Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_594.165165129630.0
YMR232W (FUS2)6772245064e-55
KLLA0B13068g6712203777e-38
ABL013C6982213227e-31
Kwal_55.203146572203228e-31
CAGL0M04917g5861611337e-08
Kwal_26.9189172629731.2
YMR053C (STB2)85060676.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_594.1
         (651 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_594.1                                                           1145   0.0  
YMR232W (FUS2) [4188] chr13 (736925..738958) Protein required fo...   199   4e-55
KLLA0B13068g complement(1140423..1142438) weakly similar to sp|Q...   149   7e-38
ABL013C [579] [Homologous to ScYMR232W (FUS2) - SH] (372925..375...   128   7e-31
Kwal_55.20314                                                         128   8e-31
CAGL0M04917g 537760..539520 weakly similar to sp|Q05670 Saccharo...    56   7e-08
Kwal_26.9189                                                           33   1.2  
YMR053C (STB2) [4013] chr13 complement(380345..382897) Protein o...    30   6.1  

>Scas_594.1
          Length = 651

 Score = 1145 bits (2963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/651 (88%), Positives = 573/651 (88%)

Query: 1   DSDLFNAWYESXLKIGNLQKLEDIFKRPINRVNEWILILNDLISASKEATHTSNYERLIE 60
           DSDLFNAWYES LKIGNLQKLEDIFKRPINRVNEWILILNDLISASKEATHTSNYERLIE
Sbjct: 1   DSDLFNAWYESXLKIGNLQKLEDIFKRPINRVNEWILILNDLISASKEATHTSNYERLIE 60

Query: 61  TRNRYKDFQKHIREQADEYNGNTMYNFSLTPNEIIQSYDNAICSPKHDQPQVVVYPPLND 120
           TRNRYKDFQKHIREQADEYNGNTMYNFSLTPNEIIQSYDNAICSPKHDQPQVVVYPPLND
Sbjct: 61  TRNRYKDFQKHIREQADEYNGNTMYNFSLTPNEIIQSYDNAICSPKHDQPQVVVYPPLND 120

Query: 121 AIPYTDSFAANTYGSLQXXXXXXXXXXXXXXXXXXXXXVDLKDHSNKENICKDSVFQPPQ 180
           AIPYTDSFAANTYGSLQ                     VDLKDHSNKENICKDSVFQPPQ
Sbjct: 121 AIPYTDSFAANTYGSLQSRRSLSVASTSSSHYSSNNGSVDLKDHSNKENICKDSVFQPPQ 180

Query: 181 LTLNDXXXXXXXXXXXXXXXXXXXXXXDFHAVLDFNLRLGKTWKKMLDFDHPHDSHDTKY 240
           LTLND                      DFHAVLDFNLRLGKTWKKMLDFDHPHDSHDTKY
Sbjct: 181 LTLNDHIHKFKHIHKKLKILVGLIGNLDFHAVLDFNLRLGKTWKKMLDFDHPHDSHDTKY 240

Query: 241 SRYMDTILKLKEQETILKLTDLETTVLLPLARMGKYCEVVXXXXXXXXXXXXXYMIYLQE 300
           SRYMDTILKLKEQETILKLTDLETTVLLPLARMGKYCEVV             YMIYLQE
Sbjct: 241 SRYMDTILKLKEQETILKLTDLETTVLLPLARMGKYCEVVKLRLKDLKSLKKDYMIYLQE 300

Query: 301 RKTKIHDVKRDVIGKHFENMQRQLTDELPIFIDLFHRIFEVVVINYSQVMLKYLETMSGG 360
           RKTKIHDVKRDVIGKHFENMQRQLTDELPIFIDLFHRIFEVVVINYSQVMLKYLETMSGG
Sbjct: 301 RKTKIHDVKRDVIGKHFENMQRQLTDELPIFIDLFHRIFEVVVINYSQVMLKYLETMSGG 360

Query: 361 EADLSQDVSSLQKKNFDILEAFSESRYNTKRAIRENWSFPGDPSGSRVVRKLFELXYLIP 420
           EADLSQDVSSLQKKNFDILEAFSESRYNTKRAIRENWSFPGDPSGSRVVRKLFEL YLIP
Sbjct: 361 EADLSQDVSSLQKKNFDILEAFSESRYNTKRAIRENWSFPGDPSGSRVVRKLFEL*YLIP 420

