  ++    K+ F+TG +  I   Q  AL  +       +  +V R  EK +Q  +E+ 
Sbjct: 13  GPWKSQLFKGKVAFVTGGAGTICRAQTEALVLLGC-----RAAIVGRNKEKTVQAAREIS 67

Query: 61  EAKYPKSK-----------VYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGS 109
           E                  + I  +DV E+E ++  +    E F  ID +I  A     +
Sbjct: 68  ELSVKGGGKDSDDSDGDSVLPIFGVDVREIEQLEEAVARTVERFGRIDFVIAGAAGNFIA 127

Query: 110 DRVGDIDIKDVKGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYC 169
                +     K ++  ++LG  N  +A L   Q +  G I+ + +       P  S   
Sbjct: 128 P-FSKLSANAFKSVVSIDLLGSFNTAKACLAELQ-RTKGSILFVSATFHYYGVPYQSHVG 185

Query: 170 ASKFAVRAFTESLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLE- 228
           A+K  V A + +L  EL  + +R   IAPG +E    + R  G   + +S+   + PL+ 
Sbjct: 186 AAKAGVDALSNALAVELGVSGVRSNCIAPGAIEGTEGISRLTGSVSK-QSICSKI-PLQR 243

Query: 229 ---ADDVADLIVYTTS 241
                D+A+  VY  S
Sbjct: 244 LGTTKDIAETTVYLFS 259

>ADR059C [1800] [Homologous to ScYBR159W - SH] (811943..812998)
           [1056 bp, 351 aa]
          Length = 351

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 96/204 (47%), Gaps = 20/204 (9%)

Query: 17  FITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKS----KVYIG 72
            +TGAS GIG+  AL+   AS G   ++LV+R   KL +LK+ I AKY        V  G
Sbjct: 72  LVTGASDGIGKEFALQL--ASKG-FNVLLVSRTEAKLLELKQEIMAKYKVDARVLSVDFG 128

Query: 73  KLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDI--KDVKGMMDTNVLG 130
             +      I      LP     + +L+NN G +  S  V  ++   ++++G++  N   
Sbjct: 129 VDNRLTYTAISELCGELP-----VTVLVNNVGVS-HSIPVSFLETTEEELRGIITVNNTA 182

Query: 131 LINVTQAVLHIF-----QKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRE 185
            + VTQ V  +      + +  G ++ +GS  G    P  + Y  SK  V+A++ +L  +
Sbjct: 183 TLMVTQTVAPLVIANARRLQCRGLVLTMGSFDGLLPTPLLATYSGSKDFVQAWSTALVVD 242

Query: 186 LINTKIRVILIAPGIVETEFSVVR 209
           L    + V ++   +V +  S VR
Sbjct: 243 LAPLNVDVQIVLSYLVTSAMSKVR 266

>YKL055C (OAR1) [3204] chr11 complement(334966..335802)
           3-Oxoacyl-[acyl-carrier-protein] reductase [837 bp, 278
           aa]
          Length = 278

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 59/122 (48%), Gaps = 18/122 (14%)

Query: 96  IDILINNAG--KALGSDRVGDIDIKDVKGMMDTNVLGLINVTQAVLHIFQKKN------S 147
           +++LIN AG  +   S R     I+D+   M+ N +  + +T   +    K        S
Sbjct: 114 VNLLINCAGLTQESLSVRTTASQIQDI---MNVNFMSPVTMTNICIKYMMKSQRRWPELS 170

Query: 148 GD-----IVNLGSV--AGRDAYPTGSIYCASKFAVRAFTESLRRELINTKIRVILIAPGI 200
           G      IVN+ S+  +G+   P  S+Y ASK A+  FTE L  E+    IR   I+PG+
Sbjct: 171 GQSARPTIVNISSILHSGKMKVPGTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGL 230

Query: 201 VE 202
           V+
Sbjct: 231 VK 232

>Sklu_1570.1 YKR009C, Contig c1570 100-2370
          Length = 756

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 72/156 (46%), Gaps = 8/156 (5%)

Query: 3   QGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEA 62
           QG    E L +KIV +TGA  G+G++ AL +  A  G     +V   ++  + + + I  
Sbjct: 174 QGSTKVESLKDKIVIVTGAGGGLGRSHALWF--AKYGA---KVVVNDIKAPEPVVDEINK 228

Query: 63  KYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKG 122
            Y        K DV    T    +    E F  +D+L+NNAG       +   D ++   
Sbjct: 229 IYGGGSAIPDKHDVVTQPT--EIVKTALEAFGRVDVLVNNAGILRDRSFLKMTD-EEWYA 285

Query: 123 MMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAG 158
           ++  ++     +++AV  +F K+ SG I+N  S +G
Sbjct: 286 VLKVHLFSTYGLSKAVWPVFLKQRSGYIINTTSTSG 321

>YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with
           similarity to proteins of the short-chain alcohol
           dehydrogenase family, expression is regulated by Yap1p
           transcription factor [771 bp, 256 aa]
          Length = 256

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 104/227 (45%), Gaps = 10/227 (4%)

Query: 17  FITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGKLDV 76
           FI G S GIG    ++ + AS G   +  + R    L + K+V +    +  ++I +LD+
Sbjct: 10  FIIGGSRGIG-FNLVKILSASTGNTVITSI-RGSPSLPKNKQVEDLAKIRKNIHIVQLDL 67

Query: 77  TELETIQPFLDNLPEE--FKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLINV 134
           T+ E+I    D + +   F  IDI I  +  +    +V +           TN LG I  
Sbjct: 68  TKDESIGNIADEIKKTPFFLGIDIFIACSAVSDSYYKVLETPKSVWLNHYSTNALGPILA 127

Query: 135 TQAVLHIFQKKNSGDIVNLGSVAGR-DAYPTGSI--YCASKFAVRAFTESLRRELINTKI 191
            Q V  +   K +  I  + SVAG  +A+   S+  Y  SK A+    ++L  EL     
Sbjct: 128 LQKVYPLLLLKKTRKIFFISSVAGSINAFVPLSVSAYGQSKAALNYAVKTLSFELKPEGF 187

Query: 192 RVILIAPGIVETEFSVVRYKGDNERAKSV-YDGVHPLEADDVADLIV 237
            V+   PG+V T+    +Y  D+ + K++   GV+ +  ++ A  ++
Sbjct: 188 TVVAFHPGMVSTDMG--QYGLDHFKEKNIDISGVNIITPEESASALI 232

>Scas_666.17*
          Length = 283

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 93/210 (44%), Gaps = 23/210 (10%)

Query: 2   SQGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIE 61
           SQ  K+   +    V ITG S G+G A  + ++   N   K+ ++   ++K       I 
Sbjct: 14  SQKWKSINDIKSPCVVITGGSHGLGHAIVVRFL---NKVPKITII--NVDK-------IS 61

Query: 62  AKYPKSKVYIGKLDVTELETIQPFLDNLPEEFKD-IDILINNAGKALGSDRVGDIDIKDV 120
           +     ++   + D++    ++  L  +  ++ + I ++INNAG  +       +D  + 
Sbjct: 62  SPQDDPRMVTIQCDLSNQVEMEKTLSLIKRKYGERIAVIINNAGMRMKYQNFQHLDQNEC 121

