Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_592.1454954924350.0
YAL028W5281703916e-41
CAGL0G06314g6531813871e-39
Scas_663.275591773344e-33
YOR324C6021662682e-24
Sklu_2164.44651511871e-14
KLLA0A03938g4201681245e-07
Kwal_26.70633781511004e-04
CAGL0I03630g42763810.076
Kwal_56.2362840953665.4
Kwal_14.140820236637.8
YLR274W (CDC46)77584658.7
CAGL0A00583g64679649.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_592.14
         (549 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_592.14                                                           942   0.0  
YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown fu...   155   6e-41
CAGL0G06314g complement(603668..605629) some similarities with s...   153   1e-39
Scas_663.27                                                           133   4e-33
YOR324C (YOR324C) [5106] chr15 complement(923227..925035) Protei...   107   2e-24
Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement         77   1e-14
KLLA0A03938g 351240..352502 some similarities with sp|P39734 Sac...    52   5e-07
Kwal_26.7063                                                           43   4e-04
CAGL0I03630g 308811..310094 similar to sp|P25441 Saccharomyces c...    36   0.076
Kwal_56.23628                                                          30   5.4  
Kwal_14.1408                                                           29   7.8  
YLR274W (CDC46) [3667] chr12 (691557..693884) Member of the MCM/...    30   8.7  
CAGL0A00583g 65286..67226 weakly similar to sp|Q06149 Saccharomy...    29   9.4  

>Scas_592.14
          Length = 549

 Score =  942 bits (2435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/549 (86%), Positives = 474/549 (86%)

Query: 1   MDRLIARMEDPGKRSPSPMASSTEEPLTLVAGMNPSINRAKKKILRRETHTPENTSSEES 60
           MDRLIARMEDPGKRSPSPMASSTEEPLTLVAGMNPSINRAKKKILRRETHTPENTSSEES
Sbjct: 1   MDRLIARMEDPGKRSPSPMASSTEEPLTLVAGMNPSINRAKKKILRRETHTPENTSSEES 60

Query: 61  LKPSGSEMEEPKPETIPKTVEIPTIRVNNEPIEDQPKLVRQQSQPNLVALGAKANGHRES 120
           LKPSGSEMEEPKPETIPKTVEIPTIRVNNEPIEDQPKLVRQQSQPNLVALGAKANGHRES
Sbjct: 61  LKPSGSEMEEPKPETIPKTVEIPTIRVNNEPIEDQPKLVRQQSQPNLVALGAKANGHRES 120

Query: 121 ATLRSGKPDYTSANTGMFSDHIFNESTADGLIPRQNELPFMDTNTDNPVKLTPFAQAQNE 180
           ATLRSGKPDYTSANTGMFSDHIFNESTADGLIPRQNELPFMDTNTDNPVKLTPFAQAQNE
Sbjct: 121 ATLRSGKPDYTSANTGMFSDHIFNESTADGLIPRQNELPFMDTNTDNPVKLTPFAQAQNE 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXXNVTDKKRLVNQFLESVEAPSTLQLRFPDSLAA 240
                                       NVTDKKRLVNQFLESVEAPSTLQLRFPDSLAA
Sbjct: 181 AERSGRHHRRHHSGSSELSRRSRASTLTNVTDKKRLVNQFLESVEAPSTLQLRFPDSLAA 240

Query: 241 KRPKQMYNTSNFSSTGHSTRSSDTHMTTANSFQSLLYHDLENPSKPSSASLYKXXXXXXX 300
           KRPKQMYNTSNFSSTGHSTRSSDTHMTTANSFQSLLYHDLENPSKPSSASLYK       
Sbjct: 241 KRPKQMYNTSNFSSTGHSTRSSDTHMTTANSFQSLLYHDLENPSKPSSASLYKSGTNSKS 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVSDNNIEDVGMSTDEVDDN 360
                                                   LVSDNNIEDVGMSTDEVDDN
Sbjct: 301 TSSSMSTGLLSSESSSSSSSYTSSESSTMSSSSTKISSSSLVSDNNIEDVGMSTDEVDDN 360

Query: 361 NTSSSGAGNGTDLSLSCNEIDYYQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNF 420
           NTSSSGAGNGTDLSLSCNEIDYYQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNF
Sbjct: 361 NTSSSGAGNGTDLSLSCNEIDYYQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNF 420

Query: 421 DTYLHDLKKLKYQIISLQKLVRNDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLE 480
           DTYLHDLKKLKYQIISLQKLVRNDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLE
Sbjct: 421 DTYLHDLKKLKYQIISLQKLVRNDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLE 480