Query: 421 QQMFKTSKLFDDLHYPATDSLTPIRDYKNDYFHRDDNKLPNVTRFPVLNNSTKISSHLKD 480
           QQMFKTSKLFDDLHYPATDSLTPIRDYKNDYFHRDDNKLPNVTRFPVLNNSTKISSHLKD
Sbjct: 421 QQMFKTSKLFDDLHYPATDSLTPIRDYKNDYFHRDDNKLPNVTRFPVLNNSTKISSHLKD 480

Query: 481 TTNFYENIKRPASLDLSEIGEPLNKKLYSPLNLDRFQKVVQLETPTNEGTTVPLLDIIRR 540
           TTNFYENIKRPASLDLSEIGEPLNKKLYSPLNLDRFQKVVQLETPTNEGTTVPLLDIIRR
Sbjct: 481 TTNFYENIKRPASLDLSEIGEPLNKKLYSPLNLDRFQKVVQLETPTNEGTTVPLLDIIRR 540

Query: 541 LYESELEYAEFLTIADSAYRKTLHEITTFRDKLLRKDSNEELLLFGNLDXXXXXXXXXXX 600
           LYESELEYAEFLTIADSAYRKTLHEITTFRDKLLRKDSNEELLLFGNLD           
Sbjct: 541 LYESELEYAEFLTIADSAYRKTLHEITTFRDKLLRKDSNEELLLFGNLDTISSISIIFST 600

Query: 601 XXXXXXXXXXSQEALDNETWRTINTSMVNGSISSSLLNIAEPFENNLLRIR 651
                     SQEALDNETWRTINTSMVNGSISSSLLNIAEPFENNLLRIR
Sbjct: 601 SLKNLLLKNNSQEALDNETWRTINTSMVNGSISSSLLNIAEPFENNLLRIR 651

>YMR232W (FUS2) [4188] chr13 (736925..738958) Protein required for
           cell fusion during mating, localizes to dots beneath the
           tip of mating projection (shmoo) [2034 bp, 677 aa]
          Length = 677

 Score =  199 bits (506), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 142/224 (63%), Gaps = 16/224 (7%)

Query: 208 DFHAVLDFNLRLGKTWKKMLDFDHPHDS---HD----TKYSRYMDTILKLKEQETILKLT 260
           D   ++D +LR    WKK+++ + P  +   HD    T  S Y+D + + K Q TILKLT
Sbjct: 454 DLSGIIDISLRRINAWKKVIECERPSGAFFAHDNLISTMCSSYIDKLHEQKNQVTILKLT 513

Query: 261 DLETTVLLPLARMGKYCEVVXXXXXXXXXXXXXYMIYLQERKTKIHDVKRDVIGKHFENM 320
           +LET V+ PL R+  +C  V             YM++LQE+K  + D+KRD++G HF+N+
Sbjct: 514 ELETDVMNPLERIIAHCTTVKSKLKDLQALKKDYMLFLQEKKANVRDIKRDLLGMHFQNL 573

Query: 321 QRQLTDELPIFIDLFHRIFEVVVINYSQVMLKYLETMSGGEADLSQDVSSL--------- 371
           Q Q+  ELP+FI L H   E +++NY +V LKYLE ++GG+  L +D+ ++         
Sbjct: 574 QNQMKRELPVFITLIHDTIECILLNYIKVFLKYLEIIAGGKKYLQKDLENMSLNDSIATG 633

Query: 372 QKKNFDILEAFSESRYNTKRAIRENWSFPGDPSGSRVVRKLFEL 415
           Q KN DIL+ +S+SRY TKR +R++W FPGDPSGSRVVRKLFEL
Sbjct: 634 QIKNLDILQCYSKSRYMTKRMVRKDWPFPGDPSGSRVVRKLFEL 677

 Score =  152 bits (385), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 129/234 (55%), Gaps = 9/234 (3%)

Query: 423 MFKTSKLFDDLHYPATDSLTPIRDYKNDYFHRDDNKLPNVTRFPVLNNSTKISSHLKDTT 482
           MFKTS    DL+YP  DSLTPIRDYKNDYFH++D+KLP + R P    + K+S H     
Sbjct: 1   MFKTSYNLYDLNYPKNDSLTPIRDYKNDYFHKNDDKLPEIVRKP----TRKLSKHENKLN 56