Query: 121 KGMMDTNVLGLINVTQAVLHIFQKKNSGD----IVNLGSVAGRDAYPTGSIYCASKFAVR 176
             +   N    +   Q+++    ++NS D    IVN+ S  G       + Y ASK A+ 
Sbjct: 122 MRVFQLNTFNAVRFMQSLV---PEENSNDRQCYIVNVASTLGTLTPAKVAGYGASKSALI 178

Query: 177 AFTESLRRELIN---TKIRVILIAPGIVET 203
           AF +S   EL     + IR +L+ PG + T
Sbjct: 179 AFHQSYSMELQTRRVSNIRTLLVVPGQLNT 208

>YKR009C (FOX2) [3265] chr11 complement(453995..456697)
           Multifunctional enzyme of the peroxisomal fatty acid
           beta-oxidation pathway possessing 2-enoyl-CoA hydratase
           2 and D-3-hydroxyacyl-CoA dehydrogenase activities [2703
           bp, 900 aa]
          Length = 900

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 83/193 (43%), Gaps = 9/193 (4%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLV-----LVARRLEKLQQLKEVIEAKYP 65
             +++V ITGA  G+G+  AL Y  AS G   +V      +       +    V++    
Sbjct: 7   FKDRVVVITGAGGGLGKVYALAY--ASRGAKVVVNDLGGTLGGSGHNSKAADLVVDEIKK 64

Query: 66  KSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMD 125
              + +   D    E  +  ++   +EF  +D+LINNAG  L       +  ++   ++D
Sbjct: 65  AGGIAVANYDSVN-ENGEKIIETAIKEFGRVDVLINNAG-ILRDVSFAKMTEREFASVVD 122

Query: 126 TNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRE 185
            ++ G   +++A     + +  G I+N  S AG       + Y A+K  +    E+L +E
Sbjct: 123 VHLTGGYKLSRAAWPYMRSQKFGRIINTASPAGLFGNFGQANYSAAKMGLVGLAETLAKE 182

Query: 186 LINTKIRVILIAP 198
                I V  IAP
Sbjct: 183 GAKYNINVNSIAP 195

>Scas_675.10
          Length = 312

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/264 (21%), Positives = 110/264 (41%), Gaps = 34/264 (12%)

Query: 10  RLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKY----- 64
           +LN++IV ITG S G+G+  A +Y    N + K+++V+R  +KL +  + I  K      
Sbjct: 4   QLNDQIVLITGGSQGLGREFAHKYYHEGNNS-KIIVVSRSEKKLIKAVDAISGKTVGTNL 62

Query: 65  ---------PKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDI 115
                      +K+Y    D+++ E +    D L E    +++L        G    G I
Sbjct: 63  SPEETGKLNKNAKLYYYPCDLSDHEAVSTMFDRLCE----LEMLPTQVYCCAG----GSI 114

Query: 116 D--IKDVKGMMDTNVLGLINVTQAVLHIFQKKNSGDIVN-----LGSVAGRDAYPTGSIY 168
               KD+ G  +   +G+       LHI  K    ++ N       SV     +   S Y
Sbjct: 115 PKLFKDLTG--EELDMGIKMNYSTTLHIAHKVAQLELSNCHLILFSSVTAFFPFIGYSQY 172

Query: 169 CASKFAVRAFTESLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLE 228
              K +++A    LR+E++  +I  +   PG  ++E   +      +  + +     P+ 
Sbjct: 173 APLKVSLKALVGILRQEMLQNRISCVY--PGNFQSEGFELEELTKPDITREIEGASTPIS 230

Query: 229 ADDVADLIVYTTSRKQNTVIADTL 252
           ++D  + I+ +     + +  D +
Sbjct: 231 SEDCCNKIIRSLESGYDDITTDLI 254

>CAGL0H07513g 734835..735893 highly similar to sp|P38286
           Saccharomyces cerevisiae YBR159w, start by similarity
          Length = 352

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 101/215 (46%), Gaps = 35/215 (16%)

Query: 18  ITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGKLDVT 77
           +TGAS GIG+  A +   AS G   LVL++R   KL  LK+ +E K+   K  I  +D++
Sbjct: 67  VTGASDGIGKEFASQL--ASKG-FNLVLISRTESKLVALKDELEGKF-NIKAKILAIDIS 122

Query: 78  -----ELETIQPFLDNLPEEFKDIDILINNAGKA-------LGSDRVGDIDIKDVKGMMD 125
                    I    D+LP     I IL+NN G++       L ++   + +++++  + +
Sbjct: 123 ADSKDNYNKIYSLCDDLP-----ISILVNNVGQSHSIPVPFLATE---EEEMRNIITINN 174

Query: 126 TNVLGLINVTQAVLHIFQKKN--SGD---------IVNLGSVAGRDAYPTGSIYCASKFA 174
           T  L +  +   ++    KK+  SGD         I+ +GS  G    P  + Y  SK  
Sbjct: 175 TATLMITQIIAPIIIRTVKKHRESGDKKLKSQRGLILTMGSFGGLIPTPLLATYSGSKAF 234

Query: 175 VRAFTESLRRELINTKIRVILIAPGIVETEFSVVR 209
           ++ ++ SL  EL    + V L+   +V +  S VR
Sbjct: 235 LQNWSSSLAGELAADNVDVELVLSYLVTSAMSKVR 269

>YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine
           reductase, catalyzes the second step in the synthesis of
           phytosphingosine [963 bp, 320 aa]
          Length = 320

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 109/265 (41%), Gaps = 34/265 (12%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKL-QQLKEV-IEAKYPK-- 66
           L +++V ITG S G+G+  A +Y + +  T K+++V+R   +L     E+ IEA   +  
Sbjct: 5   LEDQVVLITGGSQGLGKEFAKKYYNEAENT-KIIIVSRSEARLLDTCNEIRIEAHLRRET 63

Query: 67  -----------------SKVYIGKLDVTELETIQPFLDNLPEEFKDIDIL----INNAGK 105
                             +++    D++  E+++   + L    +D+D+L    +  AG 
Sbjct: 64  TDEGQVQHKLAAPLDLEQRLFYYPCDLSCYESVECLFNAL----RDLDLLPTQTLCCAGG 119

Query: 106 ALGSDRVGDIDIKDVKGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTG 165
           A+     G +   ++   MD N    +NV   +    Q K    I+   S      +   
Sbjct: 120 AVPKLFRG-LSGHELNLGMDINYKTTLNVAHQIALAEQTKEHHLII-FSSATALYPFVGY 177

Query: 166 SIYCASKFAVRAFTESLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVH 225
           S Y  +K A+++    LR+EL N   R+  + PG  E+E   V      E  K +     
Sbjct: 178 SQYAPAKAAIKSLVAILRQELTN--FRISCVYPGNFESEGFTVEQLTKPEITKLIEGPSD 235

