Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_590.71581588271e-115
YLR008C (PAM18)1681685644e-75
CAGL0J00935g1531405182e-68
KLLA0E09438g1631585081e-66
ADR345C1581545029e-66
Sklu_1938.41641594976e-65
Kwal_33.152981711684933e-64
CAGL0D02552g143861909e-19
AGR393W142701846e-18
YNL328C (MDJ2)146661831e-17
Scas_716.46144811812e-17
Sklu_2034.5142651812e-17
KLLA0E02024g146701672e-15
Kwal_55.22136145731672e-15
YJL104W (PAM16)149102820.003
KLLA0C02981g16269660.52
CAGL0G02783g49081604.2
Scas_681.6120444604.7
Kwal_14.91582294605.7
KLLA0F09790g17542587.0
YDR125C (ECM18)45339588.7
YNL064C (YDJ1)40930588.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_590.7
         (158 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_590.7                                                            323   e-115
YLR008C (PAM18) [3426] chr12 complement(165576..166082) Protein ...   221   4e-75
CAGL0J00935g complement(95878..96339) highly similar to tr|Q0791...   204   2e-68
KLLA0E09438g 838259..838750 similar to sgd|S0003998 Saccharomyce...   200   1e-66
ADR345C [2086] [Homologous to ScYLR008C - SH] (1315746..1316222)...   197   9e-66
Sklu_1938.4 YLR008C, Contig c1938 6198-6692 reverse complement        196   6e-65
Kwal_33.15298                                                         194   3e-64
CAGL0D02552g 261991..262422 similar to sp|P42834 Saccharomyces c...    78   9e-19
AGR393W [4704] [Homologous to ScYNL328C (MDJ2) - SH] complement(...    75   6e-18
YNL328C (MDJ2) [4287] chr14 complement(22834..23274) Protein inv...    75   1e-17
Scas_716.46                                                            74   2e-17
Sklu_2034.5 YNL328C, Contig c2034 7065-7493 reverse complement         74   2e-17
KLLA0E02024g complement(191062..191502) similar to sp|P42834 Sac...    69   2e-15
Kwal_55.22136                                                          69   2e-15
YJL104W (PAM16) [2811] chr10 (227244..227693) Mitochondrial prot...    36   0.003
KLLA0C02981g 268669..269157 similar to sp|P47138 Saccharomyces c...    30   0.52 
CAGL0G02783g 256580..258052 similar to sp|P40486 Saccharomyces c...    28   4.2  
Scas_681.6                                                             28   4.7  
Kwal_14.915                                                            28   5.7  
KLLA0F09790g complement(901211..901738) no similarity, hypotheti...    27   7.0  
YDR125C (ECM18) [972] chr4 complement(701391..702752) Protein po...    27   8.7  
YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein i...    27   8.8  

>Scas_590.7
          Length = 158

 Score =  323 bits (827), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 158/158 (100%), Positives = 158/158 (100%)

Query: 1   MNDSNNNTNTLEVPQLAIPGEASGSPTMTISQPTSTKNGMDLYFDEAMQYMGRHPVMTGV 60
           MNDSNNNTNTLEVPQLAIPGEASGSPTMTISQPTSTKNGMDLYFDEAMQYMGRHPVMTGV
Sbjct: 1   MNDSNNNTNTLEVPQLAIPGEASGSPTMTISQPTSTKNGMDLYFDEAMQYMGRHPVMTGV 60

Query: 61  AAFLTLYAAAGTYKSISTKLNGGKATATFLKGGFDAKMNQKEALQILNLTENKLNMKKLK 120
           AAFLTLYAAAGTYKSISTKLNGGKATATFLKGGFDAKMNQKEALQILNLTENKLNMKKLK
Sbjct: 61  AAFLTLYAAAGTYKSISTKLNGGKATATFLKGGFDAKMNQKEALQILNLTENKLNMKKLK 120

Query: 121 EVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKSVKK 158
           EVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKSVKK
Sbjct: 121 EVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKSVKK 158