Query: 483 NFYENIKRPASLDLSEIGEPL-NKKLYSPLNLDRFQKVVQL----ETPTNEGTTVPLLDI 537
           +     KRPASLDL  I E L NKK+YSP+N + FQ VV+L    + P +         I
Sbjct: 57  DKKFTNKRPASLDLHSIVESLSNKKIYSPINTEIFQNVVRLNLSPQIPNSPHEGCKFYKI 116

Query: 538 IRRLYESELEYAEFLTIADSAYRKTLHEITTFRDKLLRKDSNEELLLFGNLDXXXXXXXX 597
           ++  Y SE+EY   L  A++ YRK L+    F++KL++ DS++ELLLFGN+D        
Sbjct: 117 VQEFYLSEVEYYNNLLTANNVYRKALNSDPRFKNKLVKLDSSDELLLFGNIDTIASISKI 176

Query: 598 XXXXXXXXXXXXXSQEALDNETWRTINTSMVNGSISSSLLNIAEPFENNLLRIR 651
                          + LD   W+ I T         S  +I+E FE +LLRI+
Sbjct: 177 LVTAIKDLLLAKQRGKMLDANEWQKIFTKNEVQQQLYSTFDISEAFEQHLLRIK 230

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 60/114 (52%), Gaps = 7/114 (6%)

Query: 4   LFNAWYESXLKIGNLQKLEDIFKRPINRVNEWILILNDLISASKEATHTSNYERLIETRN 63
            FN WYE  LK     KLEDI K P+ R+ +WI  L  L S  ++        +L  TR 
Sbjct: 257 FFNKWYEYCLKESGCIKLEDILKSPMKRLTQWIDTLETLESCYEDILSPELGLKLSPTRR 316

Query: 64  RYKDFQKHIREQADEYNGNTMYNFSLTPNEIIQSYDNAICSPKHDQPQVVVYPP 117
           +Y  F   +  +  EY  N+MYNFSLTP+EIIQSYD        DQ   ++ PP
Sbjct: 317 KYSLFSNKLETEVSEYKSNSMYNFSLTPSEIIQSYD-------EDQFTHLLKPP 363

>KLLA0B13068g complement(1140423..1142438) weakly similar to
           sp|Q05670 Saccharomyces cerevisiae YMR232w FUS2 required
           for cell fusion during mating singleton, start by
           similarity
          Length = 671

 Score =  149 bits (377), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 127/220 (57%), Gaps = 12/220 (5%)

Query: 208 DFHAVLDFNLRLGKTWKKMLDFD------HPHDSHDTKYSRYMDTILKLKEQETILKLTD 261
           +   VLD  L +  TWK +++F+      H  D+  T Y  Y++ I K ++Q  IL+L D
Sbjct: 452 ELAKVLDRTLTIAITWKNLIEFEPPNEMFHSGDNERTIYGTYVEKIDKQRQQVMILQLQD 511

Query: 262 LETTVLLPLARMGKYCEVVXXXXXXXXXXXXXYMIYLQERKTKIHDVKRDVIGKHFENMQ 321
           L   V+ PL  + +    V             YM YL++R T+ HD K+ ++   F+++Q
Sbjct: 512 LRRKVIKPLQHLLQRFATVKQKLADRNSLKKEYMAYLRQRDTETHDAKKQILANSFQDLQ 571

Query: 322 RQLTDELPIFIDLFHRIFEVVVINYSQVMLKYLETMSGGEADLSQD---VSSLQK---KN 375
            QL + LPIF +       ++V  Y+ +M++Y++ +SGG+  L+++   V+S Q+    N
Sbjct: 572 HQLAESLPIFNEYAREAITLLVSQYTLLMMEYMQIISGGDQFLNKELELVNSGQRDLGDN 631

Query: 376 FDILEAFSESRYNTKRAIRENWSFPGDPSGSRVVRKLFEL 415
           FDIL+ F  SRY T+ AIRENW++ GDP  S+VVR+LFEL
Sbjct: 632 FDILQLFCSSRYYTRHAIRENWTYHGDPRASKVVRRLFEL 671