Query: 226 PLEADDVADLIVYTTSRKQNTVIAD 250
            +      D+I  + +R    V  D
Sbjct: 236 AIPCKQACDIIAKSLARGDEDVFTD 260

>Sklu_2267.5 YNL202W, Contig c2267 5903-6955
          Length = 350

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 90/206 (43%), Gaps = 10/206 (4%)

Query: 14  KIVFITGASAGIG--QATALEYMDASNGTVKLVLVARRLEK-LQQLKEVIEAKYPKSKVY 70
           K++F+TG +  I   Q  A+  +       K  +V R  EK ++   E+ +  +  S + 
Sbjct: 84  KVLFVTGGAGTICRVQTEAMVLLGC-----KAAIVGRDKEKTIKVAGEISQLGHGTSVLP 138

Query: 71  IGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLG 130
           +  +DV +++ ++  +     EF  ID +I  A     SD   ++     K ++  ++LG
Sbjct: 139 VYGVDVRDIKQLEDAVSQTVNEFGRIDFVIAGAAGNFISDFT-NLSSNAFKSVVSIDLLG 197

Query: 131 LINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTK 190
             N  +A      KKN G I+ + +       P  S   A+K  + A + +L  EL    
Sbjct: 198 SFNTVKACFPQL-KKNKGAIIFVSATFHYYGVPFQSHVGAAKAGIDALSNALAVELGVLG 256

Query: 191 IRVILIAPGIVETEFSVVRYKGDNER 216
           IR   IAPG +     + R    N++
Sbjct: 257 IRSNCIAPGAIANTEGISRLLTGNKK 282

>Scas_613.18
          Length = 286

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 66/137 (48%), Gaps = 9/137 (6%)

Query: 73  KLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLI 132
           K DV   E I+     + ++   I ILINNAG       + +   ++V  +++ N LG  
Sbjct: 84  KCDVGSQEEIEKTYKRISKDHASIHILINNAGITCLKP-ITEFSKEEVNKVINVNYLG-- 140

Query: 133 NVTQAVLHIF-QKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLR---RELIN 188
                ++H++    N G IVN+ SV G       + Y ASK  + +F +SL    ++   
Sbjct: 141 --ACKLMHLWLSANNEGFIVNIASVLGLITPARLAAYGASKGGLISFHQSLNLLLKKRTT 198

Query: 189 TKIRVILIAPGIVETEF 205
            KI+++L+  G + T+ 
Sbjct: 199 NKIKMLLVCTGKIRTKM 215

>CAGL0I09328g 898234..899325 similar to sp|P38342 Saccharomyces
           cerevisiae YBR265w 3-ketosphinganine reductase,
           hypothetical start
          Length = 363

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 2/87 (2%)

Query: 166 SIYCASKFAVRAFTESLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVH 225
           S Y  +K +++A T  LR EL NT+I  +   PG   +E  V+      +  KS+    +
Sbjct: 218 SQYAPAKVSLKALTSILRHELPNTRISCVY--PGNFYSEGYVLEEMSKPDITKSIEGSSY 275

Query: 226 PLEADDVADLIVYTTSRKQNTVIADTL 252
           P+  ++  D IV+  +R  + V  D++
Sbjct: 276 PISCEECCDKIVWWLNRGYDDVTTDSI 302

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 11 LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQ 54
          L +++V I G S G+G+    +Y D S  + K++LV+R   KL+
Sbjct: 4  LEDQVVLIAGGSQGLGKQFGQKYWDESRHS-KIILVSRSDVKLR 46

>AAL089W [98] [Homologous to ScYOR246C - SH]
           complement(184564..185550) [987 bp, 328 aa]
          Length = 328

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 88/204 (43%), Gaps = 20/204 (9%)

Query: 1   MSQGPKAAERLNEKIVFITGASAGIGQATALE-YMDASNGTVKLVLVARRLEKLQQLKEV 59
           + Q P    R+  K+  +TG ++GIG  T L  YM      V     +R  + ++++K+ 
Sbjct: 7   LDQLPYYDPRVERKVALVTGGNSGIGWYTVLHLYMHGFIVYVGGRNSSRVHKAIKEIKQE 66

Query: 60  IEAKYPKSKV--------YIGKL-----DVTELETIQPFLDNLPEEFKDIDILINNAG-K 105
            E +   ++          +G+L     D+T+L +++        +   +D+LINNAG  
Sbjct: 67  AENRLETARQDPHDELERCLGELRYLPIDLTDLRSVEKAAKKFRAQESTLDVLINNAGVM 126

Query: 106 ALGSDRVGDIDIKDVKGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTG 165
           AL  +   D      +  M TN +    +T  +L  + K++ G +V L S+  +  +   
Sbjct: 127 ALPYELTHD----GFEVQMQTNYVSHFLLTMRLLP-YVKRSGGRVVTLSSIGHKIQFTYC 181

Query: 166 SIYCASKFAVRAFTESLRRELINT 189
            + C   +    F   LR  +  T
Sbjct: 182 PLDCHFDYRPNIFFTWLRYAMAKT 205

>KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces
           cerevisiae YKL055c OAR1 putative 3-oxoacyl-(acyl carrier
           protein) reductase singleton, start by similarity
          Length = 259

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 58/117 (49%), Gaps = 10/117 (8%)

Query: 96  IDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLINVTQAVLHIFQKK-----NSGDI 150
           +D+L+N AG    +  +   +  ++  +M+ N +  +++TQ  L    +      + G I
Sbjct: 104 LDLLVNCAGITQTTAAI-KANTNEMADIMNVNFMSSVSLTQLALKQMIRNTKLHGHRGKI 162

Query: 151 VNLGSVAGRDA----YPTGSIYCASKFAVRAFTESLRRELINTKIRVILIAPGIVET 203
           VN+ SV G  +     P  ++Y ASK A+  +   L  EL    I V  I+PG+VE+
Sbjct: 163 VNIASVLGDSSSNIIVPGTAMYSASKAAMIQYNRVLSEELKRLSIDVQTISPGLVES 219

>YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the
           short-chain dehydrogenase-reductase family, which are
           NAD- or NADP-dependent oxidoreductases, has low
           similarity to S. cerevisiae Ylr426p [927 bp, 308 aa]
          Length = 308

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 92/203 (45%), Gaps = 28/203 (13%)

Query: 17  FITGASAGIGQATALEYMDASNGTVKLVLVARRLEK-----LQQLKEVIEAKYPKSKVYI 71
            ITG S+G+G   A E             ++RR+ K     +Q      + +Y  + ++ 
Sbjct: 42  LITGGSSGLGFELAKE-------------LSRRINKVIVADIQSFPTFAQVEY--NNIFY 86

Query: 72  GKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGL 131
            + D+T L+ I+     +  +  +I+I+INNAG A    ++  +  K+V+ ++D N++G 
Sbjct: 87  YQCDITSLDEIKNLKKAIERDHGNINIIINNAGVA-HIKKLEHMTNKEVEQLIDINLIGA 145