Query: 481 RRMESSGERLNEQKETMKRMENLINLENSLKLSQKNASWVSKNKAIVYDLSVVFILLLSG 540
           RRMESSGERLNEQKETMKRMENLINLENSLKLSQKNASWVSKNKAIVYDLSVVFILLLSG
Sbjct: 481 RRMESSGERLNEQKETMKRMENLINLENSLKLSQKNASWVSKNKAIVYDLSVVFILLLSG 540

Query: 541 YLLQKLIWT 549
           YLLQKLIWT
Sbjct: 541 YLLQKLIWT 549

>YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown
           function [1587 bp, 528 aa]
          Length = 528

 Score =  155 bits (391), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 121/170 (71%)

Query: 378 NEIDYYQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNFDTYLHDLKKLKYQIISL 437
           +E+DYYQRHI ++L+++EAL+K +L+D +LK ENDL  N+ NFD  + +L+ L+ + I  
Sbjct: 356 DELDYYQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGW 415

Query: 438 QKLVRNDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLERRMESSGERLNEQKETM 497
           ++LV  DYL+ LK+DFD  N  SFE  L++ +N NV KLQDLE+RM S  +RL  +KE M
Sbjct: 416 KELVEEDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVM 475

Query: 498 KRMENLINLENSLKLSQKNASWVSKNKAIVYDLSVVFILLLSGYLLQKLI 547
           ++ME+L++LENSL +S+KN ++ SK +    D+  + I+++  Y  + L+
Sbjct: 476 RKMESLLSLENSLMISKKNVTFASKYRNEALDIVFLIIIIVICYTFKHLV 525

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 89/243 (36%), Gaps = 51/243 (20%)

Query: 92  IEDQPKLVRQQSQPNLVALGAKA------NGHRESATLRSGKPDYTSANTGMFSDHIFNE 145
           +E +P +  Q S  NL AL  K       + H      R   PDYTSA+T MFSD +FN 
Sbjct: 51  VETKPNVGWQASHSNLAALHEKEQKYEMEHHHARHKLHRQVIPDYTSASTAMFSDCMFNA 110

Query: 146 S----------TADGLIPRQNELPFMDTNTDNPVKLTPFAQAQNEXXXXXXXXXXXXXXX 195
           +           + GL P+    PF    T       PF Q   E               
Sbjct: 111 APDKVRSLSTMKSSGLSPKH---PFNVVATFK----GPFPQHSVESKPLDGGYSAKDHFP 163

Query: 196 XXXXXXXXXXXXXN-----------------VTDKKRLVNQFLESVEAPSTLQLRFPDSL 238
                                          V DKKRLV++FL+S+E  S+ Q +   +L
Sbjct: 164 SFKMLQAQQHPAHRHYKDNDKYGLKSPSRSFVKDKKRLVHRFLKSMEPSSSGQSKDSSAL 223

Query: 239 AAK----RPKQMYNTSNFSSTGHSTRSSDTHMTTANSFQSLLYHDLE-------NPSKPS 287
           A       P  +   S   +    +    +   T  S QSLLYHDLE       +PS+P 
Sbjct: 224 APAFDPILPNVISKPSKRPTHHSHSSDGSSSTQTDISLQSLLYHDLESSPKKHVSPSRPP 283

Query: 288 SAS 290
           S +
Sbjct: 284 SVA 286

>CAGL0G06314g complement(603668..605629) some similarities with
           sp|P39734 Saccharomyces cerevisiae YAL028w, hypothetical
           start
          Length = 653

 Score =  153 bits (387), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 117/181 (64%)

Query: 368 GNGTDLSLSCNEIDYYQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNFDTYLHDL 427
            N +++ L  NE DYYQ+HI  RL K E+ +K +L+ +ILK E +L NN+ +FD    DL
Sbjct: 471 ANDSNMFLGTNETDYYQQHINSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDL 530

Query: 428 KKLKYQIISLQKLVRNDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLERRMESSG 487
           + LK QI+ L+  + N+YL +LK DFD NN  SFE+ L + + +NV  L+ LE +M    
Sbjct: 531 QNLKSQILGLKNTIANEYLTVLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQ 590

Query: 488 ERLNEQKETMKRMENLINLENSLKLSQKNASWVSKNKAIVYDLSVVFILLLSGYLLQKLI 547
            +L +QKETM++ME+L+ LENSL +S+KN     K + ++YD+  +  L+L GY L+   
Sbjct: 591 SQLVDQKETMRKMESLLYLENSLMVSKKNTGLAYKYRYMLYDILTLGFLVLIGYYLKAYF 650