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 90/170 (52%), Gaps = 14/170 (8%)

Query: 433 LHYPATDSLTPIRDYKND------YFHRDDNKLPNVTRFPVLNNSTKISSHLKDTTNFYE 486
           L+YP+ +S+TPIR  + D      ++  + N   N + +     + +    +K++     
Sbjct: 11  LNYPSNNSVTPIRTCREDKYVLPNFYQTNHNPYSN-SLWNTSEENREALKRIKESAASKR 69

Query: 487 NIKRPASLDLSEIG-------EPLNKKLYSPLNLDRFQKVVQLETPTNEGTTVPLLDIIR 539
             +   S DL +         EP +KK YSPL+++ F + + L++   +  T+  +  ++
Sbjct: 70  TREDDCSDDLEKQSIIWESEQEPQSKKTYSPLDVETFSQKMNLDSARPDSKTLSFIQTLQ 129

Query: 540 RLYESELEYAEFLTIADSAYRKTLHEITTFRDKLLRKDSNEELLLFGNLD 589
           +L ESE +Y E L++  S Y++       FR+KLL + SN+ELLLFGNLD
Sbjct: 130 KLLESEQQYFEMLSLCLSTYKEEACHNKKFRNKLLNRASNDELLLFGNLD 179

>ABL013C [579] [Homologous to ScYMR232W (FUS2) - SH]
           (372925..375021) [2097 bp, 698 aa]
          Length = 698

 Score =  128 bits (322), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 123/221 (55%), Gaps = 16/221 (7%)

Query: 208 DFHAVLDFNLRLGKTWKKMLDFDHPHDSH-------DTKYSRYMDTILKLKEQETILKLT 260
           D   ++   L   KTW +++DF+ PH+ +        + Y+ ++D +   +E+ ++L++ 
Sbjct: 481 DLAEIICQQLANAKTWHRLMDFE-PHNENCNNSIYISSIYTAFIDKLNHQREEISVLRVK 539

Query: 261 DLETTVLLPLARMGKYCEVVXXXXXXXXXXXXXYMIYLQERKTKIHDVKRDVIGKHFENM 320
            L+  V+ PL  +    + V             Y  Y+++R    HD+K+ V+ + FE+ 
Sbjct: 540 HLKKGVIDPLLVLLARTDSVRGKIDDLKVLSKEYKAYMKQRD--YHDIKKKVMAQSFEDA 597

Query: 321 QRQLTDELPIFIDLFHRIFEVVVINYSQVMLKYLETMSGGEADLSQDVSSLQKK------ 374
           Q  L  ELP F+   H+    +++ Y  ++L+YL+ + GGE  L ++++  ++       
Sbjct: 598 QALLAKELPQFMAFMHKSISYLLLRYHSLVLEYLKILCGGEKLLKKELTFFEESERELGD 657

Query: 375 NFDILEAFSESRYNTKRAIRENWSFPGDPSGSRVVRKLFEL 415
           NFDIL+ FS SR+ TK+A+R NW FPG PS SRV+RKLFEL
Sbjct: 658 NFDILQMFSSSRFYTKQAVRGNWQFPGIPSASRVLRKLFEL 698

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 89/173 (51%), Gaps = 7/173 (4%)

Query: 423 MFKTSKLFDDLHYPATDSLTPIRDYKNDYFHRDDN-KLPNVTRFPVLNNSTKISSHLKDT 481
           M K+      L YPAT  +TPIRDY  +   ++ N +   V R P   +  +     K T
Sbjct: 44  MIKSKNSIYQLAYPATGEMTPIRDYAAECQLQNRNLQQGKVRRNPYSESLWEALGENKRT 103

Query: 482 TNF----YENIKRPASLDLSEIGE-PLNKKLYSPLNLDRFQKVVQLETPTNEGTTVPLLD 536
                    N  RP SL L +  + P+ KK+ SPLNL  F   + L++P  +   +  LD
Sbjct: 104 IQRINTQVRNRHRPRSLKLEQEADIPVRKKVDSPLNLRTFGDYMTLKSPKVDPKLLNTLD 163

Query: 537 IIRRLYESELEYAEFLTIADSAYRKTLHEITTFRDKLLRKDSNEELLLFGNLD 589
           +++RL ++E EY + L + +S YR  L +       LL K+ N+ELLLFG+L+
Sbjct: 164 VVKRLVQTEREYIKKLELGNSVYRFEL-QAKKVGSMLLDKERNDELLLFGDLE 215