Query: 132 INVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRR------- 184
             +             G I+N+ SV G       + Y ASK A+  F + + R       
Sbjct: 146 YRIISTFAEDMIDNREGFIINIASVLGELTPARLTSYGASKGAMIGFHKCMSRHFRSLST 205

Query: 185 ELINTKIRVILIAPGIVETEFSV 207
           E   T I+ +L+ PG ++T   +
Sbjct: 206 ECNKTGIKTLLVCPGKIKTNMFI 228

>KLLA0D18909g complement(1592628..1593500) similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19 peroxisomal 2,
           4-dienoyl-CoA reductase singleton, start by similarity
          Length = 290

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 86/207 (41%), Gaps = 12/207 (5%)

Query: 3   QGPKAAERLNEKIVFITGASAGIG--QATALEYMDASNGTVKLVLVARRLEKLQQLKEVI 60
            GP   +  + K+VF+TG +  I   Q  A+  +       K V+V R  EK ++    I
Sbjct: 12  NGPWKKDTFHGKVVFVTGGAGTICRVQTEAMVLLGC-----KAVIVGRNPEKTRKTAHEI 66

Query: 61  E--AKYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIK 118
                 P S + I  +DV  ++ +   +    ++F  +D +I  A     +D    +   
Sbjct: 67  GQLVHDPHSCLPISSVDVRNVDQLHEAVKVAIQKFGRLDYVIAGAAGNFLADFT-HLSSN 125

Query: 119 DVKGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAF 178
             K ++  ++LG  N  +A       K  G ++ + S       P  S   A+K  + A 
Sbjct: 126 AFKSVVSIDLLGSFNTVKACFPELV-KTKGSVLFVSSTLHYYGVPFQSHVGAAKAGIDAL 184

Query: 179 TESLRRELINTKIRVILIAPG-IVETE 204
           + +L  E+    +R   +APG I  TE
Sbjct: 185 SNALAVEMGPLGLRFNCVAPGAIANTE 211

>Kwal_26.8838
          Length = 323

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 18/118 (15%)

Query: 1   MSQGPKAAERLNEKIVFITGASAGIGQATALE--------YMDASNGTV--KLVLVARRL 50
           + Q P    R + K+  +TG ++GIG  T L         Y+   N +   + +   ++ 
Sbjct: 6   LGQLPYYDIRKDRKVALVTGGNSGIGWYTVLHLYLHGFAVYVAGRNSSRVNRAIKDIKKE 65

Query: 51  EKLQQLKEVIEAKYPKSKVYIGKLDVTELETIQPFLDNLPEEFKD----IDILINNAG 104
            + +  KE  E+++P  ++Y   LD+TEL+ +    D   + F+     +D+LINNAG
Sbjct: 66  ARTRIKKEDPESRHPVGELYFLSLDLTELKLV----DKAAKRFRSLETRLDVLINNAG 119

>Scas_652.19d1
          Length = 344

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 63/131 (48%), Gaps = 10/131 (7%)

Query: 5   PKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKY 64
           P     L++K   +TG + GIG+   +E +   N  V  + V R   K ++ K+ I A  
Sbjct: 33  PADYPDLSDKTAVVTGCNTGIGKHV-VELLYQKNCNV--IGVVRTDAKGEEAKKEIIANN 89

Query: 65  PKSK---VYIGKLDVTELETIQPFLDNLPEEFKD--IDILINNAGKALGSDRVGDIDIKD 119
           PKSK     IG  D  +LE +      + E   D  ++I+I+NAG  +  D  G   ++ 
Sbjct: 90  PKSKGNITIIGGCDYLDLEKVPAVGGKIKEALGDKPLNIIIHNAG-LMAPDNKG-TSVQG 147

Query: 120 VKGMMDTNVLG 130
            + M  TNVLG
Sbjct: 148 YEAMFQTNVLG 158

>Scas_478.2
          Length = 920

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 73/157 (46%), Gaps = 10/157 (6%)

Query: 3   QGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEA 62
           QG    E +  K+V ITGA+ G+G++ A+ +  A  G     ++   +   +     I +
Sbjct: 315 QGSVKVESIKGKVVIITGANGGLGKSHAMWF--AKYGA---KVIINDITNPETTVNEINS 369

Query: 63  KYPKSKVYIGKLD-VTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVK 121
           K+     +    + +TE E +   +    + F  +DIL+NNAG  L       +  K+  
Sbjct: 370 KFGADTAFPDSHNIITESELV---VKTAIDHFGHVDILVNNAG-ILRDKSFLKMTEKEWY 425

Query: 122 GMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAG 158
            ++  ++     + +AV   F K+NSG I+N  S +G
Sbjct: 426 PVLQVHLQATFAMCKAVWPHFSKQNSGFIINTTSTSG 462

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 71/176 (40%), Gaps = 12/176 (6%)

Query: 30  ALEYMDASNGTVKLVLVARRLEKLQQLKEV------IEAKYPKSKVY-IGKLDVTELETI 82
           ALEY       V   L        Q  K        I++KY  + V     ++      I
Sbjct: 27  ALEYAKRGAKVVVNDLGGTLGGSGQNSKAADVVVDEIKSKYNGTAVANYDSVNENGANII 86

Query: 83  QPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLINVTQAVLHIF 142
           +  +DN    F  IDILINNAG  L       +  K+ + ++D ++ G   +T A     
Sbjct: 87  KTAIDN----FGKIDILINNAG-ILRDVSFNKMSEKEFQAVIDVHLNGAFQLTHAAWPYM 141

Query: 143 QKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKIRVILIAP 198
           + +  G I+N  S AG       + Y A+K  +    E+L +E     I V  IAP
Sbjct: 142 KAQKFGRIINTASPAGLFGNFGQANYSAAKLGLVGLAETLAKEGFKYNILVNSIAP 197

>Sklu_1624.3 YBR265W, Contig c1624 1338-2288
          Length = 316

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/258 (20%), Positives = 103/258 (39%), Gaps = 30/258 (11%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLV-ARRLEKL------------QQLK 57
           ++ + + + G S G+G+  A +Y   + GT   V+V +R   KL            Q+L 
Sbjct: 9   VDHQTLLVAGGSQGLGKQFACKYF--AEGTANTVIVVSRSAAKLAAAVKDITGQDAQELT 66

Query: 58  EVIEAKYPKSKVYIGKLDVTELETIQPFLDNLPEE-FKDIDILINNAGKA--LGSDRVGD 114
             +E    +  ++    D+++    +   + L E       +++   G    L  D  GD
Sbjct: 67  VDLEFDSKERNMFYIPCDLSDYHATEKMYELLLERNLSPTQVMLCAGGSTPKLFKDLTGD 126

Query: 115 IDIKDVKGMMDTNVLGLINVTQAVLHIFQKKNSG--DIVNLGSVAGRDAYPTGSIYCASK 172
             +  V+     N +  +N+     H+  +K+S    ++   S      +   S Y   K
Sbjct: 127 ELVTGVQ----VNYMTCLNLA----HVLARKHSSLPHVIFFSSETAFFPFIGYSQYAPMK 178

