Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_592.13*1419141975990.0
YOR326W (MYO2)1574151036340.0
Scas_663.261567157236060.0
CAGL0F00671g1566150435840.0
Kwal_26.70551555152834960.0
ADR354W1558155734790.0
YAL029C (MYO4)1471145934030.0
Sklu_2164.51350125133720.0
KLLA0A03905g1550149433670.0
CAGL0G06336g141893129080.0
Scas_688.22187677413201e-154
Kwal_23.5534190780113041e-152
ACR068W180574912821e-149
YHR023W (MYO1)192881612801e-148
KLLA0E11572g184874612561e-145
CAGL0J00693g188480612281e-141
Scas_721.119123272211541e-135
KLLA0B12562g126072611531e-135
YMR109W (MYO5)121972611351e-133
CAGL0K07590g125275011281e-131
CAGL0K03487g121772711241e-131
YKL129C (MYO3)127172711261e-131
Kwal_26.7587125075011201e-130
AEL306C129272610721e-123
Scas_677.2924678722.0
Scas_719.9*897123732.5
CAGL0J08206g1898107732.8
Scas_418.261368714.5
KLLA0A05544g99274705.7
CAGL0M06083g694116688.8
AEL208W98774698.8
YHR182W785133689.5
YNL049C (SFB2)876164689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_592.13*
         (1419 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_592.13*                                                         2931   0.0  
YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,...  1404   0.0  
Scas_663.26                                                          1393   0.0  
CAGL0F00671g complement(73893..78593) highly similar to sp|P1952...  1385   0.0  
Kwal_26.7055                                                         1351   0.0  
ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (...  1344   0.0  
YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy c...  1315   0.0  
Sklu_2164.5 YOR326W, Contig c2164 5497-9549                          1303   0.0  
KLLA0A03905g complement(345818..350470) similar to sp|P19524 Sac...  1301   0.0  
CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces c...  1124   0.0  
Scas_688.22                                                           513   e-154
Kwal_23.5534                                                          506   e-152
ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH] complement(...   498   e-149
YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain (...   497   e-148
KLLA0E11572g complement(1018972..1024518) similar to sp|P08964 S...   488   e-145
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...   477   e-141
Scas_721.119                                                          449   e-135
KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439 S...   448   e-135
YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may ...   441   e-133
CAGL0K07590g 748352..752110 highly similar to sp|P36006 Saccharo...   439   e-131
CAGL0K03487g 322030..325683 highly similar to sp|Q04439 Saccharo...   437   e-131
YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin ty...   438   e-131
Kwal_26.7587                                                          436   e-130
AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C (...   417   e-123
Scas_677.29                                                            32   2.0  
Scas_719.9*                                                            33   2.5  
CAGL0J08206g 807382..813078 similar to sp|P41832 Saccharomyces c...    33   2.8  
Scas_418.2                                                             32   4.5  
KLLA0A05544g 510371..513349 gi|417201|sp|Q03215|K6P1_KLULA Kluyv...    32   5.7  
CAGL0M06083g complement(634963..637047) highly similar to sp|P32...    31   8.8  
AEL208W [2298] [Homologous to ScYGR240C (PFK1) - SH] complement(...    31   8.8  
YHR182W (YHR182W) [2467] chr8 (468217..470574) Protein of unknow...    31   9.5  
YNL049C (SFB2) [4539] chr14 complement(535279..537909) Protein w...    31   9.6  

>Scas_592.13*
          Length = 1419

 Score = 2931 bits (7599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1419/1419 (100%), Positives = 1419/1419 (100%)

Query: 1    MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60
            MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN
Sbjct: 1    MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60

Query: 61   NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120
            NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK
Sbjct: 61   NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120

Query: 121  VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180
            VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK
Sbjct: 121  VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180

Query: 181  YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240
            YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY
Sbjct: 181  YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240

Query: 241  LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300
            LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE
Sbjct: 241  LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300

Query: 301  DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360
            DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT
Sbjct: 301  DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360

Query: 361  RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420
            RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA
Sbjct: 361  RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420

Query: 421  KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480
            KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL
Sbjct: 421  KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480

Query: 481  QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE 540
            QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE
Sbjct: 481  QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE 540

Query: 541  SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV 600
            SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV
Sbjct: 541  SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV 600

Query: 601  LKATTNPTLATIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINST 660
            LKATTNPTLATIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINST
Sbjct: 601  LKATTNPTLATIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINST 660

Query: 661  NVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYLL 720
            NVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYLL
Sbjct: 661  NVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYLL 720

Query: 721  APTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLAYLEKIRS 780
            APTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLAYLEKIRS
Sbjct: 721  APTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLAYLEKIRS 780

Query: 781  DKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKTDAATLLQT 840
            DKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKTDAATLLQT
Sbjct: 781  DKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKTDAATLLQT 840

Query: 841  LHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRANSPKHRYQ 900
            LHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRANSPKHRYQ
Sbjct: 841  LHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRANSPKHRYQ 900

Query: 901  TLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIEELISNIKEN 960
            TLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIEELISNIKEN
Sbjct: 901  TLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIEELISNIKEN 960

Query: 961  DAKTTEYKSLLKHTSLPVVTGTNERTAAYISTKNQVEEDKVTIRTILTKYETLKDLCRKE 1020
            DAKTTEYKSLLKHTSLPVVTGTNERTAAYISTKNQVEEDKVTIRTILTKYETLKDLCRKE
Sbjct: 961  DAKTTEYKSLLKHTSLPVVTGTNERTAAYISTKNQVEEDKVTIRTILTKYETLKDLCRKE 1020

Query: 1021 LKSLESLEKGVNDEKFASSLQSSLELIKRDISDLRINAIEKDNERTSTSSELKDGTDCTD 1080
            LKSLESLEKGVNDEKFASSLQSSLELIKRDISDLRINAIEKDNERTSTSSELKDGTDCTD
Sbjct: 1021 LKSLESLEKGVNDEKFASSLQSSLELIKRDISDLRINAIEKDNERTSTSSELKDGTDCTD 1080

Query: 1081 NAVVQILTKRQGDLINDLVNVVFLEFQIPQRGRTKDCEHFYPVKLLISIVNLMNKFGLRK 1140
            NAVVQILTKRQGDLINDLVNVVFLEFQIPQRGRTKDCEHFYPVKLLISIVNLMNKFGLRK
Sbjct: 1081 NAVVQILTKRQGDLINDLVNVVFLEFQIPQRGRTKDCEHFYPVKLLISIVNLMNKFGLRK 1140

Query: 1141 SSHSILKQTVQDLIGKISSMDAKKCVTFGLYWIISLHKLSSLPQEPAVLNKLQDKFYKTW 1200
            SSHSILKQTVQDLIGKISSMDAKKCVTFGLYWIISLHKLSSLPQEPAVLNKLQDKFYKTW
Sbjct: 1141 SSHSILKQTVQDLIGKISSMDAKKCVTFGLYWIISLHKLSSLPQEPAVLNKLQDKFYKTW 1200

Query: 1201 LKQCFNQMKTVDSILILFDTISEFTLFFQGTTELLTNIITALLQHINAKWFNDLLIKQNT 1260
            LKQCFNQMKTVDSILILFDTISEFTLFFQGTTELLTNIITALLQHINAKWFNDLLIKQNT
Sbjct: 1201 LKQCFNQMKTVDSILILFDTISEFTLFFQGTTELLTNIITALLQHINAKWFNDLLIKQNT 1260

Query: 1261 LSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRNVNQACKLLQLRISNISDFQLVCEFCY 1320
            LSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRNVNQACKLLQLRISNISDFQLVCEFCY
Sbjct: 1261 LSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRNVNQACKLLQLRISNISDFQLVCEFCY 1320

Query: 1321 DLSSLQMHALLTKYRPTQFEKPIPVDVLNHLSNTARRERTTMKRELTLDAGTETYSVENL 1380
            DLSSLQMHALLTKYRPTQFEKPIPVDVLNHLSNTARRERTTMKRELTLDAGTETYSVENL
Sbjct: 1321 DLSSLQMHALLTKYRPTQFEKPIPVDVLNHLSNTARRERTTMKRELTLDAGTETYSVENL 1380

Query: 1381 FQGHPIEASDEHDDINQLINQLPSDKDFPVIKELGSLLA 1419
            FQGHPIEASDEHDDINQLINQLPSDKDFPVIKELGSLLA
Sbjct: 1381 FQGHPIEASDEHDDINQLINQLPSDKDFPVIKELGSLLA 1419

>YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,
            class V, involved in polarized growth, secretion and
            cytokinesis, required for mitochondrial distribution into
            growing bud [4725 bp, 1574 aa]
          Length = 1574

 Score = 1404 bits (3634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 747/1510 (49%), Positives = 989/1510 (65%), Gaps = 160/1510 (10%)

Query: 1    MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60
            MSFEVGTRCWYP+ E GWIG EV KN+F DG YH+EL  E   ++ ++TK L  NN   +
Sbjct: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDL--NN---D 55

Query: 61   NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120
              + LP+LRNPPILEAT DLT+LSYLNEPAVLHAIK+RY+Q NIYTYSGIVLIATNPFD+
Sbjct: 56   KDQSLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDR 115

Query: 121  VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180
            V++LY+ +MIQAYA K R E+ PH+FAIAEEAYR M N+ QNQTI+VSGESGAGKTVSAK
Sbjct: 116  VDQLYTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAK 175

Query: 181  YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240
            YIMR+FASVEEE+       +HQ EMS+ E KILATNP+MEAFGNAKTTRNDNSSRFGKY
Sbjct: 176  YIMRYFASVEEEN---SATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKY 232

Query: 241  LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300
            L+ILFD + +IIG+ I+TYLLERSRLV+QP  ERNYHIFYQ+++GL +  K++L+LT+A 
Sbjct: 233  LEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDAS 292

Query: 301  DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360
            D+FY+NQGG++ INGIDD+ EY  T+++L+ VGI  E Q QIFKILAALLHIGNIEIKKT
Sbjct: 293  DYFYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKT 352

Query: 361  RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420
            R DA+LS+ +P+L+ ACELLG+D   F+KW+TKKQI TRSEKI+SNL+++QALVA+DSVA
Sbjct: 353  RNDASLSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVA 412

Query: 421  KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480
            KFIYS+LFDWLV NIN VLC   V++ I+SFIGVLDIYGFEHFE+NSFEQFCINYANEKL
Sbjct: 413  KFIYSALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKL 472

Query: 481  QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE 540
            QQEFN HVFKLEQEEYVKEEIEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLPAGSDE
Sbjct: 473  QQEFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE 532

Query: 541  SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV 600
            SWT KLYQT +K P+N VF KPRFGQ KFI+SHYA+DV Y+V+GFIEKN+DT+S+  LEV
Sbjct: 533  SWTQKLYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEV 592

Query: 601  LKATTNPTLATIFEFSEA------ENKTNITEQAGTIQR---KTINRKPTLGSIFKRSLV 651
            LKA+TN TL  I E  E       E K    EQAG+ +    +T+NRKPTLGS+FK+SL+
Sbjct: 593  LKASTNETLINILEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLI 652

Query: 652  ELMETINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFE 711
            ELM TINSTNVHYIRCIKPN +KEAW+FDNLMVLSQLRACGVLETI+ISCAGFPSRW FE
Sbjct: 653  ELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFE 712

Query: 712  EFIQRYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGV 771
            EF+ RYY+L P +QW  +    E + ED+++   +IL   +  K KYQIG TKIFFKAG+
Sbjct: 713  EFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGM 772

Query: 772  LAYLEKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMK 831
            LAYLEK+RS+K+    V+IQK IRAKYYR  YLQ   +IK  Q+ I+G   RQRV+ EMK
Sbjct: 773  LAYLEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMK 832

Query: 832  TDAATLLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIR 891
             + ATLLQ  +R   +R+ VF  L+ I  +Q  IR+ L    +++E E  +A+ IQSK+R
Sbjct: 833  VNCATLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVR 892

Query: 892  ANSPKHRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIE 951
               P+ R+   K  T+++Q+L+RR+ +Q KLKQLK  A+S   LK  +  ++ ++I   +
Sbjct: 893  TFEPRSRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQ 952

Query: 952  ELISNIKENDAKTTEYKSL---LKHTSLPVVTGTNERTAAYISTKNQVEED--------- 999
             L S +KEN   T   K L   ++ ++    T  N +    I   NQ  +D         
Sbjct: 953  NLASKVKENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIEN 1012

Query: 1000 ------------KVTIRTILTKYETLKDLCRKELKSLESLEKG-VNDEKFASSLQSSLEL 1046
                        ++ +  ++ +++ LK+  +K+L+ LE  +K  V  +     LQ+ ++ 
Sbjct: 1013 NLQSTEQTLKDAQLELEDMVKQHDELKEESKKQLEELEQTKKTLVEYQTLNGDLQNEVKS 1072

Query: 1047 IKRDI----------------------------------------SDLRINAI------- 1059
            +K +I                                        SDL  N +       
Sbjct: 1073 LKEEIARLQTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRST 1132

Query: 1060 --EKDNERTSTSSELKDGTDCTD-NAVVQILTKRQGDLINDLVNVVFLEFQIPQRG---R 1113
                +N   S S + ++G + T  N  +  L +    L  ++   +   F++P  G   +
Sbjct: 1133 PSSGNNHIDSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQ 1192

Query: 1114 TKDCEHFYPVKLLISIVNLMNKFGLRKSSHSILKQ---TVQDLIGKISSMDAKKCVTFGL 1170
                +  YP ++LI +++ M +FGL K S S L Q   T+Q ++ ++   D      F L
Sbjct: 1193 LSKRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWL 1252

Query: 1171 YWIISLHKL------SSLPQEP--------------AVLNKLQDKF-------YKTW--- 1200
              +  L+        S L +E               +++ +L+D F       Y  W   
Sbjct: 1253 ANVRELYSFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWLKK 1312

Query: 1201 ------------------------------LKQCFNQMK--TVDSILILFDTISEFTLFF 1228
                                          L + F   +  T+D IL  F++I      F
Sbjct: 1313 LQKQLQKKAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSF 1372

Query: 1229 QGTTELLTNIITALLQHINAKWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRNS 1288
                E+   ++T LL +++A  FN+L++K+N LSW  GL+ +  + ++ +WC +H + + 
Sbjct: 1373 HIENEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTDG 1432

Query: 1289 TEYLRNVNQACKLLQLRISNISDFQLVCEFCYDLSSLQMHALLTKYRPTQFEKPIPVDVL 1348
            TE L+++ Q  KLLQ+R   I D  ++   CY L+  Q+  L+++Y+   +E PIP ++L
Sbjct: 1433 TECLQHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIPQEIL 1492

Query: 1349 NHLSNTARRE 1358
             ++++  ++E
Sbjct: 1493 RYVADIVKKE 1502

>Scas_663.26
          Length = 1567

 Score = 1393 bits (3606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 745/1572 (47%), Positives = 996/1572 (63%), Gaps = 166/1572 (10%)

Query: 1    MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60
            MSFEVGTRCWYP+ E GWIG EVTKND +DGTY +ELT E   V+ +ETK L +      
Sbjct: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPS- 59

Query: 61   NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120
                LP+LRNPPILE+T DLTTLSYLNEPAVLHAIK+RY+Q NIYTYSGIVLIATNPFD+
Sbjct: 60   ----LPLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDR 115

Query: 121  VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180
            +++LYS +MIQAY+ K R E+ PH+FAIAEEAYR M N+ QNQTI+VSGESGAGKTVSAK
Sbjct: 116  MDQLYSQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAK 175

Query: 181  YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240
            YIMR+FAS +EE+ +  G+ +H  EMS+ E +ILATNP+MEAFGNAKTTRNDNSSRFGKY
Sbjct: 176  YIMRYFASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKY 235

Query: 241  LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300
            L+ILFD    IIG+ ++TYLLERSRLV+QP +ERNYHIFYQ+L+GL  D+K++L+LT A+
Sbjct: 236  LEILFDKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKAD 295

Query: 301  DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360
            D+FY+NQGGE  I GIDD  EY  TI++L+ VG+  E Q  IFKILAALLHIGNIEIKKT
Sbjct: 296  DYFYMNQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKT 355

Query: 361  RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420
            R D++LSS +P+L+ ACELLG+DP  F+KWITKKQI TRSEKI+SNL+++QALVARDSVA
Sbjct: 356  RNDSSLSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVA 415

Query: 421  KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480
            KFIYS+LFDWLV NIN VLC   V + I+SFIGVLDIYGFEHFE+NSFEQFCINYANEKL
Sbjct: 416  KFIYSALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKL 475

