Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_592.1525425413220.0
YAL027W2612645687e-73
CAGL0G06292g2532554531e-55
ADR352C2542573164e-35
KLLA0A03960g2252232254e-22
Kwal_26.70662042032236e-22
YGR062C (COX18)316103690.76
Scas_686.1818076651.9
YDR330W50048634.2
Kwal_56.22329776104635.0
YHR168W49954635.1
KLLA0C07579g61963618.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_592.15
         (254 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_592.15                                                           513   0.0  
YAL027W (YAL027W) [41] chr1 (94690..95475) Protein of unknown fu...   223   7e-73
CAGL0G06292g complement(602454..603215) similar to sp|P39735 Sac...   179   1e-55
ADR352C [2093] [Homologous to ScYAL027W - SH] (1326273..1327037)...   126   4e-35
KLLA0A03960g 353119..353796 weakly similar to sp|P39735 Saccharo...    91   4e-22
Kwal_26.7066                                                           91   6e-22
YGR062C (COX18) [2025] chr7 complement(616330..617280) Protein r...    31   0.76 
Scas_686.18                                                            30   1.9  
YDR330W (YDR330W) [1159] chr4 (1127863..1129365) Protein possibl...    29   4.2  
Kwal_56.22329                                                          29   5.0  
YHR168W (YHR168W) [2455] chr8 (440377..441876) Protein of unknow...    29   5.1  
KLLA0C07579g complement(662466..664325) similar to sp|P40053 Sac...    28   8.4  

>Scas_592.15
          Length = 254

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/254 (100%), Positives = 254/254 (100%)

Query: 1   MASSIATVRISKNAIVSLRVFINRKKLLRNNSREGQTFQAPLLSNNSIICLKSPLVRILI 60
           MASSIATVRISKNAIVSLRVFINRKKLLRNNSREGQTFQAPLLSNNSIICLKSPLVRILI
Sbjct: 1   MASSIATVRISKNAIVSLRVFINRKKLLRNNSREGQTFQAPLLSNNSIICLKSPLVRILI 60

Query: 61  SNQDMERLTNEIRDTIILIVYDLSSPEVMETVLGKLRIGSSADFETEILPKLMDENTLSK 120
           SNQDMERLTNEIRDTIILIVYDLSSPEVMETVLGKLRIGSSADFETEILPKLMDENTLSK
Sbjct: 61  SNQDMERLTNEIRDTIILIVYDLSSPEVMETVLGKLRIGSSADFETEILPKLMDENTLSK 120

Query: 121 DLVNVPLQTVTRVAKFKYKLRFKGNWELDIFINNMKKLIKIRHFLLFTDGHMSAARTLEL 180
           DLVNVPLQTVTRVAKFKYKLRFKGNWELDIFINNMKKLIKIRHFLLFTDGHMSAARTLEL
Sbjct: 121 DLVNVPLQTVTRVAKFKYKLRFKGNWELDIFINNMKKLIKIRHFLLFTDGHMSAARTLEL 180

Query: 181 PPNRRILLTEQKTSLESEGSPMIPLEVDGDEMIETTQDAVEDVKPDIKLKYNPIINLGEC 240
           PPNRRILLTEQKTSLESEGSPMIPLEVDGDEMIETTQDAVEDVKPDIKLKYNPIINLGEC
Sbjct: 181 PPNRRILLTEQKTSLESEGSPMIPLEVDGDEMIETTQDAVEDVKPDIKLKYNPIINLGEC 240

Query: 241 LSIHILQRPRRHKV 254
           LSIHILQRPRRHKV
Sbjct: 241 LSIHILQRPRRHKV 254

>YAL027W (YAL027W) [41] chr1 (94690..95475) Protein of unknown
           function [786 bp, 261 aa]
          Length = 261

 Score =  223 bits (568), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 123/264 (46%), Positives = 177/264 (67%), Gaps = 23/264 (8%)

Query: 1   MASSIATVRISKNAIVSLRVFINRKKLLRNNSR-----EGQTFQAPLLSNNSIICLKSPL 55
           MA SIATV+I+++ ++ LR+F+NRK++L+ N +         F+APLLSNNSIICLKSP 
Sbjct: 1   MAPSIATVKIARDMVLPLRIFVNRKQILQTNDKTSNKSNATIFEAPLLSNNSIICLKSPN 60

Query: 56  VRILISNQDMERLTNEIRDTIILIVYDLSSPEVMETVLGKLRIGSSADFETEILPKLMDE 115
            RI +S QD + L +EI++ ++LIVY+L+SPE++ +VL K+R+G S DF+  +LPKL   
Sbjct: 61  TRIYLSQQDKKNLCDEIKEDLLLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKLF-A 119