Query: 173 FAVRAFTESLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLEADDV 232
            +++A    LR+E   ++I  +   PG  E+E   V      E  KS+     P+  D+ 
Sbjct: 179 QSIKALVMILRQEFPESRISCVY--PGNFESEGFEVETLTKPEITKSIEGASTPISCDEC 236

Query: 233 ADLIVYTTSRKQNTVIAD 250
            + IVY   +  + V  D
Sbjct: 237 CNKIVYWLDKGYDDVTTD 254

>Scas_641.31
          Length = 287

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 75/181 (41%), Gaps = 32/181 (17%)

Query: 85  FLDNLP--EEFKD---------IDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133
           F +N+P  EE  D         +++L+N AG    S  +      ++  +M+ N L  ++
Sbjct: 98  FHENIPLFEEIWDKNASNTNYYVNLLVNCAGITQDSLSL-RTSTDEISQIMNINFLSCVS 156

Query: 134 VTQAVL------------------HIFQKKNSGDIVNLGSVAGRDA--YPTGSIYCASKF 173
           ++  V                   H   K     I+N+ S+ G      P  SIY ASK 
Sbjct: 157 LSNFVCKKMIRSQNLFKRGEMALDHELPKPPPPCIINISSILGEGTIQVPGTSIYSASKA 216

Query: 174 AVRAFTESLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLEADDVA 233
           A+  +T +L +E     IR + +APG+V     +        +  ++  G++   +D VA
Sbjct: 217 ALIQYTRTLSQETETWGIRALSMAPGLVTDTDMIQEMDPQTRQQLNLLMGLNCTTSDVVA 276

Query: 234 D 234
           D
Sbjct: 277 D 277

>Scas_652.19d
          Length = 341

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 68/152 (44%), Gaps = 20/152 (13%)

Query: 5   PKAAERLNEKIVFITGASAGIG-QATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAK 63
           P     L  K   ITG + GIG +   L Y    N    ++ V R  EK +  K+    K
Sbjct: 33  PADYPDLTSKTALITGTNTGIGFEVMKLLYSKNCN----IIAVVRSAEKGEAAKKEAIEK 88

Query: 64  YPKSK---VYIGKLDVTELETIQPFLDNLPEEFKD--IDILINNAGKA----LGSDRVGD 114
           YP SK     +G  D  +L T++P  + +     D  ++I+I+NAG       G+ + G 
Sbjct: 89  YPNSKGSISVVGGNDFLDLTTVKPASEEIKLVLGDKPLNIIIHNAGLMAPVNTGTSKQG- 147

Query: 115 IDIKDVKGMMDTNVLGLINVTQAVLHIFQKKN 146
                ++ M  TNVLG   +   +  +F KK+
Sbjct: 148 -----LEAMFSTNVLGPQLLQHFLDPLFLKKD 174

>Kwal_27.11910
          Length = 184

 Score = 40.0 bits (92), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 56/108 (51%), Gaps = 16/108 (14%)

Query: 4   GPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAK 63
           G   A++ N  +V  TGAS GIG+  A +   A  G   LVL++R L KL+ L+   E +
Sbjct: 55  GKYGAKKGNYCVV--TGASDGIGKEYARQM--AKRG-FNLVLISRTLSKLESLQSEFEKE 109

Query: 64  YPKSKVYIGKLDVTE-----LETIQPFLDNLPEEFKDIDILINNAGKA 106
           Y K +V I  +D+++        IQ     +P     I +LINN G++
Sbjct: 110 Y-KVQVRILAIDISQDSAENYSKIQQTCTGIP-----ITVLINNVGQS 151

>YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109)
           Member of the short chain alcohol dehydrogenase/ribitol
           dehydrogenase family [981 bp, 326 aa]
          Length = 326

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 90/204 (44%), Gaps = 18/204 (8%)

Query: 6   KAAERLNEKIVFITGASAGIGQATALEYM-DASNGTVKLVLVARRLEKLQQLKEVIEAKY 64
           K+       IV ITG S G+G+A   + + D SN T+  V +     +  ++K++I    
Sbjct: 63  KSLREFKNGIVLITGGSKGLGRAIVSQLLQDYSNLTILNVDICPSSVRNTRVKDLI---- 118

Query: 65  PKSKVYIGKLDVTELETIQPFLDNLPEEFK-DIDILINNAGKALGSDRVGDIDIKDVKGM 123
                     D+++ E +   L+ L  ++K +I +++NNAG          ++  ++  +
Sbjct: 119 ---------CDLSDDEEVAALLNLLKRKYKNEIRLIVNNAGVRANFTGFNGMERDNLDKI 169

Query: 124 MDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLR 183
              N    +   Q +           IVN+ S+ G       + Y ASK A+ AF +S  
Sbjct: 170 FKINTFAPLQFIQELAPSRHSTRQCYIVNIASILGILTPAKVAAYAASKAALIAFHQSYS 229

Query: 184 RELIN---TKIRVILIAPGIVETE 204
            EL N     IR +L+ PG + TE
Sbjct: 230 FELQNEGVRNIRTLLVTPGQLNTE 253

>Kwal_27.12155
          Length = 280

 Score = 40.0 bits (92), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 70/161 (43%), Gaps = 23/161 (14%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDAS-------NGTVKLVLVARRLEKLQQLKEVIEAK 63
           L  K+  I+GAS+GIG A A  +  A        N    LV  AR L     ++ V+  K
Sbjct: 28  LKGKVACISGASSGIGAAVAEAFAQAGADLAVWYNSHPALVETARDLANTYHVR-VVAYK 86

Query: 64  YPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKG- 122
            P          V + + +Q  +  +  EF  ID+ + NAG A     + D   + V   
Sbjct: 87  CP----------VDDEQQVQATIARVITEFGRIDVFVANAGVAWHEGPLLDAQRRSVADQ 136

Query: 123 ----MMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGR 159
               ++ T+  G+   ++ V  +FQ++  G +V   S++G 
Sbjct: 137 EWNRIIQTDFQGVYYCSKYVGEVFQRQQHGSLVVTASMSGH 177

>ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [990
           bp, 329 aa]
          Length = 329

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 101/244 (41%), Gaps = 51/244 (20%)

Query: 2   SQGPKAAERLNEK--IVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEV 59
           S  P    +L+ K  I  +TG + G+G+                  + R L + Q +  +
Sbjct: 47  SAMPIVGVQLDPKRDIALVTGGAGGLGKE-----------------IVRELRRRQIVTVI 89

Query: 60  IEAKYPK-----SKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGD 114
           ++   P      + V+    D++    I+   +N+  +   + ILINNA  A+ SD   D
Sbjct: 90  LDVVPPPDLESLTGVHFYACDISLPGRIRVIHENIIRDVGHVTILINNA--AITSDLPLD 147

Query: 115 -IDIKDVKGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKF 173
            +D   ++ ++  N+LG   + +  L      + G IVN+ SV G       + Y ASK 
Sbjct: 148 RVDNDKIEQIIRVNLLGPYTLIREFLPSMIAIDRGYIVNIASVLGFVTPARLTAYGASKG 207