Query: 481  QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE 540
            QQEFN HVFKLEQEEY+KEEIEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLPAGSDE
Sbjct: 476  QQEFNQHVFKLEQEEYIKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE 535

Query: 541  SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV 600
            SWT KLYQT +KPP+N VF KPRFGQ KF++SHYA+DV Y+V+GFIEKN+DT+S+  LEV
Sbjct: 536  SWTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEV 595

Query: 601  LKATTNPTLATIFEFSE------AENKTNITEQAGTIQRKT-----INRKPTLGSIFKRS 649
            LKATTN TL+TI E  E       E K N   Q     +K      + RKPTLGS+FK S
Sbjct: 596  LKATTNDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLS 655

Query: 650  LVELMETINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWA 709
            L+ELM+TINSTNVHYIRCIKPN EKEAWKFDNLMVLSQLRACGVLETI+ISCAGFPSRW 
Sbjct: 656  LIELMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWT 715

Query: 710  FEEFIQRYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKA 769
            F EFI RYY+L P  +W  +    +++ +D++  C  IL+  +  K+KYQIG TKIFFKA
Sbjct: 716  FNEFILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKA 775

Query: 770  GVLAYLEKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFE 829
            G+LAY EK+RS K+    VLIQKHIR+KYYR  Y+    S+    +  +G   RQRV++E
Sbjct: 776  GMLAYFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYE 835

Query: 830  MKTDAATLLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSK 889
            ++  AATL+QT++R    RS +   + +I+++Q+ IR  L    +Q ++ES +AI IQS+
Sbjct: 836  LEQHAATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSR 895

Query: 890  IRANSPKHRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGF 949
            IRA  P+  Y++ +  TI++Q+L+RR+ +Q   K+LK  A+S   LK  +  ++ ++I  
Sbjct: 896  IRAFVPRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQL 955

Query: 950  IEELISNIKEN------------------------DAKTTEYKSLLKHTSLPVVTGTNER 985
             + L + +KEN                        +A+  E +  L       V  +   
Sbjct: 956  TQNLAAKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSL 1015

Query: 986  TAAYISTKNQVEEDKVTIRTILTKYETLKDLCRKELKSLESLEKGVNDEKFASS------ 1039
                I     VE  K  + T+  KY  ++   + +L  LE  +  + + K  +S      
Sbjct: 1016 KDQLIKANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEI 1075

Query: 1040 ---------LQSSLEL---------------------------IKRDISDLRINAIEKDN 1063
                     LQ+S+ L                            + +IS  ++ +I  D 
Sbjct: 1076 KSLKEELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDT 1135

Query: 1064 --ERTSTSSELKDGTDCTDNAVVQI------LTKRQGDLINDLVNVVFLEFQIPQRG--- 1112
              +  S +    D      N + QI      L +    L N++   +   FQ+P  G   
Sbjct: 1136 AADHVSVNGYGMDDDIINTNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVAI 1195

Query: 1113 RTKDCEHFYPVKLLISIVNLMNKFGLRKSSHSILKQTVQDLIGKISSMDAKKCVTFGLYW 1172
            +    +  YP ++LI +++ M +FGL K S S L Q +  +   ++++     +  G +W
Sbjct: 1196 QLSRRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAFW 1255

Query: 1173 IISLHKL--------SSLPQEPAVLNKLQDKFYK------TWLKQCFNQMK--------- 1209
            + ++ +L         S+  E +    + D+ Y       T LK+ F  +          
Sbjct: 1256 LANVRELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWLK 1315

Query: 1210 ---------TVDSILI------------------LFDTISEFTL-----FFQGT------ 1231
                      ++++++                  +F++  E+T+     FF         
Sbjct: 1316 KLQKDLQKKAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMKS 1375

Query: 1232 ----TELLTNIITALLQHINAKWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRN 1287
                 E+   +I  LL +++   FNDL++K+N LSW  GL+ +  + ++ +WC +H + +
Sbjct: 1376 FHIENEVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLPD 1435

Query: 1288 STEYLRNVNQACKLLQLRISNISDFQLVCEFCYDLSSLQMHALLTKYRPTQFEKPIPVDV 1347
              +YL+++ Q  KLLQLR   I D  +V   C  LS  Q+  L+++Y    +E PIP D+
Sbjct: 1436 GAQYLQHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPIPQDI 1495

Query: 1348 LNHLSNTARRERTTMKRELTLDAGTETYSVENLFQGHPIEASDEHDDINQLINQLPSDKD 1407
            L ++++  ++E T+   ++ L   T  ++        P  A       +Q+   +PS   
Sbjct: 1496 LKYVADIVKKESTSAHNDIFLHPETGPFN-------DPFVAVKTR-KFDQVEAYIPSWLV 1547

Query: 1408 FPVIKELGSLLA 1419
             PV K +  L+A
Sbjct: 1548 LPVTKRIVDLVA 1559

>CAGL0F00671g complement(73893..78593) highly similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 or sp|P32492
            Saccharomyces cerevisiae YAL029c MYO4, start by
            similarity
          Length = 1566

 Score = 1385 bits (3584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 732/1504 (48%), Positives = 982/1504 (65%), Gaps = 154/1504 (10%)

Query: 1    MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60
            MSFEVGTRCWYP+ E GWIG EVTKND +DGTYH+EL  E G  + IETK L      + 
Sbjct: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDL-----TDE 55

Query: 61   NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120
            + E LP+LRNPPILEAT DLT+LSYLNEPAVLHAIK+RY+Q NIYTYSGIVLIATNPFD+
Sbjct: 56   SDESLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDR 115

Query: 121  VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180
            V++LYS +MIQAYA K R EM PH+FAIAEEAYR M +N +NQTI+VSGESGAGKTVSAK
Sbjct: 116  VDQLYSQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAK 175

Query: 181  YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240
            YIMR+FASVEEE+       +HQ EMS+ E KILATNP+MEAFGNAKTTRNDNSSRFGKY
Sbjct: 176  YIMRYFASVEEEN---SMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKY 232

Query: 241  LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300
            L+ILFD + +IIG+ I+TYLLERSRLV+QP +ERNYHIFYQM++GLS   K +L+L  AE
Sbjct: 233  LEILFDKDTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAE 292

Query: 301  DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360
            D++Y+NQGG+  I G+DD  EY+TT+++L+ VGI  E Q  IFKILAALLHIGNIEIKKT
Sbjct: 293  DYYYMNQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKT 352

Query: 361  RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420
            R DA+LSS + +L+ ACELLG+D   F+KWITKKQI TRSEKI+SNL+++QALVARDSVA
Sbjct: 353  RNDASLSSDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVA 412

Query: 421  KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480
            KFIYS+LFDWLV NIN VLC   V + + SFIGVLDIYGFEHFE+NSFEQFCINYANEKL
Sbjct: 413  KFIYSALFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKL 472

Query: 481  QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE 540
            QQEFN HVFKLEQEEYVKE+IEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLPAGSDE
Sbjct: 473  QQEFNQHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE 532

Query: 541  SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV 600
            SWT KLYQT +KPP+N VF KPRFGQ KF++SHYA+DV Y+V+GFIEKN+DT+S+  LEV
Sbjct: 533  SWTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEV 592

Query: 601  LKATTNPTLATIFE--------FSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVE 652
            LKA+TN TL  I +          +A+     ++ A     +T+ RKPTLGS+FK+SL+E
Sbjct: 593  LKASTNETLINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIE 652

Query: 653  LMETINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEE 712
            LM TI STN HYIRCIKPN +KEAWKFDNLMVLSQLRACGVLETI+ISCAGFPSRW F E
Sbjct: 653  LMTTIRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNE 712

Query: 713  FIQRYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVL 772
            FI RYY+L P  +W  +    +M+ +D++  C+ IL+  +  K+KYQIG TKIFFKAG+L
Sbjct: 713  FILRYYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGML 772

Query: 773  AYLEKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKT 832
            A+LEK+RSDK+   +VLIQK+IRAKYYR  +L+ M +I + Q  ++G   R  +D E K 
Sbjct: 773  AFLEKLRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKN 832

Query: 833  DAATLLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRA 892
             AAT +Q+L R  R RSQ+   + +I  +Q  +R+ L     Q + E+ +A+ IQSK+R+
Sbjct: 833  KAATEIQSLLRGYRRRSQILSIISSIRCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRS 892

Query: 893  NSPKHRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIEE 952
              P+  +   +  T+++Q+L+RR+ +Q+KLKQLK  A+S   LK  +  ++ +++   + 
Sbjct: 893  FKPRKAFLEDRRKTVVVQSLIRRRFAQKKLKQLKADAKSVNHLKEVSYKLENKVVELTQN 952

Query: 953  LISNIKEN---DAKTTEYKSLLKHTSL--------------------PVVTGTNERTAAY 989
            L + +KEN    A+  E ++ L+ ++L                     V     ++    
Sbjct: 953  LAAKVKENKSLSARVVELQTSLEESALLQEELKQIKSKHDAELLEQKDVFAEKGKQIEEE 1012

Query: 990  ISTKN-QVEEDKVTIRTILTKYETLKDLCRKELKSLESLEKG-VNDEKFASSLQSSLELI 1047
            ++  N QVEE K  +  +  +YE  K   +  L+ LE  +   +  + F S LQ+ +  +
Sbjct: 1013 LNAANLQVEEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSL 1072

Query: 1048 KRDIS----------------------DLRINAIEKDNERTSTSSEL-------KDGTDC 1078
            K ++S                      D+ +     +       SEL       KD    
Sbjct: 1073 KEELSRLQTQISLGTVTANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSKDAGSV 1132

Query: 1079 TD----------NAVVQI------LTKRQGDLINDLVNVVFLEFQIPQRGRTKDCEH--- 1119
            ++          NA+ QI      L +    L N++ + +  +F++P  G          
Sbjct: 1133 SNMGMDSYASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRRDV 1192

Query: 1120 FYPVKLLISIVNLMNKFGLRKSSHSILKQTVQDLIGKISSMDAKKCVTFGLYWIISLHKL 1179
             YP ++LI I++ M +FGL K S   L Q +  +   ++++     +  G +W+ ++ +L
Sbjct: 1193 VYPARILIIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVREL 1252

Query: 1180 SS---------LPQEP--------------AVLNKLQDKF-------YKTWLKQCFNQMK 1209
             S         L +E               +++ +L++ F       Y  WLK+   +++
Sbjct: 1253 YSFVVFAQHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRELQ 1312

Query: 1210 -----------------------------------TVDSILILFDTISEFTLFFQGTTEL 1234
                                               T+D IL  F++I      FQ   E+
Sbjct: 1313 KKAVNAVVLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIENEV 1372

Query: 1235 LTNIITALLQHINAKWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRN 1294
               ++T LL +++A  FNDL++K+N LSW  GL+ +  + ++ +WC +H + + T+ L++
Sbjct: 1373 FHKVVTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCLQH 1432

Query: 1295 VNQACKLLQLRISNISDFQLVCEFCYDLSSLQMHALLTKYRPTQFEKPIPVDVLNHLSNT 1354
            + Q  KLLQ+R  +I D  ++   C  L+  Q+  L+T+Y+   +E PIP ++L ++++ 
Sbjct: 1433 LIQTSKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKYVADI 1492

Query: 1355 ARRE 1358
             + E
Sbjct: 1493 VKSE 1496

>Kwal_26.7055
          Length = 1555

 Score = 1351 bits (3496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 724/1528 (47%), Positives = 976/1528 (63%), Gaps = 148/1528 (9%)

Query: 1    MSFEVGTRCWYPNSEAGWIGCEVTK-NDFQDGTYHIELTSETGLVIPIETKHLESNNAME 59
            MSFEVGTRCWYP+ + GW+G EVTK +  ++G + +EL  E G  + IET+ L      E
Sbjct: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPEEGKFLLELKLENGETVEIETETLN-----E 55

Query: 60   NNHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFD 119
            + +E LP+LRNPPILEA  DLT+LSYLNEPAVLHAIK RY Q NIYTYSGIVLIATNPFD
Sbjct: 56   SQNEKLPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFD 115

Query: 120  KVEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSA 179
            +VE+LYS +MIQAYA + R E+ PH+FAIA+EAYR M ++ QNQTI+VSGESGAGKTVSA
Sbjct: 116  RVEQLYSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSA 175

Query: 180  KYIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGK 239
            KYIMR+FASVE+ + +    S H  +MS+ E +ILATNP+MEAFGNAKT+RNDNSSRFGK
Sbjct: 176  KYIMRYFASVEQANADN-ASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGK 234

Query: 240  YLQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNA 299
            YL+ILFD + +IIG+ I+TYLLERSRLVFQP  ERNYHIFYQ++ GLS   K++L+LT  
Sbjct: 235  YLEILFDESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKV 294

Query: 300  EDFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKK 359
            ED+ YL QGG+  I G+DD+ EY  T+++L  VG   + Q Q+FKILAALLHIGNIE+KK
Sbjct: 295  EDYHYLRQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKK 354

Query: 360  TRTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSV 419
            TR DA+LSS +P+L+ AC+LLG+D   FSKWITKKQI TRSEKI+SNLSFNQALVARDSV
Sbjct: 355  TRNDASLSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSV 414

Query: 420  AKFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEK 479
            AKFI+S+LFDWLV NIN VLC  QVS+ I+SFIGVLDIYGFEHFE+NSFEQFCINYANEK
Sbjct: 415  AKFIFSALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEK 474

Query: 480  LQQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSD 539
            LQQEFN HVFKLEQEEYV E+IEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLPAGSD
Sbjct: 475  LQQEFNQHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSD 534

Query: 540  ESWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLE 599
            ESWT KLYQT +KPP+N+VF KPRFGQ KF++SHYA+DV Y+V GFIEKN+DT+S+  LE
Sbjct: 535  ESWTQKLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLE 594

Query: 600  VLKATTNPTLATIFEFSEAENKTNITEQAGTIQRKTINR---KPTLGSIFKRSLVELMET 656
            VLKA+ N TL +I +  + +N   + E+    ++    R   KPTLGS+FK+SL+ELM T
Sbjct: 595  VLKASKNDTLLSILDTID-KNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNT 653

Query: 657  INSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQR 716
            I+STNVHYIRCIKPN EKEAWKFDNLMVLSQLRACGVLETI+ISCAGFPSRW + EF+ R
Sbjct: 654  IDSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLR 713

Query: 717  YYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLAYLE 776
            Y++L P+D W ++    E S +D+   C  IL   +D  +KYQ+G TKIFFKAG+LAYLE
Sbjct: 714  YHILIPSDNWTKIFTS-EASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLE 772

Query: 777  KIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKTDAAT 836
            K+RS K+    VLIQK I+  YYR  YL    +I N Q++I G   RQ VD E KT AA 
Sbjct: 773  KLRSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAI 832

Query: 837  LLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRANSPK 896
             LQT+ R  R R      L +I+ VQ+ +R+ +    +  + +S +A+ IQ KIR   P+
Sbjct: 833  SLQTIFRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPR 892

Query: 897  HRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIEELISN 956
              Y   +  ++ IQ+LVRRK +Q++LKQLK  A+S   L+  +  ++ ++I   + L   
Sbjct: 893  QSYNATRGSSVKIQSLVRRKLAQKQLKQLKADAKSVNHLQEVSYKLENKVIQLTQSLAEK 952

Query: 957  IKENDAKTTE-------------YKSLLKHTSLPVVTGTNERTAAYIS-----------T 992
            +KEN   T +              KSLL            E+  ++ +            
Sbjct: 953  VKENRDMTAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIELDNA 1012

Query: 993  KNQVEEDKVTIRTILTKYETLKDLCRKELKSLESLEKGVNDEKFASS-LQSSLELIKRDI 1051
            K +VE  K  I  +L++ E LK   R +++ L ++++   D +  +S L++ ++ +K +I
Sbjct: 1013 KAEVEAAKKEIEDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEI 1072

Query: 1052 SDLRINAIEKDNERT-----------------------------STSSELKDGTDCTDNA 1082
            + L+ +     N  T                             S ++ ++D    T +A
Sbjct: 1073 NRLQTSIRSGANSNTILAHTPTKSRRFSAHSSLTDASPRQLNVISMNNGMEDDARSTASA 1132

Query: 1083 VVQI------LTKRQGDLINDLVNVVFLEFQIPQRGRTKDC---EHFYPVKLLISIVNLM 1133
            + QI      + +    L  ++V  +   F+IP+ G   +    E  YP +++I +++ M
Sbjct: 1133 LSQINDELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTRKEVLYPARIMIIVLSDM 1192