Query: 116 NTLSKDLVNVPLQTVTRVAKFKYKLRFKGNWELDIFINNMKKLIKIRHFLLFTDGHMSAA 175
              + + V   +Q+VTR+AKFKYKL +K  WELDIFIN++KK+  +RH+L+F        
Sbjct: 120 GADTDNAVTSHIQSVTRLAKFKYKLHYKHKWELDIFINSIKKIANLRHYLMF-------- 171

Query: 176 RTLELPPNRRILLTEQKTSLES--EGSPMIP--LEVDGD-EMIETTQDAVEDVKPDIKLK 230
           +TL L  N   L    KT L    E  P +P  L  +GD + ++T  +  ED+KP I+  
Sbjct: 172 QTLTL--NGFSLNAGPKTLLARKIEKQPQVPNLLIENGDADALDTPVE--EDIKPVIEFM 227

Query: 231 YNPIINLGECLSIHILQRPRRHKV 254
           Y P+INLGE + +H+L RPRRHKV
Sbjct: 228 YKPVINLGEIIDVHVLHRPRRHKV 251

>CAGL0G06292g complement(602454..603215) similar to sp|P39735
           Saccharomyces cerevisiae YAL027w, start by similarity
          Length = 253

 Score =  179 bits (453), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 156/255 (61%), Gaps = 5/255 (1%)

Query: 1   MASSIATVRISKNAIVSLRVFINRKKLLRNNSREGQTFQAPLLSNNSIICLKSPLVRILI 60
           M  +IA ++++K++I+ +RV INR+++L   + E +  QAPLLSNN+I+CLKSPL +I +
Sbjct: 1   MVQNIAYIKVAKDSILPVRVHINRRQILSTATEESKV-QAPLLSNNTIVCLKSPLTKIYL 59

Query: 61  SNQDMERLTNEIRDTIILIVYDLSSPEVMETVLGKLRIGSSADFETEILPKLMDENTLSK 120
           SN D++ L  E+ D IILI+Y+LSSP + + +  K+R+G   DF+ + L K     ++  
Sbjct: 60  SNTDLKNLVTEMEDDIILILYELSSPAMKQNIFSKIRVGQVYDFDEDTLKKF--PQSIQG 117

Query: 121 DLVNVPLQTVTRVAKFKYKLRFKGNWELDIFINNMKKLIKIRHFLLFTDGHMSAARTLEL 180
            L    L ++ RV K KYKL ++ NW++DIFI+N+ KL  IR +L+F D +        L
Sbjct: 118 SLKESNLTSLKRVGKMKYKLTYRKNWDVDIFISNINKLETIRTYLIFKDQYPQWNEYPCL 177

Query: 181 PPNRRILLTEQKTSLESEGSPMI--PLEVDGDEMIETTQDAVEDVKPDIKLKYNPIINLG 238
              + +L+  QK S  +   P+I    E       ++ +D   + KP+I   Y P ++L 
Sbjct: 178 QKQQSLLVMGQKLSESTNQDPIILQEEEELNLNYEQSAEDQPNNEKPEIAFTYEPQLSLI 237

Query: 239 ECLSIHILQRPRRHK 253
           +CL ++IL+RP+R +
Sbjct: 238 QCLDLYILKRPKRKR 252

>ADR352C [2093] [Homologous to ScYAL027W - SH] (1326273..1327037)
           [765 bp, 254 aa]
          Length = 254

 Score =  126 bits (316), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 142/257 (55%), Gaps = 13/257 (5%)

Query: 1   MASSIATVRISKNAIVSLRVFINRKKLLRNNSREGQTFQAPLLSNNSIICLKSPLVRILI 60
           M+ + A +++    ++ +RVFINR+++L NN+     F+AP+LSN++I+ LKSP VR+ +
Sbjct: 1   MSPTHALLQLQPGYVMPVRVFINRREVL-NNAASCSLFEAPILSNSAIVRLKSPSVRVHL 59

Query: 61  SNQDMERLTNEIRDTIILIVYDLSSPEVMETVLGKLRIGSSADFETEILPKLMDENTLSK 120
           S  D + L  E+RD ++ I+Y+L SP   ET L K +IG  ADF  +I+      +   +
Sbjct: 60  SEDDKQSLLAELRDDLLYIIYELGSPGAEET-LRKFKIGGLADFR-DIVRAAEQGDRPEQ 117