Query: 174 AVRAFTESLRRE----------------LINTK--IRVILIAPGIVETEFSVVRYKGDNE 215
            + A  ESL  E                L+ ++  IR +L+ PG + T+        DN 
Sbjct: 208 GLIALHESLVDELEQYTWKDSSNPGYVPLLKSRGVIRSLLVCPGKLTTKMF------DNA 261

Query: 216 RAKS 219
           R+ S
Sbjct: 262 RSPS 265

>AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH]
          (326834..327757) [924 bp, 307 aa]
          Length = 307

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 11 LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVI 60
          LN ++V I+G S G+G+A A +Y++ S+ TV  V+V+R  EKL +  E I
Sbjct: 5  LNGQVVLISGGSQGLGRAFAQKYIEESDSTV--VIVSRSEEKLTRAGEAI 52

>Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement
          Length = 363

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 84/209 (40%), Gaps = 24/209 (11%)

Query: 15  IVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGKL 74
           +  ITG S G+G     ++   +  T  L +V       Q +    E K   + V+    
Sbjct: 85  MALITGGSGGLGLEIVQQFQLLNIKTFILDIVP----PPQMVFGNCEIK-SNTNVFYYPC 139

Query: 75  DVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLINV 134
           D++  + I      +  +  ++ ILINNAG   G  R+ ++  K ++  +  N +     
Sbjct: 140 DISNPKEIAELHKKIKLQHGNVTILINNAGITSGY-RLQELSDKVIEKTIQVNYVSAFYT 198

Query: 135 TQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTK---- 190
            Q  L      + G IVN+ SV G  +    + Y ASK  + +  E+L  EL   K    
Sbjct: 199 IQEFLPDMVSMSRGYIVNVASVLGFMSPARLTAYGASKGGLISLHEALVNELYQIKRTRP 258

Query: 191 --------------IRVILIAPGIVETEF 205
                         I+ +L+ PG ++T  
Sbjct: 259 QDSLHNLSPRSKIPIKALLVCPGKIKTPL 287

>KLLA0A11352g complement(983428..984372) similar to sp|P50167 Pichia
           stipitis D-arabinitol 2-dehydrogenase [ribulose forming]
           (EC 1.1.1.250) (ARDH), start by similarity
          Length = 314

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 96/228 (42%), Gaps = 36/228 (15%)

Query: 10  RLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEA-----KY 64
           RL+  +  +TGA+ G+  A  L     S G+ +L L+   L  L+ +K  +E        
Sbjct: 30  RLDGHVTIVTGAAGGL--AHTLSQALVSQGS-ELALMDLSLPSLENVKTELELFQKQNNI 86

Query: 65  PKSKVYIGKLDVTELETIQPFLDNLPEEFKDI--DILINNAGKALGSDRVGDIDIKDVKG 122
           P  K+ +   D++  + ++  + ++P   K I    L++ AG     +   + D +  + 
Sbjct: 87  PPVKISLWACDISNADEVEMVVKSIPSSHKGIVPQKLVHTAGFCQNIN-AHEYDAEKAQK 145

Query: 123 MMDTNVLGLINVTQAVL---------------HIFQKKNS------GDIVNLGSVAG--- 158
           +++ N+LG + + Q++                HI +   +         V +GS++G   
Sbjct: 146 LVNVNLLGSLYICQSMARQLLARRTRRKSISEHIDESGEAMPQFPEASFVLIGSMSGLIV 205

Query: 159 RDAYPTGSIYCASKFAVRAFTESLRRELINTKIRVILIAPGIVETEFS 206
               P  + Y  SK  V    +SL  E     IRV  I+PG + T  +
Sbjct: 206 NTPQPQCA-YNMSKAGVIHLVKSLAAEWAKFGIRVNAISPGYIATALT 252

>ABR076C [667] [Homologous to ScYKL055C (OAR1) - SH]
           (527756..528571) [816 bp, 271 aa]
          Length = 271

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 97  DILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLINVTQ-AVLHIFQKKNSGD----IV 151
           D+L+N AG +  S           + ++  N+  L+++ Q +V  + + +        IV
Sbjct: 111 DLLVNCAGVSQASLAAHTSADAAAR-LLHVNLGSLVSLCQLSVRPMLRARRVAHARPTIV 169

Query: 152 NLGSVAG---RDAYPTGSIYCASKFAVRAFTESLRRELINTKIRVILIAPGIVE 202
           N+ SV G       P  ++Y ASK AV  ++ +L  EL  T I    +APG+V 
Sbjct: 170 NVASVLGCAHAQPPPGTAVYAASKSAVIQYSRALAAELERTGIACHAVAPGLVP 223

>AER111W [2616] [Homologous to ScYLR426W - SH]
           complement(846805..846884,846937..847840) [984 bp, 327
           aa]
          Length = 327

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 80/190 (42%), Gaps = 38/190 (20%)

Query: 68  KVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTN 127
           +V   + D+++   ++  L+ +  E+  +D+LIN AG       +  +  +++      N
Sbjct: 114 RVRFLRADLSKPADVERVLEQVTREYSRVDVLINCAGMRSRYQGLQAVAPEELHKTFQVN 173

Query: 128 VLGLINVTQAVLHIFQKKNSGD-----IVNLGSVAGRDAYPTGSIYCASKFAVRAFTESL 182
           V        A     QK    D     +V +GS  G  A    S Y A+K A  A+ +S 
Sbjct: 174 VF-------APQRFIQKLAPRDDRQFYLVTVGSTLGILAPARLSAYAATKAATIAYHDSW 226

Query: 183 RRELINT---KIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHP--------LEADD 231
             EL+++   ++R +L+  G ++T                ++ G  P        LE+++
Sbjct: 227 TFELLSSGRQRVRTLLVVLGQMDTR---------------MFQGFRPPRQFLAPVLESEE 271

Query: 232 VADLIVYTTS 241
           +A  IV+  S
Sbjct: 272 LARRIVHCCS 281

>Sklu_2404.13 YKL055C, Contig c2404 24100-25005
          Length = 301

 Score = 35.0 bits (79), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 150 IVNLGSVAGRD---AYPTGSIYCASKFAVRAFTESLRRELINTKIRVILIAPGIV 201
           I+N+ S+ G       P  SIY ASK A+  ++  L +EL  + +RV  ++P +V
Sbjct: 195 IINVSSILGHSKGITLPGTSIYSASKAAIAQYSMVLSQELARSGVRVNCVSPKLV 249

>Scas_650.8
          Length = 326

 Score = 34.3 bits (77), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 81/177 (45%), Gaps = 33/177 (18%)

Query: 5   PKAAERLNEKIVFITGASAGIGQATALE-YMDASNGTVKLVLVARRLEKLQQ-LKEV-IE 61
           P     ++ K+  ITG ++GIG  T L  YM        + L  R   K+++ + E+ IE
Sbjct: 8   PYYNPEVDRKVAVITGGNSGIGWYTVLHLYMHG----FTVYLCGRTSHKIKKAINEITIE 63