Query: 1134 NKFGLRKSSHSILKQTVQDLIGKISSMDAKKCVTFGLYWIISLHKLSSLP--QEPAVLN- 1190
             + GL K S S L + +  +   +S +     +  G +W+ ++ +L S     + ++LN 
Sbjct: 1193 WRLGLTKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNVRELYSFVVFAQESILND 1252

Query: 1191 --------------------KLQDKF-------YKTWLK--------------------- 1202
                                +L+D F       Y  WLK                     
Sbjct: 1253 DSYNSGLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAVSAVVMSQSLP 1312

Query: 1203 ------------QCFNQMK--TVDSILILFDTISEFTLFFQGTTELLTNIITALLQHINA 1248
                        + F+Q     +D IL  F+ I      +    E+   +I  LL+++++
Sbjct: 1313 GFIANESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKTYHVEQEVFREVIITLLRYVDS 1372

Query: 1249 KWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRNVNQACKLLQLRISN 1308
              FNDL++++N LSW  GL+ +  + ++ +WC SH I   T+ L+++ QA KLLQL+ +N
Sbjct: 1373 ICFNDLIMRRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDCLQHMLQASKLLQLKKAN 1432

Query: 1309 ISDFQLVCEFCYDLSSLQMHALLTKYRPTQFEKPIPVDVLNHLSNTARRERTTMKRELTL 1368
            + D  ++ E C  L   Q+  L+T+Y    +E PIP ++L  ++N  + E +     L+ 
Sbjct: 1433 LDDIDIIWEICSSLKPAQIQKLITQYAVADYEVPIPQEILTFVANRVKSESS-----LSS 1487

Query: 1369 DAGTETYSVENLFQGHPIEASDEHDDIN 1396
            +  ++T+S++      P+E     D  N
Sbjct: 1488 NGKSQTHSIDIFL---PVENGPFKDPFN 1512

>ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (MYO4)
            - SH] complement(1328357..1333033) [4677 bp, 1558 aa]
          Length = 1558

 Score = 1344 bits (3479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/1557 (46%), Positives = 979/1557 (62%), Gaps = 153/1557 (9%)

Query: 1    MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60
            MS+EVGTRCWYP+ E GWIG E+TK+      Y ++LT E G V+ I    +E     E 
Sbjct: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVE-----EG 55

Query: 61   NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120
            + E LP+LRNPPILEAT DLT+LSYLNEPAVLHAIK RY Q NIYTYSGIVLIATNPFD+
Sbjct: 56   SCEELPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDR 115

Query: 121  VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180
            V++LYS +MIQAYA + R E+ PH+FAIAEEAY  M N+ QNQTI+VSGESGAGKTVSAK
Sbjct: 116  VDQLYSQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAK 175

Query: 181  YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240
            YIMR+FA+VE+ +    G S H  EMS+ E KILATNP+MEAFGNAKTTRNDNSSRFGKY
Sbjct: 176  YIMRYFATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKY 235

Query: 241  LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300
            L+ILFD + +IIG+ I+TYLLERSRLVFQP SERNYHIFYQ+L+GL  + KK+L L   E
Sbjct: 236  LEILFDKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVE 295

Query: 301  DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360
            ++ Y+NQGG S I G+DD  EY+ T ++LS V I    Q  +FK+LAALLHIGNI++KKT
Sbjct: 296  EYHYMNQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKT 355

Query: 361  RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420
            R DA++S+TDPSL+ ACELLG+D   F+KWITKKQI TRSEKI+SNL++ QA+VARDSVA
Sbjct: 356  RNDASVSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVA 415

Query: 421  KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480
            KFIYS+LFDWLV NINNVLC   V   I SFIGVLDIYGFEHFE+NSFEQFCINYANEKL
Sbjct: 416  KFIYSALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKL 475

Query: 481  QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE 540
            QQEFN HVFKLEQEEYVKEEI+WSFIEF+DNQPCIDLIENKLGILSLLDEESRLPAGSDE
Sbjct: 476  QQEFNQHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE 535

Query: 541  SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV 600
            +WT KLYQT +KPP+NTVF KPRFGQ KF++SHYA DV Y+V+GFIEKN+DT+S+  LEV
Sbjct: 536  TWTQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEV 595

Query: 601  LKATTNPTLATIFEFSEAENKTNITEQAGTIQR-----KTINRKPTLGSIFKRSLVELME 655
            LK +TN TL  I E  +  N   + E+  + ++     +T+NRKPTLGS+FK+SLVELM 
Sbjct: 596  LKGSTNETLLAILETID-RNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMS 654

Query: 656  TINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQ 715
            TINSTNVHYIRCIKPN EKEAWKFDNLMVLSQLRACGVLETI+ISCAGFP+RW ++EF  
Sbjct: 655  TINSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFAL 714

Query: 716  RYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLAYL 775
            RY++L P+  W ++ A    + E++   C  IL   +  K+KYQ+G TKIFFKAG+LA+L
Sbjct: 715  RYHILVPSTNWTKIFA-TGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFL 773

Query: 776  EKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKTDAA 835
            EK R+DK+   + +IQK I+  YYR  YL+   +IK   S+ +G   R R+D E KT AA
Sbjct: 774  EKKRTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAA 833

Query: 836  TLLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRANSP 895
              +Q+L+R + +R      L +I+  Q+ +RR L    ++   E+ +AI IQ  IRA  P
Sbjct: 834  ITIQSLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKP 893

Query: 896  KHRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIEELIS 955
            +  Y T +  TI++Q+LVRR+ ++ KL+ LK +A+S + LK  +  ++ ++I   E L +
Sbjct: 894  RTSYITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAA 953

Query: 956  NIKEN------------------------DAKTTEYKSLLKHTSLPVVTGTNERTAAYIS 991
             +KEN                          K  EY+  +            E T     
Sbjct: 954  KVKENKDLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTL 1013

Query: 992  TKNQVEEDKVTIRTILTKYETLKDLCRKELKSLESLEKGVNDEKFASS-LQSSLELIKRD 1050
               +V++ +  I  + +K E LK   + +++ L  + + ++D +  +S L + +  +K +
Sbjct: 1014 AMKEVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEE 1073

Query: 1051 ISDLRINAIEKDNERTSTSSELKDGTDCTDNAVVQILTKRQGD----------------- 1093
            I+ L  NAI ++   T T S  +     + + +  I + +Q +                 
Sbjct: 1074 IARLH-NAI-RNAPATGTLSPTRSKRISSYSGLDNIGSPKQWNVVSLNNGLMEEETRSIM 1131

Query: 1094 ------------LIND-------LVNVVFLEFQIPQRGRTKDC---EHFYPVKLLISIVN 1131
                        L+ND       +V  +    +IPQ G   +    E  YP ++LI I++
Sbjct: 1132 SQLSQINDELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPARVLIIILS 1191

Query: 1132 LMNKFGLRKSSHSILKQTVQDLIGKISSMDAKKCVTFGLYWIISLHKLSSLP-------- 1183
             M + GL + S   L + +  +   ++++     +  G +W+ ++ +L S          
Sbjct: 1192 DMWRLGLTEQSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFAIYAHDSIL 1251

Query: 1184 ---------------QEPAVLNKLQDKF-------YKTWLKQCFNQMK------------ 1209
                           Q   +++ L+D F       Y  WLK+   +++            
Sbjct: 1252 NDNAYIKDLNEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKELEKRAVSAVVMSQS 1311

Query: 1210 -----------------------TVDSILILFDTISEFTLFFQGTTELLTNIITALLQHI 1246
                                    +D IL  F+TI      +   TE+   +I +LL+++
Sbjct: 1312 LPGFIVPESSAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVETEVYREVIMSLLRYV 1371

Query: 1247 NAKWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRNVNQACKLLQLRI 1306
            +A  FNDL++K+N LSW  GL+ +  + ++ +WC  H I   ++ L ++ QA KLLQL+ 
Sbjct: 1372 DAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCLEHMLQASKLLQLKK 1431

Query: 1307 SNISDFQLVCEFCYDLSSLQMHALLTKYRPTQFEKPIPVDVLNHLSNTARRERTTMKREL 1366
            +N+ D  ++ E C  L   Q+  L+++Y    +E PIP ++L+ +++  ++E       L
Sbjct: 1432 ANMEDINIIWEICSSLKPAQIQKLISQYSAADYEVPIPQEILSFVADRVKKESA-----L 1486

Query: 1367 TLDAGTETYSVENLFQGHPIEASD-----EHDDINQLINQLPSDKDFPVIKELGSLL 1418
            + D  + ++S +          +D     E  +IN++   +P+  + P+ + +  L+
Sbjct: 1487 SNDGKSASHSSDIFLPVATGSFADPFSQIEPREINKIEAHIPAWLNLPISRRVVELI 1543

>YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy chain,
            class V [4416 bp, 1471 aa]
          Length = 1471

 Score = 1315 bits (3403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/1459 (48%), Positives = 956/1459 (65%), Gaps = 114/1459 (7%)

Query: 1    MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60
            MSFEVGT+CWYP+ E GWIG EVTKNDF +GT+H+EL  E G  + IET   E+    ++
Sbjct: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFEN----DD 56

Query: 61   NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120
            +H  LPVLRNPPILE+T DLTTLSYLNEPAVLHAIK+RY    IYTYSGIVLIA NPFDK
Sbjct: 57   DHPTLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDK 116

Query: 121  VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180
            V+ LYS EMIQ Y+ K +DE+ PH+FAIAEEAYR M++   NQT++VSGESGAGKTVSAK
Sbjct: 117  VDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAK 176

Query: 181  YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240
            YIMR+FASV+E + N+EG+     EMS IE +ILATNP+MEAFGNAKTTRNDNSSRFGKY
Sbjct: 177  YIMRYFASVQESN-NREGEV----EMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKY 231

Query: 241  LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300
            LQILFD N  I GS I+TYLLE+SRLV+QP +ERNYHIFYQ+L GL   +K++L+L++ +
Sbjct: 232  LQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPK 291

Query: 301  DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360
            D+ Y NQGG+  I GID++ EY  T ++LS VGI+ E QL IFKILA LLHIGNIE+K T
Sbjct: 292  DYHYTNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMT 351

Query: 361  RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420
            R DA+LSS + +LQ ACELLG+DP  F+KWI KKQI TRSEKI++NL++NQAL+ARDSVA
Sbjct: 352  RNDASLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVA 411

Query: 421  KFIYSSLFDWLVGNINNVLCTSQVSET--INSFIGVLDIYGFEHFEQNSFEQFCINYANE 478
            KFIYS+LFDWLV NIN  L   ++ +   + SFIG+LDIYGFEHFE+NSFEQFCINYANE
Sbjct: 412  KFIYSTLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANE 471

Query: 479  KLQQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGS 538
            KLQQEFN HVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLP+GS
Sbjct: 472  KLQQEFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGS 531

Query: 539  DESWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQL 598
            DESW +KLY  FNKPPSN VF KPRFGQ KFI+SHYAVDV YEV+GFIEKN+D++S   L
Sbjct: 532  DESWASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHL 591

Query: 599  EVLKATTNPTLATIFEFSE-----AENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVEL 653
            +V KATTNP    I +  E     A  + N TE+   I  +   +KPTLGS+FK+SL EL
Sbjct: 592  DVFKATTNPIFKQILDNRELRSDDAPEEQN-TEKKIMIPARLSQKKPTLGSMFKKSLGEL 650

Query: 654  METINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEF 713
            M  INSTNVHYIRCIKPN+EK+ W+FDNLMVLSQLRACGVLETI+ISCAGFPSRW F+EF
Sbjct: 651  MAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEF 710

Query: 714  IQRYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLA 773
            +QRY+LL     W  +  + ++  E +V FC  IL   I    KYQIG TKIFFKAG+LA
Sbjct: 711  VQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLA 770

Query: 774  YLEKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKTD 833
            +LEK+R++K+ E+ ++IQK IRA+YYR  YLQ M SIK CQS IR +  R RVD E+KT 
Sbjct: 771  FLEKLRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTR 830

Query: 834  AATLLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRAN 893
            AA LLQT  R+   R      +  I+++Q   +R L+ + + R+F   +A++IQS IR+ 
Sbjct: 831  AAILLQTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSY 890

Query: 894  SPKHRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIEEL 953
              K  Y+TLK  +IL+Q+ +R + ++ +   L+ + E      +   G+ +E I F    
Sbjct: 891  GHKTDYRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSF 950

Query: 954  ISNIKENDAKTTEYKSLLKH--TSLP---------VVTGTNERTAAYISTKNQVEEDKVT 1002
            I N++  +   T    LL+   +++P         +V G N++ +       +++  +V 
Sbjct: 951  ILNLEMLNDSYTRLTQLLQGDLSNIPSKQRQEYETIVNGYNDKIS-------KLKTLQVE 1003

Query: 1003 IRTILTKYETLKD-------LCRKELKSLESLEKGVNDEKFASSLQSSLELIKRDISDLR 1055
            I   L K   LK+       L +  ++SL ++ KG    + +  ++S    +K++++ + 
Sbjct: 1004 IMNTLNKKNALKERKKKQSSLIQSHMQSLAAI-KGNKPSRLSDEVKS----MKQELAFIE 1058

Query: 1056 INAIEKDNERTSTSSE------LKDGTDCTDNAVVQILTKRQG--DLINDLVNVVFLEFQ 1107
             N I +D   T ++++      L          +V ++ +  G  DL+  L+++     +
Sbjct: 1059 -NVIAQDFTTTYSANKNDKVKGLGIAGQQVKPKLVNVIRRESGNPDLLELLMDLNCYTLE 1117

Query: 1108 IPQRGRTKDC--------EHFYPVKLLISIVNLMNKFGLRKSSHSILKQTVQDLIGKISS 1159
            + + G  K              P+ ++ ++V+ + + GL   S   + + +  +   + S
Sbjct: 1118 VTE-GYLKKVNVTEVNGDNVLGPIHVITTVVSSLVRNGLLIQSSKFISKVLLTVESIVMS 1176

Query: 1160 MDAKKCVTFGLYWIISLHKLSSLPQEPAVLN------------------------KLQDK 1195
            +   + +  G++W+ +L +L +       L                         K+ DK
Sbjct: 1177 LPKDETMLGGIFWLSNLSRLPAFAANQKTLYEANGGDEKDKLTLIYLNDLENETLKVFDK 1236

Query: 1196 FYKTWL----KQCFNQMKTVDSIL--------------ILFDTISEFTLF---FQGTTEL 1234
             Y TWL    K     ++  D +L               LF  ++EF      FQ    +
Sbjct: 1237 IYSTWLVKFMKHASAHIEIFDMVLNEKLFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDSM 1296

Query: 1235 LTNIITALLQHINAKWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRN 1294
             T I    L+++N   FNDL+ K   L+W +G E D  I++++ W    +I +    L  
Sbjct: 1297 HTKIFNDTLKYLNVMLFNDLITKCPALNWKYGYEVDRNIERLVSWFEP-RIEDVRPNLIQ 1355

Query: 1295 VNQACKLLQLRISNISDFQLVCEFCYDLSSLQMHALLTKYRPT-QFEKPIPVDVLNHLSN 1353
            + QA K+LQL+ISN+++F+L+ +F Y L+  Q+ A+L KY+P  + E  +P ++LN+L+N
Sbjct: 1356 IIQAVKILQLKISNLNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVPNEILNYLAN 1415

Query: 1354 TARRERTTM--KRELTLDA 1370
              +RE  ++  K E+ L A
Sbjct: 1416 VIKRENLSLPGKMEIMLSA 1434

>Sklu_2164.5 YOR326W, Contig c2164 5497-9549
          Length = 1350

 Score = 1303 bits (3372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 671/1251 (53%), Positives = 866/1251 (69%), Gaps = 80/1251 (6%)

Query: 1    MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60
            MS+EVGTRCWYP+ + GWIG E+TK+      + +ELT E   ++ IE++ L+     E 
Sbjct: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLD-----ET 55

Query: 61   NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120
              + LP+LRNPPILEAT DLT+LSYLNEPAVLHAIK RY Q NIYTYSGIVLIATNPFD+
Sbjct: 56   KDDRLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDR 115

Query: 121  VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180
            VE+LYS +MIQAYA K R E+ PH+FAIAEEAYR M N+ QNQTI+VSGESGAGKTVSAK
Sbjct: 116  VEQLYSQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAK 175