Query: 121 DLVNVPLQTVT--RVAKFKYKLRFKGNWELDIFINNMKKLIKIRHFLL----FTDGHMSA 174
            +  + L T+T  R+ K ++ L F+ NW ++I +N+++KL   R  LL          +A
Sbjct: 118 PIPGLDLHTMTFERLDKQRFPLHFEHNWVVNIILNDIRKLAVWRRLLLCDIAPIGVPAAA 177

Query: 175 ARTLELPPNRRILLTEQKTSLESEGSPMIPLEVDGDEMIETTQDAVEDVKPDIKLKYNPI 234
           A          +LL E++  +  +G     L+ D  E +    D   + KP +  +Y  +
Sbjct: 178 APAPMPAGAPYVLLRERRGRVSPQGM----LQEDAPEGVPREGDLNVEQKPVLDYRYKSV 233

Query: 235 INLGECLSIHILQRPRR 251
            NLG  + IH+LQRPRR
Sbjct: 234 TNLGPGIEIHVLQRPRR 250

>KLLA0A03960g 353119..353796 weakly similar to sp|P39735
           Saccharomyces cerevisiae YAL027w hypothetical protein
           singleton, hypothetical start
          Length = 225

 Score = 91.3 bits (225), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 73/223 (32%), Positives = 103/223 (46%), Gaps = 34/223 (15%)

Query: 65  MERLTNEIRDTIILIVYDLSSPEVMETVLGKLRIGSSADFET--EILPKLMDENTLSKDL 122
           M+ L NEIRD+++ ++Y+L SP + E VL KL+I +  DF    EIL K     T S D+
Sbjct: 1   MKFLLNEIRDSLLFMLYELCSPILEEKVLNKLKIDTFMDFADVLEILKKGSSLETRSTDV 60

Query: 123 VN------VPLQTVTRVAKFKYKLRFKGNWELDIFINNMKKLIKIRHFLLFTDGHMSAAR 176
            N      V + ++ R  K  YKL F  NW LDI I N+ KL   R  L   D   S + 
Sbjct: 61  YNPIDGIDVHITSIERTGKKSYKLHFSHNWRLDILIENIDKLHHWRKLLTLLDSVQSVSN 120

Query: 177 TLELPP-----------NRRILLTEQKTSLESEGSPMIPLEVDGDEMIETTQDAVE---- 221
           T +  P            R I   E  T+      P I +E + D + +  +D +E    
Sbjct: 121 TGQSIPLFIPFKSTNVLVRSIKPLESDTNSSKSEDPPILIEPEDDGLGQVPRDEIEMVDQ 180

Query: 222 ---DVKPDIKLKYNPIIN--------LGECLSIHILQRPRRHK 253
              D+K D K    PI +          +C+ IH+L RP+R K
Sbjct: 181 DPNDIKLDTKDDKKPIFDYQYKGMRLFDKCIKIHVLGRPKRGK 223

>Kwal_26.7066
          Length = 204

 Score = 90.5 bits (223), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 109/203 (53%), Gaps = 27/203 (13%)

Query: 77  ILIVYDLSSPEVMETVLGKLRIGSSADFETEILPKLMD-ENTLSKDLVNVPLQTVTRVAK 135
           +LI+Y+L++ E+ E VLGK+++G+  + + +I+ +     +T   D  +  L T+ R  K
Sbjct: 1   MLILYELTAKEIHEEVLGKIKVGNLVEMK-DIMTRFPSFRHTKHSDTTSCHLTTLERSGK 59

Query: 136 FKYKLRFKGNWELDIFINNMKKLIKIRHFLL----FTDGHMSA--------ARTLELPPN 183
            +YKL ++ NWELDIF+++++KL +IR  LL    F     S         ++T  L   
Sbjct: 60  HQYKLHYENNWELDIFVSDIRKLARIRSTLLQRLNFRPNSSSGLIAPIGDLSKTKVLRRV 119

Query: 184 RRILLTEQKTS------LESEGSPMIPLEVDGDEMIETTQ------DAVEDVKPDIKLKY 231
           R  ++++Q+ S      LES+   + P E  G+E   T+       D   + KP  K   
Sbjct: 120 REEIVSKQEASSEPKLLLESDEEDVFP-ESGGNEKEPTSNVLPEMIDVDSEKKPKFKFSN 178

Query: 232 NPIINLGECLSIHILQRPRRHKV 254
             ++NLG C+ IHIL+RP R K+
Sbjct: 179 VQMLNLGNCIDIHILKRPARAKM 201

>YGR062C (COX18) [2025] chr7 complement(616330..617280) Protein
           required for activity of mitochondrial cytochrome
           oxidase, required for export of Cox2p C-terminal domain
           across inner mitochondrial membrane from the matrix
           (40749) [951 bp, 316 aa]
          Length = 316