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 49/101 (48%)

Query: 2   SDLFNAWYESXLKIGNLQKLEDIFKRPINRVNEWILILNDLISASKEATHTSNYERLIET 61
           S ++  WY+  L+  +L KLEDI K P+ R+  W  I   ++  ++  +      +L + 
Sbjct: 303 STIYFKWYDRCLQKADLIKLEDILKLPVERLRTWGAITEQVLLYTEGISSDLATAQLSDF 362

Query: 62  RNRYKDFQKHIREQADEYNGNTMYNFSLTPNEIIQSYDNAI 102
            ++Y  + + +     E N     N  LTP +II  Y+ ++
Sbjct: 363 YDQYCVYLRGVSTSERECNCEAKANLELTPTQIIHFYECSV 403

>Kwal_55.20314
          Length = 657

 Score =  128 bits (322), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 124/220 (56%), Gaps = 14/220 (6%)

Query: 208 DFHAVLDFNLRLGKTWKKMLDFD------HPHDSHDTKYSRYMDTILKLKEQETILKLTD 261
           D  A+LD NLR  + W+ + +F+        H + ++ Y+ Y+D I + +++  ++KL D
Sbjct: 440 DLAAILDENLRQAEEWRNIFEFEPLSDLLTEHTNVESIYTIYIDKIHQQRQEVMLIKLGD 499

Query: 262 LETTVLLPLARMGKYCEVVXXXXXXXXXXXXXYMIYLQERKTKIHDVKRDVIGKHFENMQ 321
           L+  VL PL  + + C+ V             YM +LQ + T+  +VK +++ KHF ++Q
Sbjct: 500 LQEKVLSPLRHIIQCCKAVHVKIQDLKYLKKDYMAFLQAKDTR--NVKMEIVVKHFLSLQ 557

Query: 322 RQLTDELPIFIDLFHRIFEVVVINYSQVMLKYLETMSGGEADLSQDVSSLQKK------N 375
            +L  ELP F+ L  +    ++  Y+++ML YL  +SGG   L +++  L+        N
Sbjct: 558 GELLSELPTFLHLTSQFTIYLISFYNRIMLDYLRVLSGGSRLLKRELQLLETGEREPGDN 617

Query: 376 FDILEAFSESRYNTKRAIRENWSFPGDPSGSRVVRKLFEL 415
           FDIL++FS SR+ TK+ I ENW+  G    SR+VR LFE+
Sbjct: 618 FDILQSFSSSRFYTKQLIHENWNCHGRAMESRLVRGLFEI 657

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 88/191 (46%), Gaps = 35/191 (18%)

Query: 423 MFKTSKLFDDLHYPATDSLTPIRDYKNDYFHRDDN---------KLPN----------VT 463
           M K++    ++ YPA   LTPIRD   D+F    N         ++P            T
Sbjct: 1   MIKSTNSIYNIDYPAKSVLTPIRDSGQDFFVTKGNAGKFGQFGSRIPEDFNPYAKSMWTT 60

Query: 464 RFPVLNNS---TKISSHLKDTTNFYE-NIKRPASLDLSEIGEPLNKKLYSPLNLDRFQKV 519
                NN+    KI+S  +D  +F E + K   + +LS   EPL+ KL         +  
Sbjct: 61  EDGYKNNAQKLKKITSMRRDKVSFQEADSKELIASNLSPT-EPLDLKLQK-------ETK 112

Query: 520 VQLETP-TNEGTTVPLLDIIRRLYESELEYAEFLTIADSAYRKTLHEITTFRDKLLRKDS 578
            QL +  T++G     L       + E +YA F    +  YRK LH+  + + +L+ ++S
Sbjct: 113 SQLSSEFTDKGKA--FLTSFYSFLKREEDYAYFTDSLNMVYRKELHDHKS-KHRLIDRNS 169

Query: 579 NEELLLFGNLD 589
           N+E+LLFGN+D
Sbjct: 170 NDEILLFGNMD 180

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 6/70 (8%)