Query: 181  YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240
            YIMR+FASVE+   N E ++ H  EMS+ E KILATNP+MEAFGNAKTTRNDNSSRFGKY
Sbjct: 176  YIMRYFASVEQ---NNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKY 232

Query: 241  LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300
            L+ILFD   +IIG+ I+TYLLERSRLVFQP SERNYHIFYQ+L+GL+++ K QL LT  E
Sbjct: 233  LEILFDKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVE 292

Query: 301  DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360
            D+ Y+NQGGE+ I GIDD+ EY TT+E+LS VGI  + Q Q+FKILAALLHIGN+EIKKT
Sbjct: 293  DYHYMNQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKT 352

Query: 361  RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420
            R DA+LSS +P+L  ACELLG+D   F+KWITKKQINTRSEKI+SNL++NQALVARDSVA
Sbjct: 353  RNDASLSSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVA 412

Query: 421  KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480
            KFIYS+LF+WLV NIN VLC  +V+  INSFIGVLDIYGFEHFE+NSFEQFCINYANEKL
Sbjct: 413  KFIYSALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKL 472

Query: 481  QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE 540
            QQEFN HVFKLEQEEYVKEEIEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLPAGSDE
Sbjct: 473  QQEFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE 532

Query: 541  SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV 600
            +WT KLYQT +KPP+NTVF KPRFGQ KF++SHYA+DV+Y+V+GFIEKN+DT+S+  LEV
Sbjct: 533  TWTQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEV 592

Query: 601  LKATTNPTLATIFE-----FSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELME 655
            LKA+TN TL +I E      ++   K  + ++ G    + +NRKPTLGSIFK+SL+ELM 
Sbjct: 593  LKASTNETLLSILETLDKHAAKLAEKEQVNKKPGPA--RMVNRKPTLGSIFKQSLIELMG 650

Query: 656  TINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQ 715
            TINSTNVHYIRCIKPN  KEAW FDNLMVLSQLRACGVLETI+ISCAGFPSRW + EF+ 
Sbjct: 651  TINSTNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVL 710

Query: 716  RYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLAYL 775
            RY++L P++ W ++ +  + + ED+   C  IL   ++ K KYQ+G TKIFFKAG+LAYL
Sbjct: 711  RYHILIPSEHWSKMFSS-DTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYL 769

Query: 776  EKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKTDAA 835
            EK+RSD++   +VLIQK ++A YYR  YL  + SI+N  S   G  +RQ+VD E KT AA
Sbjct: 770  EKLRSDRLHNSSVLIQKKVKAVYYRKKYLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAA 829

Query: 836  TLLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRANSP 895
             L+Q++ RST  R++    L  I  +Q+ +R+ L    + +  +  +A+ IQ KIRA  P
Sbjct: 830  ILIQSMVRSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEP 889

Query: 896  KHRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIEELIS 955
            +  + T +  T+++Q+LVR+K +Q+KLK LK +A+S   LK  +  ++ ++I   E L  
Sbjct: 890  RQSFNTTRRSTVVVQSLVRKKFAQKKLKDLKTEAKSVNHLKEVSYKLENKVIQLTESLAE 949

Query: 956  NIKENDAKTTE-------------YKSLLKHTSLPVVTGTNERTAAYISTKNQVEEDKVT 1002
             +KEN   T                K LL            ++  A+    N+V+E  V 
Sbjct: 950  KVKENKGMTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQEKLVN 1009

Query: 1003 IRT-----------ILTKYETLKDLCRKELKSLESLEKGVND-EKFASSLQSSLELIKRD 1050
             +            ++ K + LK   R +++ L   +K   + +   S L++ ++ +K +
Sbjct: 1010 AKKEVEEAKEEIEQLIAKQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDE 1069

Query: 1051 ISDLRINA-----------IEKDNERTSTSSELKDGTD-------------------CTD 1080
            I+ L+                  + R S  S + DGT                     T 
Sbjct: 1070 IARLQAAVRSGVTSSTITSTPTASRRFSAHSSVADGTSPRQLNVISMNNGGIEDDARSTA 1129

Query: 1081 NAVVQI------LTKRQGDLINDLVNVVFLEFQIPQRGRTKDC---EHFYPVKLLISIVN 1131
            +A+ QI      L +    L  ++V  +   F+IP+ G   +    E  YP ++LI +++
Sbjct: 1130 SALSQINDELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVLYPARILIIVLS 1189

Query: 1132 LMNKFGLRKSSHSILKQTVQDLIGKISSMDAKKCVTFGLYWIISLHKLSSL 1182
             M + GL K S S L + +  +   ++++     +  G +W+ ++ +L S 
Sbjct: 1190 DMWRLGLTKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELYSF 1240

>KLLA0A03905g complement(345818..350470) similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 myosin heavy chain,
            start by similarity
          Length = 1550

 Score = 1301 bits (3367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/1494 (46%), Positives = 947/1494 (63%), Gaps = 146/1494 (9%)

Query: 1    MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60
            M +EVGTRCWYP+ + GWIG EVTK+  Q  +Y++ELT E G  + +    L+     E 
Sbjct: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLD-----ET 55

Query: 61   NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120
                LP+LRNPPILE T DLT+LSYLNEPAVLHAIK RY Q NIYTYSGIVLIATNPFD+
Sbjct: 56   KEPSLPLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDR 115

Query: 121  VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180
            V++LYS EMIQAYA K R E+ PH+FAIAEEAYR M   DQNQTIIVSGESGAGKTVSAK
Sbjct: 116  VDQLYSQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAK 175

Query: 181  YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240
            YIMR+FASVEE   N E ++ H  EMS+ E KILATNP+MEAFGNAKT RNDNSSRFGKY
Sbjct: 176  YIMRYFASVEE---NNEENAHHNLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKY 232

Query: 241  LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300
            L+ILFD + +IIG+ ++TYLLERSRLVFQP +ERNYHIFYQ+LSGLS D K QL LT+ +
Sbjct: 233  LEILFDDDTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQ 292

Query: 301  DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360
            D+ Y+NQGG+S I G+DD+ EY  T+E+LS VGI  + Q Q+FKILAALLHIGNIE+KK 
Sbjct: 293  DYHYMNQGGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKV 352

Query: 361  RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420
            R DA+LSS +P+LQ A +LLG+D   F+KW+TKKQI TRSEKI+S+L ++QA+V+RDSVA
Sbjct: 353  RNDASLSSDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVA 412

Query: 421  KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480
            KFIYS+LFDWLV NIN VLC  +V   I +FIGVLDIYGFEHF++NSFEQFCINYANEKL
Sbjct: 413  KFIYSALFDWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKL 472

Query: 481  QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE 540
            QQEFN HVFKLEQEEYVKE+IEWSFIEF+DNQPCIDLIENK+GILSLLDEESRLPAG+DE
Sbjct: 473  QQEFNQHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDE 532

Query: 541  SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV 600
             WT KLY+T NKPP+N VF KPRFGQ +FI+SHYA+DVTY+VDGFIEKN+DT+S+  LEV
Sbjct: 533  GWTHKLYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEV 592

Query: 601  LKATTNPTLATIFEFSEAENKTNITEQA---------GTIQRKTINRKPTLGSIFKRSLV 651
            LKA+ N TL +I E  +   +    +QA         G   RK + RKPTLGS+FK+SL+
Sbjct: 593  LKASNNETLLSILETVDKNAEKLAEKQAQKQESQKKPGPASRKIV-RKPTLGSMFKQSLI 651

Query: 652  ELMETINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFE 711
            +LMETINSTNVHYIRCIKPN +KEAWKFDNLMVLSQLRACGVLETI+ISCAGFPSRW + 
Sbjct: 652  DLMETINSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYT 711

Query: 712  EFIQRYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGV 771
            EF  RY++L P++ W  +    + S ED+   C  IL   +D   KYQ G TKIFFKAG+
Sbjct: 712  EFALRYHILVPSELWSNILLS-DPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGM 770

Query: 772  LAYLEKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMK 831
            LA+LEK+R+DK+   +V+IQK I+  +YR  YL+ + +IK  Q+ + G   R R + E K
Sbjct: 771  LAHLEKLRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFK 830

Query: 832  TDAATLLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIR 891
             +AA L+Q+ +R   VR  V   + +I+ +Q+  R+ +    +       +A+ IQ  +R
Sbjct: 831  NNAALLIQSAYRGISVRDNVSSIIISIIRIQSMARKQITCKELLERRRGDAAVTIQKSVR 890

Query: 892  ANSPKHRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIE 951
            +  P+  +   K GT++IQ+ +R+  +Q KLKQLK +A+S   L+  +  ++ ++I   E
Sbjct: 891  SFQPRKSFLHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTE 950

Query: 952  ELISNIKENDAKTTEYKSLLK--HTSLPVVTGTNERTAAY-------------------- 989
             L S +KEN    +  ++L K  + S  + +   E    +                    
Sbjct: 951  SLASKVKENKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVND 1010

Query: 990  --ISTKNQVEEDKVTIRTILTKYETLKDLCRKELKSLESL-EKGVNDEKFASSLQSSLEL 1046
              I+ K ++   K  +  +L K + LKD     L+ L S  ++ +  +   + L+  +  
Sbjct: 1011 QLIAAKEEIISAKAEVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFS 1070

Query: 1047 IKRDISDLR------------INAIEKDNERTSTSSELKDGTDCTDNAVVQILTKRQGDL 1094
            +K +++ L+            INA    N R S +S L DG+      VV I      + 
Sbjct: 1071 LKEEVARLQSSMRSGVYVGGGINATPVKNRRFSANSTLNDGSSPKQLNVVSINNNFNTED 1130

Query: 1095 INDLVNVVFLEF----------------------QIPQRGRTKDC---EHFYPVKLLISI 1129
            ++ L++ +  E                       ++P  G + +    E  YP ++LI I
Sbjct: 1131 VSALMSQINDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVLIII 1190

Query: 1130 VNLMNKFGLRKSSHSILKQTVQDLIGKISSMDAKKCVTFGLYWIISLHKL---------- 1179
            ++ M + GL   S + L + +  +   IS++     +  G +W  ++ +L          
Sbjct: 1191 LSDMWRLGLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYAYES 1250

Query: 1180 --------SSLPQEPA-----VLNKLQDKF-------YKTWLKQCFNQMKTV-------- 1211
                    S + +E       ++ +L+D F       Y  W+K+    ++ +        
Sbjct: 1251 ITTDETYNSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEKIAVPAVVVS 1310

Query: 1212 ---------------------------DSILILFDTISEFTLFFQGTTELLTNIITALLQ 1244
                                       D +L  F+ I      +    E+  ++IT LL+
Sbjct: 1311 QSLPGFVVPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVFEDVITNLLK 1370

Query: 1245 HINAKWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRNVNQACKLLQL 1304
             ++A  FNDL++++N LSW  GL+ +  + ++ +WC SH I   +  L+++ QA KLLQL
Sbjct: 1371 LLDALCFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHILQAAKLLQL 1430

Query: 1305 RISNISDFQLVCEFCYDLSSLQMHALLTKYRPTQFEKPIPVDVLNHLSNTARRE 1358
            +   ++D  ++ + C  L  +Q+  L+T+Y    +E+PI  ++L +++   + +
Sbjct: 1431 KKRIVADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYVAEKVKND 1484

>CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces
           cerevisiae YAL029c MYO4 or sp|P19524 Saccharomyces
           cerevisiae YOR326w MYO2, start by similarity
          Length = 1418

 Score = 1124 bits (2908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/931 (59%), Positives = 713/931 (76%), Gaps = 10/931 (1%)

Query: 1   MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60
           M+FEVGTRCWYP SE GWI CEV+KN+ +DG YH++ T E G +I ++T  ++ N+++ N
Sbjct: 1   MTFEVGTRCWYP-SENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSN 59

Query: 61  NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120
               +PVLRNP   E+T DLTTLSYLNEPAVLHAIK RY  + IYTYSGIVL+ATNPF +
Sbjct: 60  EGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQ 119

Query: 121 VEELYSSEMIQAYAR-KNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSA 179
           +EELYS++MI+ Y+R  +R+E+ PH+FAIA +AY  M +  +NQTI+VSGESGAGKTVSA
Sbjct: 120 MEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSA 179

Query: 180 KYIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGK 239
           KYIMR+FAS+++       ++    EMSDIE KILATNP+MEAFGNAKT RNDNSSRFGK
Sbjct: 180 KYIMRYFASLDD------NNAAVVSEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGK 233

Query: 240 YLQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNA 299
           YLQI+FD+ KNIIG+ I+TYLLERSRLVFQ  SERNYHIFYQ+L+GL + +K++L ++N 
Sbjct: 234 YLQIMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNP 293

Query: 300 EDFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKK 359
           E F+YLNQG +  I+G+DD+ E+  TI +LS +GI+  +Q+++FKILA LLHIGNIEIK+
Sbjct: 294 EQFYYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQ 353

Query: 360 TRTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSV 419
           + T +++S  +P+L+ ACELLGLDP  FSKW+TKK+I TRSEKI++NL   QALV RDSV
Sbjct: 354 SSTSSSISPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSV 413

Query: 420 AKFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEK 479
           +KFIYS LFDWLV  IN +L  ++VS+ + SFIGVLDIYGFEHFE NSFEQFCINYANEK
Sbjct: 414 SKFIYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEK 473

Query: 480 LQQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSD 539
           LQQEFN HVFKLEQEEYV+E+IEWSFIEF+DNQPCIDLIEN+LGILSLLDEESRLP+G+D
Sbjct: 474 LQQEFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTD 533

Query: 540 ESWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLE 599
           ESWT KLYQT +KPP N VF KP+FGQ KF+ISHYA +V Y+V+GFIEKN+DT+SES + 
Sbjct: 534 ESWTQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMN 593

Query: 600 VLKATTNPTLATIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINS 659
           VLK + N TL ++ + +E E  T   + A   + K IN+KPTLG +FK+SL ELME IN+
Sbjct: 594 VLKNSQNDTLISLTKPTE-ETSTPPPQTASISRPKLINKKPTLGFMFKKSLGELMEIINN 652

Query: 660 TNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYL 719
           TNVHYIRC+KPN+ K AW+FD+ MVLSQLRACG+LETIKISCAGFPSRW+F+EFI RYY+
Sbjct: 653 TNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYM 712

Query: 720 LAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLAYLEKIR 779
           L  T  W  V +  E + E  + FC  IL     S +K QIG+TKIFFK+GVLA LE +R
Sbjct: 713 LVDTTLWSDVAS-SESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAELESLR 771

Query: 780 SDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKTDAATLLQ 839
             K+  +A+ IQK IRA   R+ YL+ +  +++ Q+ IR    R  V+ ++KT  A ++Q
Sbjct: 772 LKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTKLALMMQ 831

Query: 840 TLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRANSPKHRY 899
              RS RVR +V + L +I+ +Q   R VL   ++Q    ++++IMIQS IR    K +Y
Sbjct: 832 ATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGYKHKTQY 891

Query: 900 QTLKTGTILIQALVRRKQSQEKLKQLKIQAE 930
           +  +     IQAL R   ++  + +L+ ++E
Sbjct: 892 RYFRKNYQAIQALSRSMLARSLMLKLRSESE 922

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 97/180 (53%), Gaps = 10/180 (5%)

Query: 1188 VLNKLQDKFYKTWLKQCFNQMKTVD-SILILFDTISEFTLFFQ---GTT----ELLTNII 1239
            +L+ L D F +    + FN   +V+ S +I F  + +   + Q   GT+     L   +I
Sbjct: 1191 ILSILNDMFREN--DKLFNDFASVEISNVISFKILQQKIKYIQSKMGTSAIEKSLFGKLI 1248

Query: 1240 TALLQHINAKWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRNVNQAC 1299
              L+Q++N    N +LIK  ++ +  G+  +  +  +L++C   K+ N     R  +Q  
Sbjct: 1249 ETLIQYLNLNVANHVLIKIPSVDFETGIILEKNLDTLLEYCEELKLSNCRNSTRQTSQMS 1308

Query: 1300 KLLQLRISNISDFQLVCEFCYDLSSLQMHALLTKYRPTQFEKPIPVDVLNHLSNTARRER 1359
            KLLQL IS++ + ++VC++C+ L+  Q+HALL K + +  EKP+P  V+  + + A+  +
Sbjct: 1309 KLLQLSISSVEELRVVCQYCFALNLTQIHALLAKQKASSDEKPMPYIVVKKVQSWAQETK 1368

>Scas_688.22
          Length = 1876

 Score =  513 bits (1320), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 285/774 (36%), Positives = 467/774 (60%), Gaps = 55/774 (7%)