Query: 548 W 548
           W
Sbjct: 651 W 651

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 95  QPKLVRQQSQPNLVALGAKANGHRESATL-RSGKPDYTSANTGMFSDHIFN 144
           +P ++RQ +  NL AL    N   E   L R   PDYTS NTG FS+ +FN
Sbjct: 174 KPMIIRQVTASNLAALADGKNRLVEKKMLKRPTIPDYTSVNTGAFSECMFN 224

>Scas_663.27
          Length = 559

 Score =  133 bits (334), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 67/177 (37%), Positives = 114/177 (64%)

Query: 371 TDLSLSCNEIDYYQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNFDTYLHDLKKL 430
           T L+++CNE++YYQ HI   L + E L+K+NL+  ++K E DLH  L  FD     L+ +
Sbjct: 379 TTLNINCNELNYYQTHICNTLAEFERLLKQNLQTFVIKDEADLHGTLSKFDNLTFHLQNM 438

Query: 431 KYQIISLQKLVRNDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLERRMESSGERL 490
           K +I  L  ++   YL  +K  F+ ++++SFE  L   +  ++ +L++LE RME    +L
Sbjct: 439 KNRIDELYDVINEKYLSKIKTAFNEDDESSFEFELRTSVEASIKQLEELENRMEYCQLKL 498

Query: 491 NEQKETMKRMENLINLENSLKLSQKNASWVSKNKAIVYDLSVVFILLLSGYLLQKLI 547
            EQ+ETM++++NLI +ENSL  S+KN   +   + +V+D+ V+F++L  GY ++K+I
Sbjct: 499 QEQRETMRQLDNLILIENSLLESKKNVKHIYSYRFLVFDILVIFVVLYFGYWVKKII 555

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 86/328 (26%), Positives = 129/328 (39%), Gaps = 87/328 (26%)

Query: 1   MDRLIARMEDPGKRSPSPMASSTEEPLTLVAGMNPSINRAKKKILRRETHTPENTSSEES 60
           M+ LI R+E+PG R+            TL+    P  N+ +KKI   ++H  +  S+   
Sbjct: 1   MNFLIDRIENPGTRT------------TLLPSSFP--NKLQKKI--DKSHEADLFSNNLK 44

Query: 61  LKPSGSEMEEPKPETIPKTVEIPTIRVNNEPI-EDQPKLV--------RQQSQPNLVALG 111
            K + S+     P      +++P + +N+EPI E +P  +        R  S+  L    
Sbjct: 45  RKSAASKTRHLAPTKSQNNIKLPILSINDEPILESEPSRIGLASYFSQRHNSEEGLSFKT 104

Query: 112 AKANGHRESATLRSGKPDYTSANTGMFSDHIFNESTA-------------DG----LIPR 154
           +    H ES  L    PDY++A+ G FSD IFN++ +             DG    L  R
Sbjct: 105 SSRRKHLESQPL----PDYSAASLGTFSDCIFNDALSKEPTLTNAKGNYLDGGEKCLRSR 160

Query: 155 QNELPFMDTNTDNPVKLTP---------FAQAQNEXXXXXXXXXXXXXXXXXXXXXXXXX 205
           +    +   NT    + T          F+Q QN                          
Sbjct: 161 RQSSIYSSRNTSPYKRRTSSFGASGPLGFSQVQNSGKQLKNKRSNSNNHSTNL------- 213

Query: 206 XXXNVTDKKRLVNQFLESVEAPSTLQLRFPDSLAAKRPKQMYNTSNFSSTGHS--TRSSD 263
                +DKKRLVN+FL     P             K P    +  N   TG S  T+S++
Sbjct: 214 ----ASDKKRLVNEFLNCRNGP------------GKSP--TISEDNLGETGWSIATKSNN 255

Query: 264 THMTTANSF--QSL---LYHDLENPSKP 286
            +    N F  QSL   L+HDL+ PS+P
Sbjct: 256 NNQEQMNLFTDQSLSDILFHDLDTPSQP 283

>YOR324C (YOR324C) [5106] chr15 complement(923227..925035) Protein
           of the endoplasmic reticulum membrane [1809 bp, 602 aa]
          Length = 602

 Score =  107 bits (268), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 101/166 (60%), Gaps = 2/166 (1%)

Query: 378 NEIDYYQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNFDTYLHDLKKLKYQIISL 437
           +E++YYQ HI+  L K E  M+ NL D I+K EN++   +Q +D    +L  L  ++ +L
Sbjct: 427 DELNYYQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDLLSGELTLLLDEMTTL 486

Query: 438 QKLVRNDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLERRMESSGERLNEQKETM 497
           +  V N +LV LK DFD ++  +F N L   + ++V +LQ LERRME   ERLN+QK ++
Sbjct: 487 RTTVINQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLNKQKSSL 546

Query: 498 KRMENLINLENSLKLSQKNASWVSKNKAIVYDLSVVFILLLSGYLL 543
           + M++LI L+N L  S+ N   +   +  + D  ++  LL+ G+++
Sbjct: 547 REMDSLIELKNVLNKSKNNTKSIYLYRYFIID--IIAFLLMGGFIV 590

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 75/201 (37%), Gaps = 49/201 (24%)

Query: 1   MDRLIARMEDPGKRSPSPMASSTEEPLTLVAGMNPSINRAKKKILRRETHTPENTSSEES 60
           M+ LI RME+PG R+ + +  S   P     G   S   A K                  
Sbjct: 1   MNLLIDRMENPGSRNCTLLPPSF--PRGFCKGRRASSGDAVK------------------ 40

Query: 61  LKPSGSEMEEPKPETIPKT---------VEIPTIRVNNEPIEDQPK-------------L 98
           +K SG + +        KT           +P I VN+ P+  +P               
Sbjct: 41  IKESGLQPQPQPEPLQAKTNVAHFSKSSSRLPVIAVNDNPVVPRPSTEVNLGSLLQKERE 100

Query: 99  VRQQSQP------NLVALGAKANGHRESATLRSGKPDYTSANTGMFSDHIFNESTADGLI 152
             ++ QP      +L     +A+G R+ +   +  P   S  TG FSD +F E   D  +
Sbjct: 101 KEKEEQPALHDRRHLYVTKNRAHGVRQRSLEMTSLPVLGSTKTGKFSDFLF-EDDIDNRV 159

Query: 153 PRQNELPFMDTNTDNPVKLTP 173
            R +      ++ D+P +++P
Sbjct: 160 GRHSRSYSGASSLDDPFRVSP 180

>Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement
          Length = 465

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 90/151 (59%), Gaps = 3/151 (1%)

Query: 383 YQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNFDTYLHDLKKLKYQIISLQKLVR 442
           Y+ +I   + K E+++K  + D++  +E  + ++ Q   T   +L++++ +I+ L   V+
Sbjct: 295 YKEYIVNEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVK 354

Query: 443 NDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLERRMESSGERLNEQKETMKRMEN 502
            +YLV L+  F+  +  SF + L EI+ ++++ L+ LE R+++S + L  QK  ++ ME+
Sbjct: 355 ENYLVELETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLARQKNALEDMES 414

Query: 503 LINLENSLKLSQKNASW---VSKNKAIVYDL 530
           ++ L+  +  S+KN ++   + + K I++D 
Sbjct: 415 IVKLKQLVADSKKNMTFSDRLKEYKGILWDF 445

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 114 ANGHRESATLRSGKPDYTSANTGMFSDHIFN 144
             G+  S   +S  PDYTSA+TG FSD IF+
Sbjct: 59  GTGNSISKPRQSDTPDYTSASTGKFSDCIFH 89

>KLLA0A03938g 351240..352502 some similarities with sp|P39734
           Saccharomyces cerevisiae YAL028w, hypothetical start
          Length = 420

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 78/168 (46%), Gaps = 2/168 (1%)

Query: 383 YQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNFDTYLHDLKKLKYQIISLQKLVR 442
           Y +HI   L   E  +K  L  +IL +E D   N+ +       + +L   I  ++   +
Sbjct: 249 YIKHIHRDLTALEFRLKHFLMKVILPQEMDFTQNINHVSNLSKSVTQLHMDIEKIKHDTK 308

Query: 443 NDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLERRMESSGERLNEQKETMKRMEN 502
           + YL  L   F+ ++  SF + LT +++ +V++LQ LE +       L  +K  ++++EN
Sbjct: 309 DIYLEKLAAAFNGSDSESFVSKLTTLMDSHVSRLQALEGKTVDFQNELEAKKLQLRKLEN 368

Query: 503 LINLENSLKLSQKNASWVSKNKAIVYDLSVVFILLLSGYLLQKLI--W 548
           LI L + +   ++N     K K        V +L LS  L+  L   W
Sbjct: 369 LIKLNDMIGDFKRNMKLSEKLKEYYGTFGDVTVLALSISLIMYLFRRW 416