Query: 2   SDLFNAWYESXLKIGNLQKLEDIFKRPINRVNEWILILNDLISASKEATHTSNYERLIET 61
           S  +  WYE+ LK  +  +LEDI + P+ R++++    +DL+  S  A    + E   + 
Sbjct: 266 SAAYYKWYETCLKKADFNRLEDILEAPMKRIHDF---YDDLLDVSTHAEGFISPEACGKI 322

Query: 62  R---NRYKDF 68
           +   NRY +F
Sbjct: 323 KSFLNRYLEF 332

>CAGL0M04917g 537760..539520 weakly similar to sp|Q05670
           Saccharomyces cerevisiae YMR232w FUS2 required for cell
           fusion during mating, hypothetical start
          Length = 586

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 78/161 (48%), Gaps = 22/161 (13%)

Query: 429 LFDDLHYPATDSLTPIRDYKNDYFHRDDNKLPNVTRFPVLNNSTKISSHLKDTTNFYENI 488
           +++     + +SLTPIRDY ND+FH +D+KLPN+TR             +KD    Y   
Sbjct: 1   MYEQFQMISKNSLTPIRDYNNDFFHANDSKLPNLTR-------------VKDG---YGGA 44

Query: 489 KRPASLDLSEIGEPLNKKLYSPLNLDRFQKVVQLETPTNEGTTVPLLDIIRRLYESELEY 548
           +   S  +    + ++ K+      DR +K       T +   + L +++++   SE +Y
Sbjct: 45  RASYSDSIGGDLDTMDNKID-----DRVKKSSNSSVLT-DMKNINLREMLKKFIFSEEKY 98

Query: 549 AEFLTIADSAYRKTLHEITTFRDKLLRKDSNEELLLFGNLD 589
            E    A ++YR  +        K+   +S E+++LFGNL+
Sbjct: 99  IEMTEKALTSYRFNMQNKKMRSKKIFDPNSKEDVILFGNLE 139

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 72/149 (48%), Gaps = 6/149 (4%)

Query: 222 TWKKMLD------FDHPHDSHDTKYSRYMDTILKLKEQETILKLTDLETTVLLPLARMGK 275
           +W  +L       F + H+  + K +  +    + KE+    K   LE+ ++  L  +  
Sbjct: 396 SWTSLLSIEKDSVFQNIHEQLNNKINLCVKLYKEKKEELGAFKFLKLESFIIKKLETVLA 455

Query: 276 YCEVVXXXXXXXXXXXXXYMIYLQERKTKIHDVKRDVIGKHFENMQRQLTDELPIFIDLF 335
             + V             Y+I+ +E++ K+ D+KR ++G H+E +Q +L ++LP F+   
Sbjct: 456 LMKTVKGYINDLKVLHKDYLIFKKEKQMKLQDIKRTLLGTHYEQIQNKLVEQLPRFLTYI 515

Query: 336 HRIFEVVVINYSQVMLKYLETMSGGEADL 364
           ++   + +++++  +   L+ +   +ADL
Sbjct: 516 NQFMVLFLLSFNAYLRDALDILISVQADL 544

>Kwal_26.9189
          Length = 1726

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 22/29 (75%)

Query: 3    DLFNAWYESXLKIGNLQKLEDIFKRPINR 31
            DL+N + +  +K G+ +K+ED+F+R +NR
Sbjct: 1655 DLWNVYVDQEIKAGDKKKVEDLFERIVNR 1683

>YMR053C (STB2) [4013] chr13 complement(380345..382897) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Stb6p [2553 bp, 850 aa]
          Length = 850

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 363 DLSQDVSSLQKKNFDILEAFSESRYNTKRAIRENWSFPGDPSGSRVVRKLFELXYLIPQQ 422
           ++ +D+S L++K+  +    S S     + I E W  P DPS  R+ R L  + Y I  Q
Sbjct: 605 NIYEDLSELKEKSSRLYRCNSSS---AVQNIVEKWDLPFDPSVVRIARDLLRMKYDIQAQ 661

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,252,796
Number of extensions: 858446
Number of successful extensions: 2753
Number of sequences better than 10.0: 22
Number of HSP's gapped: 2830
Number of HSP's successfully gapped: 32
Length of query: 651
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 543
Effective length of database: 12,857,365
Effective search space: 6981549195
Effective search space used: 6981549195
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)