Query: 70  NPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYSSEM 129
           NP   +   +++ L++LNE +VLH +++RY    IYTYSG+ L+A NP+  ++ +Y+ E 
Sbjct: 62  NPTSFDKVDNMSELTHLNEASVLHNLEKRYKDDMIYTYSGLFLVAINPYCNIK-IYTQEY 120

Query: 130 IQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAKYIMRFFASV 189
           I  Y   ++++  PHI+AIAEEAY++++   Q+Q+++V+GESGAGKT + K I+++ AS+
Sbjct: 121 INLYNGSSKEDNKPHIYAIAEEAYQKLLTEKQDQSVLVTGESGAGKTENTKKILQYLASI 180

Query: 190 EEEHFN-KEGD---SKHQEEMSDIE---VKILATNPVMEAFGNAKTTRNDNSSRFGKYLQ 242
                   E D   S++  E++  E   +KIL +NP++E+FGNA+T RN+NSSRFGK+++
Sbjct: 181 TSNKSKYSEADLLVSQNDNEINQFESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFIK 240

Query: 243 ILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLT--NAE 300
           I FD    I G+ I+ YLLE+SR++ Q   ERNYHIFYQ+L+GLS    ++L LT  +  
Sbjct: 241 IEFDERGKINGAHIEWYLLEKSRVINQHPEERNYHIFYQLLAGLSLQELRKLELTSKSVS 300

Query: 301 DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360
           D+ YL++   S I G++D+ ++   +++ +TVG   E    I+++L+ +LHIGN++    
Sbjct: 301 DYKYLSKSNPS-IPGVNDAQDFQDLLKAFTTVGFTHEEVNNIWQVLSIILHIGNVDFTSE 359

Query: 361 RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420
           ++       DPS     +LLG+    F+  +   +     E +  + + +QA    +S++
Sbjct: 360 KSQQATFKNDPST--LAKLLGVTEKEFTTAVLTPKTKAGKEWVTQSKNASQARFILNSLS 417

Query: 421 KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480
           + +Y  LF ++V  INN L  S ++    ++IG+LDI GFE F+ NSFEQ CINY NEKL
Sbjct: 418 RTLYEKLFSFIVERINNSLDHSSMTA---NYIGLLDIAGFEIFKHNSFEQLCINYTNEKL 474

Query: 481 QQEFNHHVFKLEQEEYVKEEIEWSFIEFS-DNQPCIDLIENK---LGILSLLDEESRLPA 536
           QQ FNHH+F LEQ EY+KE I+W+F++F  D Q  IDLIENK    G+L LLDEES LP 
Sbjct: 475 QQFFNHHMFVLEQNEYMKENIQWNFVDFGKDLQASIDLIENKSSPTGVLPLLDEESILPN 534

Query: 537 GSDESWTTKLYQTFNKPPSNTVFGKPRFGQNK----FIISHYAVDVTYEVDGFIEKNKDT 592
            SD+S+ +KL  T+++         P+F ++K    F++ HYA +V Y ++G++ KNKD 
Sbjct: 535 SSDDSFFSKLISTWDQKS-------PKFIRSKLPQCFVLKHYAGEVEYNIEGWLSKNKDP 587

Query: 593 ISESQLEVLKATTNPTLATIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVE 652
           +SE  + +L ++TN  + + F      N++N   +  + +        T  +  +   + 
Sbjct: 588 LSECMISMLSSSTNEIVTSFF------NESNKNVRGSSFR--------TASARHREQQML 633

Query: 653 LMETINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEE 712
           L++ + +T+ H++RCI PN  K+A  FD  ++L QLR  GVLE I+I+  G+P+R  F+E
Sbjct: 634 LLKQLETTHPHFVRCIIPNNRKKAKDFDRKLILDQLRCNGVLEGIRIAREGYPNRIFFKE 693

Query: 713 FIQRYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVL 772
           F QRY LL+  + +                 C+++LS        Y+IG +K+FFKAGVL
Sbjct: 694 FFQRYRLLSDENHFAT----------GFKKNCEILLSSLHLDPSLYKIGTSKLFFKAGVL 743

Query: 773 AYLEKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRV 826
           A LE  +  ++  + +    H+R +  R +  + ++ ++  + L    ++  R+
Sbjct: 744 AELETKKDQRIRSIVIRFNSHLRGRIIRKMTDEKLMKLRAARVLGNSFRTYNRL 797

>Kwal_23.5534
          Length = 1907

 Score =  506 bits (1304), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 300/801 (37%), Positives = 472/801 (58%), Gaps = 52/801 (6%)

Query: 70  NPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYSSEM 129
           NP   +   D++ L++LNEP+VLH ++ RY   NIYTYSG+ L+A NP+  +  +YS + 
Sbjct: 55  NPSTFDRIDDMSELTHLNEPSVLHNLENRYADDNIYTYSGLFLVAINPYSNIR-IYSQDY 113

Query: 130 IQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAKYIMRFFASV 189
           +  Y    +++  PHIFAIAEEAY+ +++  ++Q+I+V+GESGAGKT + K I+++ AS+
Sbjct: 114 VNLYHGSPKEDNKPHIFAIAEEAYQNLLSERRDQSILVTGESGAGKTENTKKILQYLASI 173

Query: 190 EEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKYLQILFDSNK 249
             +  +K      QE     E KIL +NP++E+FGNA+T RN+NSSRFGK+++I FD   
Sbjct: 174 TSD--DKLSPDTSQE---SFERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFDELG 228

Query: 250 NIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSS-DMKKQLYLTNA-EDFFYLNQ 307
            I G+ +  YLLE+SR++ Q + ERNYHIFYQMLSG+S+ ++++    TN+ +D+ YL  
Sbjct: 229 KINGAHVDWYLLEKSRVIQQNSRERNYHIFYQMLSGMSAQELRRYGLETNSIKDYGYLRN 288

Query: 308 GGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKTRTDATLS 367
              S I G+DDS ++ T + S   VG   +    +   ++ +LHIGNIE    R  A  +
Sbjct: 289 SNPS-IPGVDDSQDFRTLLSSFQIVGFSEDEIQSMLTCISIILHIGNIEFVSER--AEQA 345

Query: 368 STDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVAKFIYSSL 427
           S D S++  C LLG+    F   + K +     + +    + +QA    +S+++ +Y +L
Sbjct: 346 SFDGSVETLCNLLGVTEADFKVAVLKPRAKAGKDWVSQAKNAHQARFILNSLSRSLYENL 405

Query: 428 FDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKLQQEFNHH 487
           F  +V  INN L    ++E   ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FNHH
Sbjct: 406 FAHIVQRINNNLDHGSMTE---NYIGLLDIAGFEIFKHNSFEQLCINYTNEKLQQFFNHH 462

Query: 488 VFKLEQEEYVKEEIEWSFIEFS-DNQPCIDLIEN---KLGILSLLDEESRLPAGSDESWT 543
           +F LEQ EY+KE ++W+FI++  D Q  IDLIE    K GIL LLDEES LP  +DES+ 
Sbjct: 463 MFVLEQNEYLKENVQWNFIDYGKDLQSTIDLIERKDTKPGILPLLDEESILPKSTDESFY 522

Query: 544 TKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEVLKA 603
           +KL +TF    S+         Q  F++ HYA DV Y VDG++ KNKD + E+ L++L  
Sbjct: 523 SKL-ETFYSDKSSKFKRSK--KQRCFVLKHYAGDVEYNVDGWLSKNKDPLHENLLQMLSN 579

Query: 604 TTNPTLATIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINSTNVH 663
           ++N  +     +SE +++        + +  +I  +  L S+  R        ++ST  H
Sbjct: 580 SSNELIRGF--YSEKDSR------GSSFKTTSIRHRDQLKSLLDR--------LSSTEPH 623

Query: 664 YIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYLLAPT 723
           ++RCI PN +K+A  F+  ++L QLR  GVLE I+I+  G+P+R  F+EF QRY +L+  
Sbjct: 624 FVRCIIPNDKKKAHDFNRKLILDQLRCNGVLEGIRIAREGYPNRIFFKEFFQRYKILSDE 683

Query: 724 DQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLAYLEKIRSDKV 783
            ++   +             C+++LS        +++G +K+FFKAGVLA LE  +  ++
Sbjct: 684 YRFSNTSKKN----------CEIVLSSLRLDPSVFKVGNSKLFFKAGVLASLEAKKEGRI 733

Query: 784 TELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVD----FEMKTDAATLLQ 839
           +++A  +   I     R    Q +  ++  Q L    ++ Q++     F +      LL+
Sbjct: 734 SDMASKLNARINGNAVRRSTSQKLKKLQAAQVLGSAFETYQKMMGDPWFSLYVKIKPLLE 793

Query: 840 TLHRSTRVRSQVFETLKNILE 860
           +    ++ R ++ E +KN+ E
Sbjct: 794 STQEISKTR-KIAEQVKNLEE 813

>ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH]
           complement(480141..485558) [5418 bp, 1805 aa]
          Length = 1805

 Score =  498 bits (1282), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 290/749 (38%), Positives = 443/749 (59%), Gaps = 71/749 (9%)

Query: 70  NPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYSSEM 129
           NP   +   D++ L++LNE +VL+ ++ RY    IYTYSG+ L+A NP+  ++ +Y+ + 
Sbjct: 59  NPSTFDKIDDMSELTHLNEASVLYNLENRYKDDMIYTYSGLFLVALNPYSNIK-VYTQDY 117

Query: 130 IQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAKYIMRFFASV 189
           +  Y    +++  PHIFA+AE+AYR ++   Q+Q+++V+GESGAGKT + K I+++ AS+
Sbjct: 118 VNLYHGSPKEDNEPHIFAVAEQAYRNLLTQRQDQSVLVTGESGAGKTENTKKILQYLASI 177

Query: 190 EEE----HFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKYLQILF 245
             +    H N E            E KIL  NP++E+FGNA+T RN+NSSRFGK+++I F
Sbjct: 178 TSDEKLAHTNLES----------FERKILQANPILESFGNAQTVRNNNSSRFGKFIKIEF 227

Query: 246 DSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE--DFF 303
           D    I G+ I+ YLLE+SR++ Q   ERNYH+FYQ+LSG+ +   K L L +    D+ 
Sbjct: 228 DEFGKINGAHIEWYLLEKSRIIQQNIRERNYHVFYQLLSGMPAGKLKTLELVSNSITDYA 287

Query: 304 YLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKTRTD 363
           YL     S I G+DD+ ++S+ + + + VG   +    IF+ +A +LHIGN+E   TR +
Sbjct: 288 YLRDSNPS-IPGVDDAHDFSSLLSAFNVVGFKEDEIHDIFQCIAIILHIGNVEFTSTRAE 346

Query: 364 -ATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVAKF 422
            AT+ +    L   C+L+G+D   F   + K +     E +  + +  Q+    +S+++ 
Sbjct: 347 QATIKNDVAPL---CKLIGVDEAAFKMAVLKPKSKAGKEWVSQSKNAAQSRFILNSLSRS 403

Query: 423 IYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKLQQ 482
           +Y  LF  +V  IN  L    ++E   ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ
Sbjct: 404 LYEKLFAHIVRRINRSLDHGSMTE---NYIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQ 460

Query: 483 EFNHHVFKLEQEEYVKEEIEWSFIEFS-DNQPCIDLIE---NKLGILSLLDEESRLPAGS 538
            FNHH+F LEQ EYVKE+I+W FI++  D +  I+LIE   N  GILS+LDEES LP  +
Sbjct: 461 FFNHHMFVLEQREYVKEDIQWDFIDYGKDLEYTIELIEKKNNPAGILSILDEESILPKST 520

Query: 539 DESWTTKLYQTFNKPPSNTVFGK-PRFGQNK----FIISHYAVDVTYEVDGFIEKNKDTI 593
           DES+ +KL   ++        GK P+F ++K    F++ HYA DV Y V  ++ KNKD +
Sbjct: 521 DESFYSKLMSAWD--------GKSPKFKRSKLQQCFVLEHYAADVEYNVKDWLSKNKDPL 572

Query: 594 SESQLEVLKATTNPTLATIFEFSEAENKTNITEQA-GTIQRKTINRKPTLGSIFKRSLVE 652
           ++  L +L  ++N  ++  +           TEQ+ G   +   NR        K  L  
Sbjct: 573 NDHLLTLLSESSNKLISEFY-----------TEQSRGHFSKTASNR-------HKEQLTL 614

Query: 653 LMETINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEE 712
           L++ ++ST+ H++RCI PNT+K+A  FD  ++L QLR  GVLE I+I+  G+P+R  F E
Sbjct: 615 LLDQLSSTDPHFVRCIVPNTKKKAKTFDRKLILDQLRCNGVLEGIRIAREGYPNRIFFRE 674

Query: 713 FIQRYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVL 772
           F QRY +L          AD + S  +    C+ +LS        Y++G TK+FFKAGVL
Sbjct: 675 FFQRYKILG---------ADPKFS-NNSKKNCEYLLSCISLDPSLYKVGNTKLFFKAGVL 724

Query: 773 AYLEKIRSDKVTELAVLIQKHIRAKYYRS 801
           A LE  + +K++ +   +   I  K  R+
Sbjct: 725 AQLETQKEEKISGIVTGLNAIIHGKTVRT 753

>YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain
           (myosin II), coiled-coil protein involved in septation
           and cell wall organization [5787 bp, 1928 aa]
          Length = 1928

 Score =  497 bits (1280), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 307/816 (37%), Positives = 478/816 (58%), Gaps = 41/816 (5%)

Query: 9   CWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMENNHEFLPVL 68
            W P+ +  ++  E+   D     +  +   + G+V P+++  + SN       +  PV 
Sbjct: 13  VWIPDEKEVFVKGELMSTDINKNKFTGQ-EEQIGIVHPLDSTEV-SNLVQVRISDVFPV- 69

Query: 69  RNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYSSE 128
            NP   +   +++ L++LNEP+VL+ +++RY+   IYTYSG+ L+A NP+  +  LYS +
Sbjct: 70  -NPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLN-LYSED 127

Query: 129 MIQAYARK-NR-----------DEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKT 176
            I  Y  K NR           +++ PHIFAIAEEAY  +++  ++Q+I+V+GESGAGKT
Sbjct: 128 HINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKT 187

Query: 177 VSAKYIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSR 236
            + K I+++ AS+     +          +   E+KIL +NP++E+FGNA+T RN+NSSR
Sbjct: 188 ENTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNNSSR 247

Query: 237 FGKYLQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYL 296
           FGK+++I F+ +  I G+ I+ YLLE+SR+V Q + ERNYHIFYQ+LSGL     K L L
Sbjct: 248 FGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNLRL 307

Query: 297 T--NAEDFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGN 354
              N +D+  L+   +  I GI+D   +   + +L+ +G   +    IF+++A +L IGN
Sbjct: 308 KSRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLIGN 367

Query: 355 IEIKKTRTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALV 414
           IE    R +      D S    C  LG+D   F   I + +     E +  + +  QA  
Sbjct: 368 IEFVSDRAEQASFKNDVSA--ICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQAKF 425

Query: 415 ARDSVAKFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCIN 474
             +++++ +Y  LF ++V  IN  L     S T+N +IG+LDI GFE FE NSFEQ CIN
Sbjct: 426 ILNALSRNLYERLFGYIVDMINKNL--DHGSATLN-YIGLLDIAGFEIFENNSFEQLCIN 482

Query: 475 YANEKLQQEFNHHVFKLEQEEYVKEEIEWSFIEFS-DNQPCIDLIENK---LGILSLLDE 530
           Y NEKLQQ FN+H+F LEQ EY+KE I+W +I++  D Q  IDLIE+K    G+L LLDE
Sbjct: 483 YTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLLDE 542

Query: 531 ESRLPAGSDESWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNK 590
           E+ LP  +DES+ +KL  T+++  S   F + R  +N FI+ HYA DV Y V+G++ KNK
Sbjct: 543 EAVLPKSTDESFYSKLISTWDQNSSK--FKRSRL-KNGFILKHYAGDVEYTVEGWLSKNK 599

Query: 591 DTISESQLEVLKATTNPTLATIFE-----FSEAENKTNITEQAGTIQRKTINRKPTLGSI 645
           D ++++ L +L ++ N  ++ +F+      S A  + NI+ Q      +T   K T  S 
Sbjct: 600 DPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKSARTSTFKTT-SSR 658

Query: 646 FKRSLVELMETINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFP 705
            +   + L+  + ST+ H++RCI PN  K+   F+  ++L QLR  GVLE I+++  G+P
Sbjct: 659 HREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLAREGYP 718