Query: 62  AK------------YPKSKVYIGKL-----DVTELETIQPFLDNLPEEFKDIDILINNAG 104
           A+            + K  +++G L     D+T+L+ ++     L +    ID+LINNA 
Sbjct: 64  AEARLGLLEKEVDDFGKD-IHLGSLRYIHMDLTDLKCVEKAAQKLLKLEDKIDVLINNAA 122

Query: 105 -KALGSDRVGD-IDIKDVKGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGR 159
             A+  +   D  +I+     + TN +    +T  +L    KK  G I+ LGS+  R
Sbjct: 123 ILAIPYELTKDGFEIQ-----LQTNYIAHFLLTMRLLPAI-KKCHGRIITLGSLGHR 173

>Kwal_34.16139
          Length = 315

 Score = 33.9 bits (76), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 90/235 (38%), Gaps = 28/235 (11%)

Query: 10  RLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQ-QLKEVIEAK-YPKS 67
           RL+  +  +TG S G+        +   +    L L   RLE  + +L E  +A    K+
Sbjct: 31  RLDGHVTIVTGGSGGLAHTLTQALLAQGSEVALLDLNVERLEYTKRELLEFAKANNLSKA 90

Query: 68  KVYIGKLDVTELETIQPFLDNLPEEFKDI--DILINNAGKALGSDRVGDIDIKDVKGMMD 125
            V     D+ + + +   +  +P +   I  D LI+ AG       + + D +  + ++ 
Sbjct: 91  NVSAWPCDIGDPDIVDEVVRAIPLKHNGIVPDKLIHTAGYCQNVPAL-EYDARQAEAVVR 149

Query: 126 TNVLGLINVTQAV-LHIFQKKNSGDIVNLGSVAGRDAYP-------------TGSI---- 167
            N++G + + Q++   + QK      V+  S    +A P             +G I    
Sbjct: 150 VNLMGSLYICQSMSRQLLQKVQRRKSVSSASGEAGEALPQFPHASYVLIGSMSGCIVNNP 209

Query: 168 -----YCASKFAVRAFTESLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERA 217
                Y  SK  V     SL  E     IRV  I+PG + T  +     G  E A
Sbjct: 210 QPQVAYNMSKAGVIHMVRSLACEWARYGIRVNSISPGYIATALTKKVISGSPEGA 264

>CAGL0K09152g 909456..910439 highly similar to tr|Q08651
           Saccharomyces cerevisiae YOR246c, hypothetical start
          Length = 327

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 55/122 (45%), Gaps = 23/122 (18%)

Query: 2   SQGPKAAERLNEKIVFITGASAGIGQATALE-YMDASNGTVKLVLVARRLEKLQQ-LKEV 59
           S+ P    ++++++  +TG ++GIG  T L  YM       ++ +  R   K+ + + ++
Sbjct: 6   SELPYYNPQVDDRVAVVTGGNSGIGWFTVLHLYMHG----FRVYVCGRNSHKVSRAMDDI 61

Query: 60  IEAKYPKSKVYIGKL-----------------DVTELETIQPFLDNLPEEFKDIDILINN 102
           IE    +  +Y+  L                 D+T+L+ +      +      +D+L+NN
Sbjct: 62  IEEAVRRHNLYLKGLHDQKPTRYLGSLQYLHTDLTDLKCVDRAAAKILRMENHLDVLVNN 121

Query: 103 AG 104
           AG
Sbjct: 122 AG 123

>CAGL0M13013g complement(1281291..1282103) similar to sp|P35731
           Saccharomyces cerevisiae YKL055c OAR1, hypothetical
           start
          Length = 270

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 12/126 (9%)

Query: 86  LDNLPEEFKDIDILINNAGKALGSDRVG-DIDIKDVKGMMDTNVLGLINVTQAVLHIFQK 144
            DN       + +L+N AG    S  VG  +    +  M++ N    + ++     +  K
Sbjct: 105 FDNNDSNRYTLRVLVNCAGITQAS--VGIRMSPNVISNMINVNFASAVYLSNYAARLQMK 162

Query: 145 KNSG---DIVNLGSVAG-----RDAYPTG-SIYCASKFAVRAFTESLRRELINTKIRVIL 195
           + S    DI+N+ S+ G     R+    G SIY A+K A+  FT    +E+    I    
Sbjct: 163 QKSRKRLDIINVSSILGGFADKRNFMIQGTSIYSATKAALSQFTRVYGKEVERLSINCHD 222

Query: 196 IAPGIV 201
           IAPG++
Sbjct: 223 IAPGLI 228

>KLLA0D06127g complement(526164..527156) similar to sgd|S0005772
           Saccharomyces cerevisiae YOR246c, start by similarity
          Length = 330

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 99/234 (42%), Gaps = 48/234 (20%)

Query: 5   PKAAERLNEKIVFITGASAGIGQATALE-YMDASNGTVKLVLVARRLEK----LQQLKEV 59
           P    +++ K+  +TG ++GIG  T L  Y+       K+ L  R   +    ++++K+ 
Sbjct: 11  PYYDPKVDNKVALVTGGNSGIGYYTVLHLYLHG----FKVYLGGRNSSRVNHAIKEIKKE 66

Query: 60  IEAKY-------PKSKVYI---GKL-----DVTELETIQPFLDNLPEEFKDIDILINNAG 104
            E +        P   + I   GKL     D+T+L +++        +   +D+LINNAG
Sbjct: 67  AEIRLRKGQDEKPHDGLMIRKTGKLEYLHIDLTDLNSVEKAATKFTVQEDHLDVLINNAG 126

Query: 105 -KALGSDRVGDIDIKDVKGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSV------- 156
             A+  +   D    + +  M TN +    +T  +L +  K   G ++ + S+       
Sbjct: 127 VMAIPYELTKD----NFEIQMQTNYVSHFLLTMRLLPLI-KARKGRVITVSSLGHNLIFF 181

Query: 157 -----AGRDAYPT----GSIYCASKFAVRAFTESLRRELINTKIRVILIAPGIV 201
                A  + +P+       Y  +K A   FT+ L   + N  I  + + PG+V
Sbjct: 182 NCNPGAQFNYWPSMFFMWCRYALAKTASIQFTKML--AIKNPDILCMSLHPGLV 233

>Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement
          Length = 326

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 54/119 (45%), Gaps = 21/119 (17%)

Query: 3   QGPKAAERLNEKIVFITGASAGIGQATALE-YMDASNGTVKLVLVARRLEKLQQLKEVIE 61
           Q P    +   K+  +TG ++GIG  T L  YM      V     +R  + ++ ++   +
Sbjct: 8   QLPYYNPQKERKVALVTGGNSGIGWYTVLHLYMHGFIVYVGGRNSSRVNQAIKAIQNEAK 67

Query: 62  AKYPKS------------KVYIGKLDVTELETIQPFLDNLPEEFK----DIDILINNAG 104
           ++  KS            K++   LD+++L ++    D    +FK     +D+LINNAG
Sbjct: 68  SRQRKSTFKGLKLERNFGKLHFLSLDLSDLRSV----DKAAAKFKGLELSLDVLINNAG 122