>Kwal_26.7063
          Length = 378

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 64/151 (42%), Gaps = 28/151 (18%)

Query: 415 NNLQNFDTYLHDL-----------KKLKYQIISLQKLVRNDYLVI--------------L 449
           N L  FD Y+ DL            K + ++  LQ+ +R    VI              L
Sbjct: 213 NELSKFDHYIRDLMASISSDESRITKTRTELDDLQQHIREAKSVIKDIDRCIQDQDIKML 272

Query: 450 KEDFDVNNKNSFENHLTEILNKNVTKLQDLERRMESSGERLNEQKETMKRMENLINLENS 509
           ++ F+  +++SF +  +  +      L   E+R+      L  QK T+ ++E  I L   
Sbjct: 273 RKSFESEDESSFISRFSAAIATYSESLASFEKRIGKCKVDLTTQKATVHKLETTIKLNEM 332

Query: 510 LKLSQKNASW---VSKNKAIVYDLSVVFILL 537
           ++ SQ N  +   + + K ++YD   + +L+
Sbjct: 333 IQDSQSNMCFLDRIREYKGLIYDFCALILLI 363

>CAGL0I03630g 308811..310094 similar to sp|P25441 Saccharomyces
           cerevisiae YDL150w RPC53 DNA-directed RNA polymerase
           III, hypothetical start
          Length = 427

 Score = 35.8 bits (81), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 42/63 (66%), Gaps = 4/63 (6%)

Query: 401 NLRDIILKRENDLHNNLQNFDTYLHDLKKLKYQIISLQKL-VRNDYLVILKEDFDVNNK- 458
           +L+D+++K+EN+L N L+    Y+ +    + + ++L+K+ ++NDY+ ILK    +N+K 
Sbjct: 237 SLQDVLVKKENELQNKLEEL--YIENGVDGQSRELNLEKIQIQNDYIKILKNIEKINDKP 294

Query: 459 NSF 461
           N F
Sbjct: 295 NKF 297

>Kwal_56.23628
          Length = 409

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 14/53 (26%)

Query: 59  ESLKPSGSEME-EPKPETIPKTVEIPTIRVNNEPIEDQPKLVRQQSQPNLVAL 110
           E LKPSG  +   PKPE              +EP++ +P+L  ++S P L+ L
Sbjct: 223 EDLKPSGLVLPTRPKPEV-------------HEPLQKKPRLTAKESHPELLPL 262

>Kwal_14.1408
          Length = 202

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 507 ENSLKLSQKNASWVSKNKAIVYDLSVVFILLLSGYL 542
           EN  ++   NASWV +  A  + + VV I+LL G+ 
Sbjct: 47  ENDQQMPNMNASWVDQRGA--WAIHVVIIMLLKGFF 80

>YLR274W (CDC46) [3667] chr12 (691557..693884) Member of the MCM/P1
           family, component of the MCM complex that binds at ARS
           elements to initiate DNA replication [2328 bp, 775 aa]
          Length = 775

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 440 LVRNDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLERRMESSGERLNEQKETMKR 499
           L R D + I+K+D +     S  NH+  I   N   +Q+   + E +G  ++ +K  MKR
Sbjct: 547 LSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQN---QQEENGSEISIEK--MKR 601

Query: 500 MENLINLENSLKLSQKNASWVSKN 523
                 L+ + +LS + A  +S N
Sbjct: 602 YITYCRLKCAPRLSPQAAEKLSSN 625

>CAGL0A00583g 65286..67226 weakly similar to sp|Q06149 Saccharomyces
           cerevisiae YLR266c, hypothetical start
          Length = 646

 Score = 29.3 bits (64), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 469 LNKNVTKLQDLERRMESSGERLNEQKETMKRMENLINLENSL--KLSQKNASWVSKNKAI 526
           +NK    + D+    E+ G+RL  QKE  +    LI L   L  +L +  A + +    I
Sbjct: 349 INKVFRSVMDMSIDEETIGDRLRLQKEISELCSVLIRLSKDLESRLGRIKAQYFNSTLFI 408

Query: 527 -VYDLSVVFILLLSGYLLQ 544
            ++ L   FILL SG L Q
Sbjct: 409 FLFRLHSRFILLTSGQLPQ 427

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.127    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,657,579
Number of extensions: 739576
Number of successful extensions: 3914
Number of sequences better than 10.0: 171
Number of HSP's gapped: 3988
Number of HSP's successfully gapped: 191
Length of query: 549
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 442
Effective length of database: 12,891,983
Effective search space: 5698256486
Effective search space used: 5698256486
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 64 (29.3 bits)