Query: 706 SRWAFEEFIQRYYLLAPTDQWGRV-TADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTK 764
           +R AF+EF QRY +L P +      ++ ++ S +    F  L+ S ++D+K  Y+IG TK
Sbjct: 719 NRIAFQEFFQRYRILYPENSTTTTFSSKLKASTKQNCEF--LLTSLQLDTK-VYKIGNTK 775

Query: 765 IFFKAGVLAYLEKIRSDKVTELAVLIQKHIRAKYYR 800
           +FFKAGVLA LEK +  K+  + + +   IR    R
Sbjct: 776 LFFKAGVLADLEKQKDVKLNNIMIKLTATIRGYTVR 811

>KLLA0E11572g complement(1018972..1024518) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1 myosin-1 isoform
           (type II myosin) heavy chain, start by similarity
          Length = 1848

 Score =  488 bits (1256), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 290/746 (38%), Positives = 436/746 (58%), Gaps = 59/746 (7%)

Query: 70  NPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYSSEM 129
           NP   +   DL+ L++LNE +VL  ++ RY    IYTYSG+ L+A NP+  ++ +YS+  
Sbjct: 59  NPSTFDKVDDLSELTHLNEASVLFNLQNRYQDDLIYTYSGLFLVAINPYSNIK-IYSNSY 117

Query: 130 IQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAKYIMRFFASV 189
           I+ Y    +++  PHIFA+AE+AY+ +++  Q+Q+I+V+GESGAGKT + K I+++ AS+
Sbjct: 118 IKLYHGSPKEDNKPHIFAVAEQAYQNLLHQKQDQSILVTGESGAGKTENTKKILQYLASI 177

Query: 190 EEEH---FNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKYLQILFD 246
             +     N+  +S         E KIL +NP++E+FGNA+T RN+NSSRFGK+++I FD
Sbjct: 178 TTDDKILLNQTNES--------FERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIDFD 229

Query: 247 SNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE--DFFY 304
               I G+ I+ YLLE+SR++     ERNYHIFYQ+LSG+S    + + L +    D+ Y
Sbjct: 230 EYGKINGAHIEWYLLEKSRVIQAHARERNYHIFYQILSGMSKQELRAIGLESNSIVDYQY 289

Query: 305 LNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKTRTDA 364
           L     S I GIDD   Y   + +  TVG   +    I K ++ +LHIGN+E    R++ 
Sbjct: 290 LRHSNPS-IPGIDDGQNYQELVSAFETVGFTKDDIQSILKCISIILHIGNVEFVSERSEQ 348

Query: 365 TLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVAKFIY 424
             +S    ++  C+LLG+    F   + K +     E +    + +QA    +S+++ +Y
Sbjct: 349 --ASIKNDIKPLCKLLGVQEDDFKSAVLKPKSKAGKEWVSQAKNASQARSILNSLSRSLY 406

Query: 425 SSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKLQQEF 484
             LF+++V  IN  L    ++E    FIG+LDI GFE F+ NSFEQ CINY NEKLQQ F
Sbjct: 407 EKLFEYIVNQINKSLEHGSMTEY---FIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFF 463

Query: 485 NHHVFKLEQEEYVKEEIEWSFIEFS-DNQPCIDLIENK----LGILSLLDEESRLPAGSD 539
           NHH+F LEQ EY KE+I+W+FI++  D Q  IDLIE K     GIL +L+EES LP  SD
Sbjct: 464 NHHMFVLEQNEYQKEDIQWNFIDYGKDLQTTIDLIEQKNSSIPGILPILEEESILPKSSD 523

Query: 540 ESWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLE 599
            S+ +KL  +++     T F + +   N FI+ HYA DV Y V  ++ KNKD ++E+ L+
Sbjct: 524 ASFYSKLLSSWDNKS--TKFKRSKLD-NCFILKHYAGDVEYNVTDWLSKNKDPLNENLLQ 580

Query: 600 VLKATTNPTLATIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINS 659
           VL    NP ++  F              A  I+  +     T  +  +  L  L+E + +
Sbjct: 581 VLNDCANPLVSQFF--------------ADRIRGSSFR---TSSNKHREQLHTLIEQLGN 623

Query: 660 TNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYL 719
           T+ H++RCI PN +K+A  FD  ++L QLR  GVLE I+I+  G+P+R  F+EF QRY +
Sbjct: 624 TDPHFVRCIIPNNKKKAGDFDKKLILDQLRCNGVLEGIRIARDGYPNRIFFKEFFQRYKI 683

Query: 720 LAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLAYLEKIR 779
           L+      R T + + +       C+++LS        Y++G TK+FFKAGVLA LE ++
Sbjct: 684 LSDE---CRFTNNSKKN-------CEILLSSLHLDPTIYKVGNTKLFFKAGVLANLELLK 733

Query: 780 SDK----VTELAVLIQKHIRAKYYRS 801
             +    VT L  +I  +   K  RS
Sbjct: 734 EQRLSAAVTRLNAIISANSVRKEIRS 759

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1, hypothetical
           start
          Length = 1884

 Score =  477 bits (1228), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 293/806 (36%), Positives = 457/806 (56%), Gaps = 49/806 (6%)

Query: 8   RCWYPNSEAGWIGCEVTKNDF-QDGTYHIELTSETGLVIPIETKHLESNNAMENNHEFLP 66
           R W P+    ++  ++   D  +D    +E   + GLV     K  +   A     E  P
Sbjct: 6   RVWVPDPVEIFVRGDLLNTDIVKDKFTGVE--QQVGLV----KKDNDGETATFKISEIFP 59

Query: 67  VLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYS 126
           V  NP   +   +++ L++LNEP+VL+ ++ RY    IYTYSG+ L+A NP+ ++  LYS
Sbjct: 60  V--NPANFDRVDNMSELTHLNEPSVLNNLENRYKDNLIYTYSGLFLVAINPYKEISNLYS 117

Query: 127 SEMIQAYARKNRD-EMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAKYIMRF 185
           +  I++Y   N +    PHIF +AE AYR++ +  Q+Q+I+V+GESGAGKT + K I+++
Sbjct: 118 NSTIKSYHSSNEETSQKPHIFEVAESAYRDLKSKKQDQSILVTGESGAGKTENTKKILQY 177

Query: 186 FASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKYLQILF 245
            AS+  + F         E  ++ E+KIL +NPV+E+FGNA+T RN+NSSRFGK+++I F
Sbjct: 178 LASITSDSF---------EVSNNFEMKILQSNPVLESFGNAQTVRNNNSSRFGKFIKIEF 228

Query: 246 DSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAEDF--F 303
           D +  I G+ I+ YLLE+SR+  +  +ERNYHIFYQ+L G S    + +Y  ++ DF  +
Sbjct: 229 DQSGKINGAFIEWYLLEKSRITNENRNERNYHIFYQLLKGTSQKDLESIYKLSSNDFAHY 288

Query: 304 YLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKTRTD 363
            +       I G+DD+ E+   + +L TVG   +    IFKI+A +LH GNIE    +++
Sbjct: 289 QILANSNHVIPGVDDAAEFQKLLVALETVGFGKDQINSIFKIVAVILHCGNIEFVSEKSE 348

Query: 364 ATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVAKFI 423
                +D S      LLG+    F   I K +     E +    + NQA    +S+ + +
Sbjct: 349 QASFKSDISA--IATLLGVSESDFKTAILKPRSKAGREWVSQAKNANQARFIINSLCRTL 406

Query: 424 YSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKLQQE 483
           Y  LF ++V  IN  +  +  S T N +IG+LDI GFE FE NSFEQ CINY NEKLQQ 
Sbjct: 407 YEHLFGYIVDTIN--MSLNHGSMTAN-YIGLLDIAGFEIFEHNSFEQLCINYTNEKLQQF 463

Query: 484 FNHHVFKLEQEEYVKEEIEWSFIEFS-DNQPCIDLIENK---LGILSLLDEESRLPAGSD 539
           FNHH+F LEQ EY+KE I+W ++++  D Q  I+L+E K    GIL LLDEE+ LP   D
Sbjct: 464 FNHHMFVLEQSEYLKENIQWDYVDYGKDLQSTINLLEAKGPPTGILPLLDEETILPKSED 523

Query: 540 ESWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLE 599
            S+ +KL  T+ +  ++T F + +     F++ HYA DV Y V+G++ KNKD ++E+ + 
Sbjct: 524 SSFYSKLISTWQQ--NSTKFKRSKLDMC-FVLKHYAGDVEYHVNGWLAKNKDPLNENLVN 580

Query: 600 VLKATTNPTLATIFEFSE-----AENKTNITEQAGTIQRKTINRKPT-LGSIFKRSLVE- 652
           +L  ++N  ++  F   E     + + T +T  + +    ++ +  T L +   R   + 
Sbjct: 581 ILSVSSNRLISEFFSGFESISSPSSSPTRLTHSSSSASINSLGKGRTNLKTALSRHREQQ 640

Query: 653 --LMETINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAF 710
             L+  +  TN H++RCI PN +K +  FD  ++L QLR  GVLE I+I+  G+P+R  F
Sbjct: 641 SSLLSQLALTNPHFVRCIIPNNKKMSETFDRRLILDQLRCNGVLEGIRIAREGYPNRILF 700

Query: 711 EEFIQRYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAG 770
           +EF +RY +L  ++   + +  +       +   +L L         Y++G +K+FFKAG
Sbjct: 701 KEFYERYRIL--SEHLDKSSDAINYKQSSQILISELHLDPTT-----YKVGTSKLFFKAG 753

Query: 771 VLAYLEKIRSDKVTELAVLIQKHIRA 796
            LA LE  +   + E+ V     IR 
Sbjct: 754 TLAELESKKESILFEITVRFNSIIRG 779

>Scas_721.119
          Length = 1232

 Score =  449 bits (1154), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 270/722 (37%), Positives = 402/722 (55%), Gaps = 44/722 (6%)

Query: 79  DLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYSSEMIQAYARKNR 138
           DLT LS +++  +   +K+R+    IYTY G VLI+ NPF  +  +Y+  ++++Y  KNR
Sbjct: 40  DLTLLSKISDETINDNLKKRFMNGTIYTYIGHVLISVNPFRDLG-IYTDAIVESYKGKNR 98

Query: 139 DEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAKYIMRFFASVEEEHFNKEG 198
            E+ PH+FAIAE  Y  M + ++NQ +I+SGESGAGKT +AK IM++ AS          
Sbjct: 99  LEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIASA--------- 149

Query: 199 DSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKYLQILFDSNKNIIGSSIKT 258
            + H E +  I+  +LATNP++E+FG AKT RN+NSSR GKYL+I F+S       +I  
Sbjct: 150 STTHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITN 209

Query: 259 YLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAEDFFYLNQGGESTINGIDD 318
           YLLE+ R+V Q  +ERN+HIFYQ   G S   ++   +   E + Y +  G ++++ IDD
Sbjct: 210 YLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYIYTSASGCTSVDTIDD 269

Query: 319 SLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIE-IKKTRTDATLSSTDPSLQKAC 377
             +Y  T++++  +G+  E Q QIF++LAA+L IGN+  ++    +A +  T  +     
Sbjct: 270 VNDYRETLKAMEVIGLHQEEQDQIFRMLAAVLWIGNVSFVENEEGNAQVRDTSVT-DFVA 328

Query: 378 ELLGLDPLTFSKWITKKQINT-----RSEKIISNLSFNQALVARDSVAKFIYSSLFDWLV 432
            LL +D     K + ++ + T     R       L+  QA   RD++AK IY++LF+W+V
Sbjct: 329 YLLQIDAPLLIKSLVERVMETNHGMRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWIV 388

Query: 433 GNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKLQQEFNHHVFKLE 492
           G +N  L   Q     +  IG+LDIYGFE FE NSFEQ CINY NEKLQQ F     K E
Sbjct: 389 GRVNVSL---QAYPGADRSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSE 445

Query: 493 QEEYVKEEIEWSFIEFSDNQPCIDLIENK--LGILSLLDEESRLPAGSDESWTTKLYQTF 550
           QE Y +E+I+W+ I++ DN+   DLIE K   GI + +++          +      Q  
Sbjct: 446 QETYKREKIKWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSNAADQAFAQRL 505

Query: 551 NKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEVLKATTNPTLA 610
           N   SN  F       NKF+I HYA DVTY+V+G  +KNKD + +  +E++  TTNP L+
Sbjct: 506 NMFSSNPHF---ELRSNKFVIKHYAGDVTYDVNGITDKNKDQLQKDLVELIATTTNPFLS 562

Query: 611 TIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINSTNVHYIRCIKP 670
            IF                 + +++  R PT G    +S  EL+ET++     YIR IKP
Sbjct: 563 GIFPVE--------------VDKESKRRPPTAGDKIIKSANELVETLSKAQPSYIRTIKP 608

Query: 671 NTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYLLAPTDQWGRVT 730
           N  K    +D+  VL Q++  G+ E ++I  AGF  R  FE+F++R+YLL+P   +    
Sbjct: 609 NQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPHCSYA--- 665

Query: 731 ADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAG-VLAYLEKIRSDKVTELAVL 789
            D     E + A   ++    I + + YQ+G T +F K    L  LE +R      +A  
Sbjct: 666 GDYTWQGETLDAVQHILNDASIPASE-YQLGTTSVFIKTPETLFALEHMRDRYWHNMAAR 724

Query: 790 IQ 791
           IQ
Sbjct: 725 IQ 726

>KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w MYO5 myosin I, start by
           similarity
          Length = 1260

 Score =  448 bits (1153), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 270/726 (37%), Positives = 405/726 (55%), Gaps = 44/726 (6%)

Query: 79  DLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYSSEMIQAYARKNR 138
           DLT LS +++ A+   +K+R+    IYTY G VLI+ NPF  +  +Y+  ++++Y  KNR
Sbjct: 38  DLTLLSSISDDAINQNLKKRFENGTIYTYIGHVLISVNPFRDLG-IYTDAVLESYKGKNR 96

Query: 139 DEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAKYIMRFFASVEEEHFNKEG 198
            E+ PH+FAIAE  Y  +   ++NQ +I+SGESGAGKT +AK IM++ A+          
Sbjct: 97  LEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAAS-------- 148

Query: 199 DSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKYLQILFDSNKNIIGSSIKT 258
            S H+  +  I+  +LATNP++E+FG AKT RN+NSSR GKYL+I F+         I  
Sbjct: 149 -STHEASIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNEQFEPCAGQITN 207

Query: 259 YLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAEDFFYLNQGGESTINGIDD 318
           YLLE+ R+V Q  +ERN+HIFYQ   G S   ++   +   + + Y +  G ++++ IDD
Sbjct: 208 YLLEKQRVVGQIRNERNFHIFYQFTKGASDTYRQNFGVLQPDQYIYTSASGCTSVDTIDD 267

Query: 319 SLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIE-IKKTRTDATLSSTDPSLQKAC 377
             +Y  TI+++  +G+  E Q QIF++L+A+L IGN+  ++    +A +  T  +     
Sbjct: 268 LHDYQETIKAMQVIGLSQEEQDQIFRMLSAILWIGNVTFVENNEGNAEVRDTSVT-DFVA 326

Query: 378 ELLGLDPLTFSKWITKKQINT-----RSEKIISNLSFNQALVARDSVAKFIYSSLFDWLV 432
            L+ +D     K + ++ + T     R       L+  QA   RD++AK IY++LFDW+V
Sbjct: 327 YLMQVDSGLLIKCLVERVMETGHGSRRGSVYHVPLNVVQATAVRDALAKAIYNNLFDWIV 386

Query: 433 GNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKLQQEFNHHVFKLE 492
             +N  +        + S IG+LDIYGFE FE NSFEQ CINY NEKLQQ F     K E
Sbjct: 387 DRVN--VSLKAFPGAVKS-IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSE 443

Query: 493 QEEYVKEEIEWSFIEFSDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTTKLYQTF 550
           QEEY KE+I+W+ I++ DN+   DLIE+K   GI + LD+          +      Q  
Sbjct: 444 QEEYNKEQIQWTPIKYFDNKVVCDLIESKRPPGIFATLDDSVATAHADSNAADQAFAQRL 503

Query: 551 NKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEVLKATTNPTLA 610
           N   +N  F       +KF+I HYA DVTY++ G  +KNKD + +   E+++ TTNP L+
Sbjct: 504 NLFSTNAHFD---LRSSKFVIKHYAGDVTYDISGMTDKNKDQLVKDLAELVQTTTNPFLS 560