 Score = 31.2 bits (69), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 44/103 (42%), Gaps = 7/103 (6%)

Query: 38  FQAPLLSNNSIICLKSPL-------VRILISNQDMERLTNEIRDTIILIVYDLSSPEVME 90
           +  PL  N  +  ++ PL       +R L   Q +E         +    +DLSSP V  
Sbjct: 159 YNVPLWKNALLPMVQIPLWVTVSMGIRTLTETQLIESFYPSWFSALGFSSFDLSSPLVAM 218

Query: 91  TVLGKLRIGSSADFETEILPKLMDENTLSKDLVNVPLQTVTRV 133
            +L  + +G+ A    E+  +LM  ++LS   +    +  TRV
Sbjct: 219 PLLAPILVGTLAVLNVELNGRLMFSSSLSSQGIKTISRNSTRV 261

>Scas_686.18
          Length = 180

 Score = 29.6 bits (65), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 39/76 (51%), Gaps = 10/76 (13%)

Query: 169 DGHMSAARTLELPP----NRRILLTEQKTSLESEGSPMIPLEVDGDEMIETTQDAVEDVK 224
           D  +S  +  E+P     NR  L + + + L  E +P IPLE D   + +  ++ +++ +
Sbjct: 30  DNSVSRGQNNEIPSLALRNRLELYSRRLSQLGLEETPQIPLETDNTSLSQAEKEKIKNEE 89

Query: 225 -PD-----IKLKYNPI 234
            PD     +K+K+ PI
Sbjct: 90  GPDVNSFKVKIKFQPI 105

>YDR330W (YDR330W) [1159] chr4 (1127863..1129365) Protein possibly
           involved in proteasome function [1503 bp, 500 aa]
          Length = 500

 Score = 28.9 bits (63), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 22/48 (45%)

Query: 163 HFLLFTDGHMSAARTLELPPNRRILLTEQKTSLESEGSPMIPLEVDGD 210
            F+   DG+++ A +L        LL+   T   S  +PM P  VD D
Sbjct: 23  QFIEMADGNLNTAISLFFENGGAALLSSNNTPTPSNSTPMAPTSVDSD 70

>Kwal_56.22329
          Length = 776

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 4/104 (3%)

Query: 37  TFQAPLLSNNSIICLKSP----LVRILISNQDMERLTNEIRDTIILIVYDLSSPEVMETV 92
           TF   LL+ +S+I +  P    +V   I N           D +  IV DLS  E +   
Sbjct: 157 TFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIF 216

Query: 93  LGKLRIGSSADFETEILPKLMDENTLSKDLVNVPLQTVTRVAKF 136
            G L IG+ A+F   +L +++ E  +++   NV  + + + A+F
Sbjct: 217 AGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEF 260

>YHR168W (YHR168W) [2455] chr8 (440377..441876) Protein of unknown
           function, contains a GTP1/OBG GTP-binding domain [1500
           bp, 499 aa]
          Length = 499

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 204 PLEVDGDEMIETTQDAV--EDVKPDIKLKYNPIIN--LGECLSIHILQRPRRHK 253
           P   D ++ +ET +     E  K D  + Y   IN  LGE  S++ LQR  +HK
Sbjct: 32  PRAADNEQWLETLRPITHPEQKKSDHDVSYTRHINVPLGEVTSVNYLQRYNKHK 85

>KLLA0C07579g complement(662466..664325) similar to sp|P40053
           Saccharomyces cerevisiae YER080w hypothetical protein
           singleton, start by similarity
          Length = 619

 Score = 28.1 bits (61), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 27/63 (42%), Gaps = 15/63 (23%)

Query: 84  SSPEVMETVLGKLRIGSSADFETEILPKLMDENTLSKDLVNVPLQTVTRVAKFKYKLRFK 143
           SS  V  T +GKL + S +D   E+  KL DEN   +D            A FKY     
Sbjct: 15  SSLRVSSTKIGKLFVRSVSDKPEEVFTKLSDENDPQRD------------AFFKYSW--- 59

Query: 144 GNW 146
           G W
Sbjct: 60  GTW 62

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,038,318
Number of extensions: 345203
Number of successful extensions: 1124
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1112
Number of HSP's successfully gapped: 24
Length of query: 254
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 155
Effective length of database: 13,168,927
Effective search space: 2041183685
Effective search space used: 2041183685
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)