>Scas_566.11
          Length = 346

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 94/244 (38%), Gaps = 53/244 (21%)

Query: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLV--ARRLEKLQQLKEVIEAKYPKSKVYI 71
           K++ ITG ++ +G   A  ++D +    +L  +  +R L +++++ E+I+    +  V +
Sbjct: 5   KVIVITGTNSNLGLNIAYRFIDNTPKDARLTFIVTSRTLLRVKEVVELIK----RHVVEV 60

Query: 72  GKLDVTELETIQPFLDN----------LPEEFKDIDILINNAGKAL--GSDRVG------ 113
           G + V + + I     N          L + +K+I     NA + +  G D +G      
Sbjct: 61  GHIGVVDYDYILVDFTNMVSVLNAYYELNKTYKEIHYFFVNAAQRVYDGIDWIGAVKEVI 120

Query: 114 ---------------DIDIKDVKGM---MDTNVLGLINVTQAVLHIFQKKNSGDIVNLGS 155
                           I +K   GM      NV G   + Q +L + +  N G IV + S
Sbjct: 121 SNPLEAVTNPTYKIQRIGVKSKDGMGLVFQANVFGPYYLIQKLLPLLKAGN-GTIVWISS 179

Query: 156 VAGRDAY---------PTGSIYCASKFAVRAFTESLRRELINTKIRVILIAPGIVETEFS 206
           V     Y          T + Y  SK  V     +   E     I   ++ PGI  T  S
Sbjct: 180 VMSAPKYLSLQDIELLKTDASYEGSKRLVDLLHLATYEERKKLGIHQYVVQPGIF-TSHS 238

Query: 207 VVRY 210
             +Y
Sbjct: 239 FFKY 242

>KLLA0B04994g complement(453048..454244) some similarities with
           sgd|S0004435 Saccharomyces cerevisiae YLR443w ECM7
           involved in cell wall biogenesis and architecture,
           hypothetical start
          Length = 398

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 13/93 (13%)

Query: 60  IEAKYPKSKVYIGKLDVTELETIQPFLDNLPE-----EFKDIDILINNAG----KALGSD 110
           I A  P S +Y+G+LD + +  +Q   D L       +  DI+   N AG    + L   
Sbjct: 52  ISAASPNS-LYLGRLDTSNVNILQGLFDKLSSSVVSAKLSDIN---NGAGLTTAEILLLT 107

Query: 111 RVGDIDIKDVKGMMDTNVLGLINVTQAVLHIFQ 143
           R  D  + DV   + T V G  ++  A   ++Q
Sbjct: 108 RYVDSQVHDVPDYIKTGVYGWCSMKHASQELWQ 140

>YLR100W (ERG27) [3516] chr12 (341811..342854) 3-Keto sterol
           reductase, required for ergosterol biosynthesis [1044
           bp, 347 aa]
          Length = 347

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 58/121 (47%), Gaps = 20/121 (16%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLV--ARRLEKLQQLKEVIEAKYPKSK 68
           +N K+  +TG ++ +G       ++  +  V+L +V  +R L ++Q++   I+  Y KS 
Sbjct: 1   MNRKVAIVTGTNSNLGLNIVFRLIETEDTNVRLTIVVTSRTLPRVQEVINQIKDFYNKS- 59

Query: 69  VYIGK------------LDVTELETIQPFLDNLPEEFKDIDILINNAGKAL--GSDRVGD 114
              G+            +D T + ++     ++ ++++ I+ L  NA + +  G D +G 
Sbjct: 60  ---GRVEDLEIDFDYLLVDFTNMVSVLNAYYDINKKYRAINYLFVNAAQGIFDGIDWIGA 116

Query: 115 I 115
           +
Sbjct: 117 V 117

>KLLA0F01749g complement(163821..164762) similar to sp|P38342
          Saccharomyces cerevisiae YBR265w TSC10
          3-ketosphinganine reductase singleton, start by
          similarity
          Length = 313

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 11 LNEKIVFITGASAGIGQATALEYMDASNG----TVKLVLVARRLEKLQQLKEVI 60
           N +++ I+G S G+G++ A  ++   +G    T K+++V+R   KL +  E I
Sbjct: 6  CNGQVILISGGSQGLGESFAKRFVQDDDGPGSNTNKVIIVSRSQSKLVKACERI 59

>CAGL0H08019g 781773..783050 highly similar to sp|P40160
           Saccharomyces cerevisiae YNL207w, start by similarity
          Length = 425

 Score = 28.9 bits (63), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 24/38 (63%)

Query: 11  LNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVAR 48
           LN+++V+  G + G+G+ + +  +   NGT K++ + R
Sbjct: 89  LNQEVVYSVGNTIGVGKESDIYQVSDRNGTAKVMKIHR 126

>ACL140C [909] [Homologous to ScYGR214W (RPS0A) - SH; ScYLR048W
           (RPS0B) - SH] (105871..106542,106643..106732) [762 bp,
           253 aa]
          Length = 253

 Score = 28.5 bits (62), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 40/90 (44%), Gaps = 18/90 (20%)

Query: 19  TGASAGIGQATA---LEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGKLD 75
           TGA+A  G+ T      Y+  S    +LV+V       Q +KE        S V I  + 
Sbjct: 93  TGATAIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEA-------SYVNIPVIA 145

Query: 76  VTELETIQPFLDNLPEEFKDIDILINNAGK 105
           +T+LE+        P E+ D+ I  NN GK
Sbjct: 146 LTDLES--------PSEYVDVAIPCNNRGK 167

>ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH]
           (640832..643438) [2607 bp, 868 aa]
          Length = 868

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 115 IDIKDVKGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGS 166
           I+I+ +   +DTN  G   VT   + +   ++SG    L S+ GRD  P GS
Sbjct: 190 IEIRSILNRVDTNTPG---VTLPSIVVVGSQSSGKSSVLESIVGRDFLPKGS 238

>Kwal_27.11301
          Length = 700

 Score = 28.1 bits (61), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 45/83 (54%), Gaps = 6/83 (7%)

Query: 51  EKLQQLKEVIEAKY--PKSKVYIG---KLDVTELETIQPFLDNLPEEFKDIDILIN-NAG 104
           ++ +QLK ++E  Y  P+ K Y     KL + +  T +  +  + ++F   +I  + NAG
Sbjct: 163 KRYEQLKSLLEMAYTLPQLKAYANEFYKLKLPKSTTKKAVIKTILQDFWQCEIDESINAG 222

Query: 105 KALGSDRVGDIDIKDVKGMMDTN 127
           + L  +R+ D+  +D+  ++ TN
Sbjct: 223 QDLIIERIIDVQTRDIYLLLLTN 245

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,076,741
Number of extensions: 342102
Number of successful extensions: 1343
Number of sequences better than 10.0: 108
Number of HSP's gapped: 1251
Number of HSP's successfully gapped: 118
Length of query: 267
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 167
Effective length of database: 13,134,309
Effective search space: 2193429603
Effective search space used: 2193429603
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)