Query: 611 TIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINSTNVHYIRCIKP 670
           TIF                TI + +  R PT G+   +S  EL+ET++     YIR IKP
Sbjct: 561 TIF--------------PDTIDKSSKRRPPTAGNKIIKSANELVETLSKAQPSYIRTIKP 606

Query: 671 NTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYLLAPTDQWGRVT 730
           N  K    +D+  VL Q++  G+ E ++I  AGF  R  FE+F++R+YLL+P   +    
Sbjct: 607 NQTKSPRDYDDQQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPKCSYA--- 663

Query: 731 ADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAG-VLAYLEKIRSDKVTELAVL 789
            D     + + A   ++    I + + YQ+G TK+F K    L  LE +R      +A  
Sbjct: 664 GDYTWQGDTLGAVKQILQDASIPTTE-YQLGVTKVFIKTPETLFALEHMRDRYWYNMAAR 722

Query: 790 IQKHIR 795
           IQ+  R
Sbjct: 723 IQRAWR 728

>YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may
           play a role in cell growth or polarity that is partially
           redundant with Myo3p, appears to stimulate actin patch
           formation, has an SH3 domain [3660 bp, 1219 aa]
          Length = 1219

 Score =  441 bits (1135), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 272/726 (37%), Positives = 397/726 (54%), Gaps = 44/726 (6%)

Query: 79  DLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYSSEMIQAYARKNR 138
           DLT LS +++ A+   +K+R+    IYTY G VLI+ NPF  +  +Y+  ++  Y  KNR
Sbjct: 40  DLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPFRDLG-IYTDAVMNEYKGKNR 98

Query: 139 DEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAKYIMRFFASVEEEHFNKEG 198
            E+ PH+FAIAE  Y  M + ++NQ +I+SGESGAGKT +AK IM++ A+          
Sbjct: 99  LEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAAS-------- 150

Query: 199 DSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKYLQILFDSNKNIIGSSIKT 258
            S H E +  I+  +LATNP++E+FG AKT RN+NSSR GKYL+I F++       +I  
Sbjct: 151 -STHTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITN 209

Query: 259 YLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAEDFFYLNQGGESTINGIDD 318
           YLLE+ R+V Q  +ERN+HIFYQ   G S   ++   +   E + Y    G  +   IDD
Sbjct: 210 YLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDD 269

Query: 319 SLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIE-IKKTRTDATLSSTDPSLQKAC 377
             +Y  T++++  +G+  E Q QIF++LAA+L IGN+  I+    +A +  T  +     
Sbjct: 270 LQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEGNAQVRDTSVT-DFVA 328

Query: 378 ELLGLDPLTFSKWITKKQINT-----RSEKIISNLSFNQALVARDSVAKFIYSSLFDWLV 432
            LL +D     K + ++ + T     R       L+  QA   RD++AK IY++LFDW+V
Sbjct: 329 YLLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIV 388

Query: 433 GNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKLQQEFNHHVFKLE 492
             +N  L   Q        IG+LDIYGFE FE NSFEQ CINY NEKLQQ F     K E
Sbjct: 389 SRVNKSL---QAFPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSE 445

Query: 493 QEEYVKEEIEWSFIEFSDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTTKLYQTF 550
           QE Y +E+I+W+ I++ DN+   DLIE +   GI + +++          +      Q  
Sbjct: 446 QETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRL 505

Query: 551 NKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEVLKATTNPTLA 610
           N   +N  F       NKF+I HYA DVTY++DG  +KNKD + +  +E++  TTN  LA
Sbjct: 506 NLFTTNPHFD---LRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLA 562

Query: 611 TIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINSTNVHYIRCIKP 670
           TIF                T+ R++  R PT G    +S  +L+ET++     YIR IKP
Sbjct: 563 TIF--------------PDTVDRESKRRPPTAGDKIIKSANDLVETLSKAQPSYIRTIKP 608

Query: 671 NTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYLLAPTDQWGRVT 730
           N  K    +D+  VL Q++  G+ E ++I  AGF  R  FE+F++R+YLL+P   +    
Sbjct: 609 NETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSPHCSYA--- 665

Query: 731 ADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAG-VLAYLEKIRSDKVTELAVL 789
            D      D +     IL +    + +YQ+G T +F K    L  LE +R      +A  
Sbjct: 666 GDYTWQ-GDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWHNMAAR 724

Query: 790 IQKHIR 795
           IQ+  R
Sbjct: 725 IQRAWR 730

>CAGL0K07590g 748352..752110 highly similar to sp|P36006
           Saccharomyces cerevisiae YKL129c or sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin like proteins,
           start by similarity
          Length = 1252

 Score =  439 bits (1128), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 279/750 (37%), Positives = 410/750 (54%), Gaps = 49/750 (6%)

Query: 79  DLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYSSEMIQAYARKNR 138
           DLT LS +++ ++   +K+R+    IYTY G VLI+ NPF  +  +Y+ + +++Y  KNR
Sbjct: 40  DLTLLSKISDESINDNLKKRFEHGIIYTYIGYVLISVNPFRDLG-IYTDDTMKSYQGKNR 98

Query: 139 DEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAKYIMRFFASVEEEHFNKEG 198
            E  PH+FAIAE  Y  + + ++NQ +I+SGESGAGKT +AK IM++ A+          
Sbjct: 99  LEAPPHVFAIAENMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAATS-------- 150

Query: 199 DSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKYLQILFDSNKNIIGSSIKT 258
            S H E +S I+  +LATNP++E+FG AKT RN+NSSR GKYL+I FD++       I  
Sbjct: 151 -STHSESISKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFDAHFQPCAGHITN 209

Query: 259 YLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAEDFFYLNQGGESTINGIDD 318
           YLLE+ R+V Q  +ERN+HIFYQ   G   + ++   +   E + Y +    + +  +DD
Sbjct: 210 YLLEKQRVVGQIKNERNFHIFYQFTKGAPEEYRQLFGVQQPEQYIYTSASQCTAVENMDD 269

Query: 319 SLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKTRT------DATLSSTDPS 372
             E++ T+ ++ T+G+    Q QIF+ LAA+L IGNI   +         D ++++    
Sbjct: 270 VEEFNETLNAMRTIGLTKSEQDQIFRALAAILWIGNISFVENEAGNAEIRDKSVTTFVAY 329

Query: 373 LQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVAKFIYSSLFDWLV 432
           L +  E L +  L   + I       R     S L+  QA   RD++AK IY++LF+W+V
Sbjct: 330 LLEVQEELLIKAL-IERIIETTHGAKRGSTYHSPLNIIQATAVRDALAKAIYNNLFEWIV 388

Query: 433 GNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKLQQEFNHHVFKLE 492
             +NN L   Q     +  IG+LDIYGFE FE NSFEQ CINY NEKLQQ F     K E
Sbjct: 389 ERVNNSL---QAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSE 445

Query: 493 QEEYVKEEIEWSFIEFSDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTTKLYQTF 550
           Q+ Y KE+I W+ IE+ DN+   DLIE K   GI + +++         ++      Q  
Sbjct: 446 QDTYKKEQIHWTPIEYFDNKIVCDLIEAKRPPGIFAAMNDAIATAHADSDAADQAFAQRL 505

Query: 551 NKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEVLKATTNPTLA 610
           N   +N  F      QNKF++ HYA DVTY++ G  +KNKD + +  +E+L  T+N  + 
Sbjct: 506 NLFTTNPHF---ELRQNKFVVKHYAGDVTYDIFGITDKNKDQLQKDLVELLSTTSNSFVR 562

Query: 611 TIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINSTNVHYIRCIKP 670
            IF            +Q  T  R+   R PT G    +S  EL+ET++     YIR IKP
Sbjct: 563 EIF-----------PDQPQTDSRR---RPPTSGDKIIKSANELVETLSKAQPSYIRTIKP 608

Query: 671 NTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYLLAPTDQWGRVT 730
           N  K +  +D+  VL Q++  G+ E ++I  AGF  R  FE+F++R+YLL+P   +    
Sbjct: 609 NDTKSSTIYDDQRVLHQIKYLGLKENVRIRRAGFAHRQVFEKFVERFYLLSPQCSYA--- 665

Query: 731 ADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFK-AGVLAYLEKIRSDKVTELAVL 789
            D     E + A   LIL +      +Y+IG T+IF K    L  LE +R      +A  
Sbjct: 666 GDYVWDGETLDA-VKLILQDASIPTTEYEIGVTQIFIKHPETLFALENMRDKYWYNMAAR 724

Query: 790 IQKHIRAKYYRSLYLQAMLSIKNCQSLIRG 819
           IQ+  R   Y    + A + I+N    IRG
Sbjct: 725 IQRAWRR--YLQKRIDAAIRIQNA---IRG 749

>CAGL0K03487g 322030..325683 highly similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin-like protein,
           start by similarity
          Length = 1217

 Score =  437 bits (1124), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 270/727 (37%), Positives = 411/727 (56%), Gaps = 46/727 (6%)

Query: 79  DLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYSSEMIQAYARKNR 138
           DLT L+ +++ ++   +K+R+    IYTY G VLI+ NPF  +  +Y+  ++++Y  KNR
Sbjct: 41  DLTLLTSISDESINDNLKKRFLNGTIYTYIGHVLISVNPFRDLG-IYTDAIMKSYQGKNR 99

Query: 139 DEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAKYIMRFFASVEEEHFNKEG 198
            E+ PH++AI+E  Y  +   ++NQ +I+SGESGAGKT +AK IM + A+          
Sbjct: 100 LEVPPHVYAISEAMYYNLKAYNENQCVIISGESGAGKTEAAKKIMEYIAATS-------- 151

Query: 199 DSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKYLQILFDSNKNIIGSSIKT 258
            S H E +  I+  +LATNP++E+FG AKT RN+NSSR GKYL+I F+S       +I  
Sbjct: 152 -STHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITN 210

Query: 259 YLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAEDFFYLNQGGESTINGIDD 318
           YLLE+ R+V Q T+ERN+HIFYQ   G S + ++   +   E + Y +    ++++ IDD
Sbjct: 211 YLLEKQRVVGQITNERNFHIFYQFTKGASDNYRQTFGVQLPEQYVYTSASKCTSVDTIDD 270

Query: 319 SLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIE-IKKTRTDATLSSTDPSLQKAC 377
             ++  TI+++  +G+  E Q QIF++LAA+L IGNI  I+    +A +  T  +     
Sbjct: 271 VKDFEATIKAMQVIGLAQEEQDQIFRMLAAILWIGNISFIENEEGNAQVRDTSVT-DFVA 329

Query: 378 ELLGLDPLTFSKWITKKQINT-----RSEKIISNLSFNQALVARDSVAKFIYSSLFDWLV 432
            LL +D  +  K + ++ + T     R       L+  QA   RD++AK IY++LF+W+V
Sbjct: 330 YLLQVDSQSLIKALVERIVETNHGSRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWIV 389

Query: 433 GNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKLQQEFNHHVFKLE 492
             +N  L         +  IG+LDIYGFE FE NSFEQ CINY NEKLQQ F     K E
Sbjct: 390 DRVNKSL---HAYPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSE 446

Query: 493 QEEYVKEEIEWSFIEFSDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTTKLY-QT 549
           Q+ Y +E+I+W+ I++ DN+   DLIE K   GI + ++ +S   A +D S   + + Q 
Sbjct: 447 QDTYAREKIQWTPIKYFDNKVVCDLIEAKRPPGIFAAMN-DSVATAHADSSAADQAFAQR 505

Query: 550 FNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEVLKATTNPTL 609
            +   SN  F +    QNKF+I HYA DVTY+V G  +KNKD + +  +E++  TTN  L
Sbjct: 506 LSLFSSNPHFEQ---RQNKFVIKHYAGDVTYDVLGMTDKNKDQLQKDLVELVGTTTNAFL 562

Query: 610 ATIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINSTNVHYIRCIK 669
            T+F                 + +    R PT G    +S  EL+ET++     YIR IK
Sbjct: 563 TTLF--------------PNQVDKDNKRRPPTAGDKIIKSANELVETLSKAQPSYIRTIK 608

Query: 670 PNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYLLAPTDQWGRV 729
           PN  K    +D+  VL Q++  G+ E ++I  AGF  R  FE+F++R+YLL+P   +   
Sbjct: 609 PNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQGFEKFVERFYLLSPRCSYA-- 666

Query: 730 TADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAG-VLAYLEKIRSDKVTELAV 788
             D   +  D++    LIL + +  + +YQ+G T++F K    L  LE +R      +A 
Sbjct: 667 -GDYTWT-GDILEAVRLILQDALIPEKEYQLGVTQVFIKTPETLFALENMRDKFWHNMAA 724

Query: 789 LIQKHIR 795
            IQ+  R
Sbjct: 725 RIQRAWR 731

>YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin type
           I, may play a role in cell growth or polarity that is
           partially redundant with Myo5p, has an SH3 domain [3816
           bp, 1271 aa]
          Length = 1271

 Score =  438 bits (1126), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 273/727 (37%), Positives = 405/727 (55%), Gaps = 47/727 (6%)

Query: 79  DLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYSSEMIQAYARKNR 138
           DLT LS +++ ++   +K+R+    IYTY G VLI+ NPF  +  +Y++ ++++Y  KNR
Sbjct: 40  DLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPFRDLG-IYTNAVLESYKGKNR 98

Query: 139 DEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAKYIMRFFASVEEEHFNKEG 198
            E+ PH+FAIAE  Y  + + ++NQ +I+SGESGAGKT +AK IM++ A+          
Sbjct: 99  LEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAAS-------- 150

Query: 199 DSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKYLQILFDSNKNIIGSSIKT 258
            + H E +  I+  +LATNP++E+FG AKT RN+NSSR GKYL+I F+S       +I  
Sbjct: 151 -NSHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITN 209

Query: 259 YLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAEDFFYLNQGGESTINGIDD 318
           YLLE+ R+V Q  +ERN+HIFYQ   G S   K+   +   E + Y    G ++ + +  
Sbjct: 210 YLLEKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYTAAAGCTSADQLMR 269

Query: 319 SLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIE-IKKTRTDATLSSTDPSLQKAC 377
             +Y  T+E++ T+G+  E Q QIF++LAA+L IGNI  I+    +A +  T  +     
Sbjct: 270 K-DYEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIENEEGNAQVGDTSVT-DFVA 327

Query: 378 ELLGLDPLTFSKWITKKQINT-----RSEKIISNLSFNQALVARDSVAKFIYSSLFDWLV 432
            LL +D     K + ++ + T     R       L+  QA   RD++AK IY++LFDW+V
Sbjct: 328 YLLQVDASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIV 387

Query: 433 GNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKLQQEFNHHVFKLE 492
             +N  L   Q     +  IG+LDIYGFE FE NSFEQ CINY NEKLQQ F     K E
Sbjct: 388 DRVNVSL---QAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAE 444

Query: 493 QEEYVKEEIEWSFIEFSDNQPCIDLIE--NKLGILSLLDEESRLPAGSDESWTTKLYQTF 550
           QE Y +E+I+W+ I++ DN+   DLIE  N  GIL+ +++          +      Q  
Sbjct: 445 QETYEREKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQRL 504

Query: 551 NKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEVLKATTNPTLA 610
           N   SN  F       NKF+I HYA DVTY+++G  +KNKD + +  +E++  TTN  L+
Sbjct: 505 NLFNSNPYF---ELRANKFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLS 561

Query: 611 TIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINSTNVHYIRCIKP 670
           TIF                 + + +  R PT G    +S  EL+ET++     YIR IKP
Sbjct: 562 TIF--------------PDDVDKDSKRRPPTAGDKIIKSANELVETLSKAEPSYIRTIKP 607

Query: 671 NTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYLLAPTDQW-GRV 729
           N  K    +D+  VL Q++  G+ E ++I  AGF  R  FE+F++R+YLL+P   + G  
Sbjct: 608 NQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPDCSYAGDY 667

Query: 730 TADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAG-VLAYLEKIRSDKVTELAV 788
           T D      D +    LIL + +  + ++Q+G T +F K    L  LE +R      +A 
Sbjct: 668 TWD-----GDTLEAVKLILRDAMIPEKEFQLGVTSVFIKTPESLFALEDMRDKYWYNMAA 722

Query: 789 LIQKHIR 795
            IQ+  R
Sbjct: 723 RIQRAWR 729

>Kwal_26.7587
          Length = 1250

 Score =  436 bits (1120), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 271/750 (36%), Positives = 411/750 (54%), Gaps = 51/750 (6%)

Query: 79  DLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYSSEMIQAYARKNR 138
           DLT LS +++ A+   +K+R+    IYTY G VLI+ NPF  +  +Y+  ++++Y  KNR
Sbjct: 40  DLTLLSKISDEAINENLKKRFQNGTIYTYIGHVLISVNPFRDLG-IYTDSVLRSYVGKNR 98

Query: 139 DEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAKYIMRFFASVEEEHFNKEG 198
            E+APH+FAIAE  Y  M   ++NQ +I+SGESGAGKT +AK IM++ A+  E       
Sbjct: 99  LEVAPHVFAIAESMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASE------- 151

Query: 199 DSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKYLQILFDSNKNIIGSSIKT 258
              H + +  I+  +LATNP++E+FG AKT RN+NSSR GKYL+I F++       +I  
Sbjct: 152 --THSDSIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGNITN 209

Query: 259 YLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLY-LTNAEDFFYLNQGGESTINGID 317
           YLLE+ R+V Q   ERN+HIFYQ   G +SD  +Q+Y +   E + Y +  G ++++ ID
Sbjct: 210 YLLEKQRVVGQLKDERNFHIFYQFTKG-ASDNYRQIYGVQKPEQYLYTSASGCTSVDTID 268

Query: 318 DSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKTRTDATLSSTDPSLQK-A 376
           D  ++  T+ ++S +GI    Q ++F+ LAA+L IGNI   +   +      D S+    
Sbjct: 269 DLSDFQETLNAMSVIGITQHEQDEVFRFLAAILWIGNISFTENE-EGNAQVRDTSVTDFV 327

Query: 377 CELLGLDPLTFSKWITKKQINT-----RSEKIISNLSFNQALVARDSVAKFIYSSLFDWL 431
             LL +D     + + ++ + T     R       L+  QA   +D++AK IY++LFDW 
Sbjct: 328 AYLLQVDSNLLVQALVERVMETNHGMKRGSIYHVPLNVVQATAVKDALAKAIYNNLFDWT 387

Query: 432 VGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKLQQEFNHHVFKL 491
           V  +N  L   Q     N  IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F     K 
Sbjct: 388 VDRVNLSL---QALPGANKSIGILDIYGFEIFDYNSFEQICINYVNEKLQQIFIQLTLKS 444

Query: 492 EQEEYVKEEIEWSFIEFSDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTTKLYQT 549
           EQEEY +E+IEW+ I++ DN+   DLIE +   GI++ +++         ++      Q 
Sbjct: 445 EQEEYAREQIEWTPIKYFDNRVVCDLIEARRPPGIIAAMNDSVATAHADSDAADQAFAQR 504

Query: 550 FNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEVLKATTNPTL 609
            N   SN  F       +KFII HYA DVTY++ G  +KNKD + +  +E++K ++N  L
Sbjct: 505 LNLFSSNPHF---ELRSSKFIIKHYAGDVTYDIFGMTDKNKDQLQKDLVELVKTSSNEFL 561

Query: 610 ATIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINSTNVHYIRCIK 669
            ++F                 + + +  R P+ G    +S  EL+ET++     YIR IK
Sbjct: 562 CSLF--------------PTVVDKNSKRRPPSAGDKIIKSANELVETLSKAQPSYIRTIK 607

Query: 670 PNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYLLAPTDQWGRV 729
           PN  K    +D+  VL Q++  G+ E ++I  AGF  R  F++F++R+YLL+P   +   
Sbjct: 608 PNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQVFDKFVERFYLLSPQCSYA-- 665

Query: 730 TADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAG-VLAYLEKIRSDKVTELAV 788
             D      D +    LIL +      +YQ+G +K+F K    L  LE +R      +A 
Sbjct: 666 -GDYTWQ-GDTLEAVKLILKDASIPPTEYQLGVSKVFIKTPESLFALETMRDKYWHNMAA 723

Query: 789 LIQKHIRAKYYRSLYLQAMLSIKNCQSLIR 818
            IQ+      +R   L+ + +    Q  IR
Sbjct: 724 RIQRA-----WRRFLLRRIDAASRIQRAIR 748

>AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C
           (MYO3) - SH] (65141..69019) [3879 bp, 1292 aa]
          Length = 1292

 Score =  417 bits (1072), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 268/726 (36%), Positives = 402/726 (55%), Gaps = 44/726 (6%)

Query: 79  DLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYSSEMIQAYARKNR 138
           DLT LS +++  +   +K R+   +IYTY G VLI+ NPF  +  +Y+ ++++ Y  +NR
Sbjct: 39  DLTLLSKISDEHINENLKRRFENGSIYTYIGHVLISVNPFRDLG-IYTDQVLETYKGRNR 97

Query: 139 DEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAKYIMRFFASVEEEHFNKEG 198
            E+ PH+FAIAE  Y  +   ++NQ +I+SGESGAGKT +AK IM++ A+          
Sbjct: 98  LEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAAS-------- 149

Query: 199 DSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKYLQILFDSNKNIIGSSIKT 258
            S H+  +  I+  +LATNP++E+FG AKT RN+NSSR GKYL+I F++        I  
Sbjct: 150 -SSHEASIGRIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGQITN 208

Query: 259 YLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAEDFFYLNQGGESTINGIDD 318
           YLLE+ R+V Q  +ERN+HIFYQ   G S   +K   +   E + Y +  G ++++ IDD
Sbjct: 209 YLLEKQRVVGQIKNERNFHIFYQFSKGASDRYRKTYGVQLPEQYVYTSASGCTSVDTIDD 268

Query: 319 SLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIE-IKKTRTDATLSSTDPSLQKAC 377
             +Y  T+E+++ +G+    Q +IF++L+A+L IGN+  ++    +A ++ T  +     
Sbjct: 269 LNDYEATLEAMNVIGLSQAEQDEIFRLLSAILWIGNVTFMEDDEGNAKIADTSIT-DFVA 327

Query: 378 ELLGLDPLTFSKWITKKQINTR---SEKIISNLSFN--QALVARDSVAKFIYSSLFDWLV 432
            LL +D     K + ++ I T        I N+  N  QA   RD++AK IY++LF+W+V
Sbjct: 328 YLLQVDAGLLVKSLVERTIETTHGMRRGSIYNVPLNIVQATAVRDALAKAIYNNLFEWIV 387

Query: 433 GNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKLQQEFNHHVFKLE 492
             +N  L   Q        IG+LDIYGFE FE NSFEQ CINY NEKLQQ F     K E
Sbjct: 388 DRVNVSL---QALPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSE 444

Query: 493 QEEYVKEEIEWSFIEFSDNQPCIDLIENK--LGILSLLDEESRLPAGSDESWTTKLYQTF 550
           QEEY KE+I+W+ I++ DN+   +LIE K   GI + L++          +      Q  
Sbjct: 445 QEEYAKEQIQWTPIKYFDNKVVCELIEAKRPPGIFAALNDSVATAHADSNAADQAFAQRL 504

Query: 551 NKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEVLKATTNPTLA 610
           N   SN  F       +KF+I HYA DVTY++ G  +KNKD +    +E+L +T+N  LA
Sbjct: 505 NLFTSNPHF---ELRSSKFVIKHYAGDVTYDIGGMTDKNKDQLQRDLVELLNSTSNTFLA 561

Query: 611 TIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINSTNVHYIRCIKP 670
           TIF  +  ++   I   AG    K I           RS  EL++T++     YIR IKP
Sbjct: 562 TIFPDTGDKDSKRIPSTAGD---KII-----------RSANELVDTLSKAQPSYIRTIKP 607

Query: 671 NTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYLLAPTDQWGRVT 730
           N  K    +D+  VL Q++  G+ E ++I  A +  R  F++F++R+YLL+P   +    
Sbjct: 608 NQTKSPLDYDDRQVLHQVKYLGLQENVRIRRACYAYRHIFDKFVERFYLLSPQCSYA--- 664

Query: 731 ADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAG-VLAYLEKIRSDKVTELAVL 789
            D       + A  +LIL +      +YQ+G TK+F K    L  LE +R      +A  
Sbjct: 665 GDYTWQGNTLDA-VNLILRDTSIPVTEYQLGVTKVFIKTPETLFALENMRDKYWHNMASR 723

Query: 790 IQKHIR 795
           IQ+  R
Sbjct: 724 IQRAWR 729

>Scas_677.29
          Length = 246

 Score = 32.3 bits (72), Expect = 2.0,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 3/78 (3%)

Query: 521 KLGILSLLDEESRLPAGSDESWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTY 580
           K  + SLL   + L A     W  +   T   PPS    G  +F  N  +I+    +VT 
Sbjct: 10  KPTVFSLLINLTSLAACG---WGLRWAATIELPPSLKQAGHKQFLTNISVIATLISNVTN 66

Query: 581 EVDGFIEKNKDTISESQL 598
             + FI++NKD+I   +L
Sbjct: 67  VANFFIQRNKDSIKCKKL 84

>Scas_719.9*
          Length = 897

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 12/123 (9%)

Query: 948  GFIEELISNI--KENDAKTTEYKSLLKHTSLPVVTGTNERTAAYIS--------TKNQVE 997
            G +  L SN+   E+D     Y S+L + +L    G  E   AY+           NQ+ 
Sbjct: 457  GKLLSLCSNLDQAESDKSNIAYGSILNNLTLQFFDGQVEAKVAYLDWLSLIYQKAPNQIL 516

Query: 998  EDKVTIRTILTKYETLKD--LCRKELKSLESLEKGVNDEKFASSLQSSLELIKRDISDLR 1055
            +   ++   L K  + +D  L  K L  L++L    ND+     LQ  L L+KRD   L+
Sbjct: 517  QHNDSLFLTLLKSLSHQDTRLIEKALDLLKNLCSDSNDDYLKKFLQDFLNLLKRDSKLLK 576

Query: 1056 INA 1058
              A
Sbjct: 577  TRA 579

>CAGL0J08206g 807382..813078 similar to sp|P41832 Saccharomyces
           cerevisiae YNL271c BNI1 regulator of budding, start by
           similarity
          Length = 1898

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 55/107 (51%), Gaps = 7/107 (6%)

Query: 714 IQRYYLLAPTDQWGRV----TADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKA 769
           IQR Y    TD+  R     +  +   LE+M A  D+++ EK+   +   +G+ ++  K 
Sbjct: 691 IQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLV-EKLSKAEHGLVGQLEMEVKE 749

Query: 770 G--VLAYLEKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQ 814
              +LA  +++     +EL  L +KH+  K+ + + L+ ML+I N +
Sbjct: 750 RDRILAKNQRVMKQLESELEELKKKHLLEKHEQEVELRKMLTILNSR 796

>Scas_418.2
          Length = 613

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 8/68 (11%)

Query: 1137 GLRKSSHSILKQTVQDLIGKISSMDAKKCVTFGLYWIISLHKL-----SSLPQEPAVLNK 1191
            GL    +SIL   ++ L+    S+   K + FG+  +++++K+     SSLP+EP  L  
Sbjct: 546  GLMFKPYSIL---LRSLLNNYFSIQTFKKLLFGIPIMVNINKMYFILYSSLPKEPVSLFT 602

Query: 1192 LQDKFYKT 1199
            L+++F+ T
Sbjct: 603  LKEQFFGT 610

>KLLA0A05544g 510371..513349 gi|417201|sp|Q03215|K6P1_KLULA
           Kluyveromyces lactis 6-phosphofructokinase alpha subunit
           (Phosphofructokinase 1) (Phosphohexokinase) (6PF-1-K
           alpha subunit), start by similarity
          Length = 992

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 43/74 (58%), Gaps = 2/74 (2%)

Query: 308 GGESTINGID-DSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKTRTDATL 366
           GG+ ++ G D    E+ + +E L   G  TE ++ +++ L  +  +G+I+   + TD+T+
Sbjct: 285 GGDGSLTGADLFRSEWPSLVEELVKDGKFTEDEVALYQNLTIVGMVGSIDNDMSGTDSTI 344

Query: 367 SSTDPSLQKACELL 380
            +   +L++ CE++
Sbjct: 345 GAY-SALERICEMV 357

>CAGL0M06083g complement(634963..637047) highly similar to sp|P32589
           Saccharomyces cerevisiae YPL106c SSE1 or sp|P32590
           Saccharomyces cerevisiae YBR169c SSE2, start by
           similarity
          Length = 694

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 52/116 (44%), Gaps = 5/116 (4%)

Query: 88  EPAVLHAIKERYNQRNIYTYSGIVLIATNPFDKVEELYSSEMIQAYARKNRDEMAPHIFA 147
           +P+ LH I+E Y+  +I     + L    P D V E+   + +    +K+  E+  H F 
Sbjct: 485 DPSGLHIIEEAYSLEDIVVKEEVPLPEDAPEDAVPEV---KEVTKTVKKDTLEITAHTFT 541

Query: 148 IAEEAYREMI--NNDQNQTIIVSGESGAGKTVSAKYIMRFFASVEEEHFNKEGDSK 201
           +A++    +I   ND      +  E+   K    +YI      ++EE+ +   D++
Sbjct: 542 LADDKLNTLIEKENDMTAQDRLVAETEDRKNNLEEYIYTLRGKLDEEYSDFASDAE 597

>AEL208W [2298] [Homologous to ScYGR240C (PFK1) - SH]
           complement(240780..243743) [2964 bp, 987 aa]
          Length = 987

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 42/74 (56%), Gaps = 2/74 (2%)

Query: 308 GGESTINGID-DSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKTRTDATL 366
           GG+ ++ G D    E+ + +E L + G  T  Q+  ++ L  +  +G+I+   + TD+T+
Sbjct: 310 GGDGSLTGADLFRSEWPSLVEELVSDGRFTAQQVHPYRNLTIVGLVGSIDNDMSGTDSTI 369

Query: 367 SSTDPSLQKACELL 380
            +   +L++ CE++
Sbjct: 370 GAYS-ALERICEMV 382

>YHR182W (YHR182W) [2467] chr8 (468217..470574) Protein of unknown
            function [2358 bp, 785 aa]
          Length = 785

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 55/133 (41%), Gaps = 27/133 (20%)

Query: 1049 RDISDLRINAIEKDNERTSTSSELKDGTDCTDNA----VVQILTKRQGDLINDLVNVV-- 1102
            RDI  +R++ +++D        E K G+  T+N                + NDLV ++  
Sbjct: 540  RDIDFVRVSNLKRD-----LLGEFK-GSKTTENTNSIITAHFFENSHSYVTNDLVGLIKL 593

Query: 1103 -FLEFQ---IP----------QRGRTKDCEHFYPVKLLISIVNLMNKFGLRKSSHSILKQ 1148
              LE     IP          ++  T  CE F P   L  +  L N F L  S +S+  Q
Sbjct: 594  WLLELPDSLIPSNHYDDLIKAEKSLTSLCEQF-PTSSLRFLQELANHFQLINSKYSLPPQ 652

Query: 1149 TVQDLIGKISSMD 1161
            T+QDL    S +D
Sbjct: 653  TIQDLFRDNSDID 665

>YNL049C (SFB2) [4539] chr14 complement(535279..537909) Protein with
            similarity to Sec24p, has a redundant role with Sec24p in
            transport vesicle formation from the endoplasmic
            reticulum [2631 bp, 876 aa]
          Length = 876

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 66/164 (40%), Gaps = 28/164 (17%)

Query: 1183 PQEPAVLNKLQDKFYKTWLKQCFNQMKTVDSILILFD-----TISEFTLFFQGTTELLTN 1237
            P+E + L   +D FYKT+  +C     TVD  L   D     T+S    F  G T     
Sbjct: 425  PKESSQLLSCKDSFYKTFTIECNKLQITVDMFLASEDYMDVATLSHLGRFSGGQTHFYPG 484

Query: 1238 IITALLQHINAKWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRNVNQ 1297
                     NA   ND  + + T   +  L  D  ++ V+    S  +R ++ +    N+
Sbjct: 485  --------FNATSLND--VTKFTRELSRHLSMDISMEAVMRVRCSTGLRATSFFGHFFNR 534

Query: 1298 ACKLL--------QLRISNIS-DFQLVCEFCYDLSSLQMHALLT 1332
            +  L         Q  +  IS +  L+ E+CY    LQ+  LLT
Sbjct: 535  SSDLCAFSTMPRDQSYLFGISIEDSLMAEYCY----LQVSTLLT 574

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 45,635,294
Number of extensions: 2059516
Number of successful extensions: 8539
Number of sequences better than 10.0: 142
Number of HSP's gapped: 8708
Number of HSP's successfully gapped: 179
Length of query: 1419
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1305
Effective length of database: 12,649,657
Effective search space: 16507802385
Effective search space used: 16507802385
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)