>YLR008C (PAM18) [3426] chr12 complement(165576..166082) Protein
           containing a DnaJ domain, which are part of chaperone
           (protein folding) system that mediates interaction with
           heat shock proteins, has high similarity to C. albicans
           Orf6.3647p [507 bp, 168 aa]
          Length = 168

 Score =  221 bits (564), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 109/168 (64%), Positives = 125/168 (74%), Gaps = 10/168 (5%)

Query: 1   MNDSNNNTNTLEVPQLAIPGEASGSPTMTI----------SQPTSTKNGMDLYFDEAMQY 50
           M+  +N  N++E PQL IPG+ +GS  +T+          +     K GMDLYFD+A+ Y
Sbjct: 1   MSSQSNTGNSIEAPQLPIPGQTNGSANVTVDGAGVNVGIQNGSQGQKTGMDLYFDQALNY 60

Query: 51  MGRHPVMTGVAAFLTLYAAAGTYKSISTKLNGGKATATFLKGGFDAKMNQKEALQILNLT 110
           MG HPV+TG  AFLTLY  AG YKSIS  LNGGK+T  FLKGGFD KMN KEALQILNLT
Sbjct: 61  MGEHPVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQILNLT 120

Query: 111 ENKLNMKKLKEVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKSVKK 158
           EN L  KKLKEVHRKIMLANHPDKGGSP+LATKINEAKDFLEK+ + K
Sbjct: 121 ENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK 168

>CAGL0J00935g complement(95878..96339) highly similar to tr|Q07914
           Saccharomyces cerevisiae YLR008c, start by similarity
          Length = 153

 Score =  204 bits (518), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 96/140 (68%), Positives = 107/140 (76%)

Query: 17  AIPGEASGSPTMTISQPTSTKNGMDLYFDEAMQYMGRHPVMTGVAAFLTLYAAAGTYKSI 76
           ++ G+A+       +Q   +K GMDLYFD A+QYMG HPV+ GV  FL LY  AG YK +
Sbjct: 11  SVTGDAAAGFPAGATQAPGSKQGMDLYFDNALQYMGEHPVLAGVGGFLALYVGAGVYKGV 70

Query: 77  STKLNGGKATATFLKGGFDAKMNQKEALQILNLTENKLNMKKLKEVHRKIMLANHPDKGG 136
            T+LNGGKA   FLKGGFD KMN KEALQILNL EN L  KKLKEVHRKIMLANHPDKGG
Sbjct: 71  QTRLNGGKAATQFLKGGFDPKMNAKEALQILNLKENNLTTKKLKEVHRKIMLANHPDKGG 130

Query: 137 SPYLATKINEAKDFLEKKSV 156
           SPYLATKINEAKDFLEKK +
Sbjct: 131 SPYLATKINEAKDFLEKKGI 150

>KLLA0E09438g 838259..838750 similar to sgd|S0003998 Saccharomyces
           cerevisiae YLR008c, start by similarity
          Length = 163

 Score =  200 bits (508), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 99/158 (62%), Positives = 112/158 (70%), Gaps = 10/158 (6%)

Query: 11  LEVPQLAIPGEAS----------GSPTMTISQPTSTKNGMDLYFDEAMQYMGRHPVMTGV 60
           +EVPQL IPGE +          G P   +      K+GMDLYFD+A+ YMG HPV+TGV
Sbjct: 6   IEVPQLPIPGEDNSNRVPEQVVIGHPAAGVPPIPQQKSGMDLYFDQALDYMGDHPVLTGV 65

Query: 61  AAFLTLYAAAGTYKSISTKLNGGKATATFLKGGFDAKMNQKEALQILNLTENKLNMKKLK 120
             F  LY AAG YKS+S +L G      +LKGGFD KMN KEAL ILNL E  L+ KKLK
Sbjct: 66  GGFFALYFAAGAYKSVSKRLGGSSQGVKYLKGGFDPKMNAKEALAILNLNETNLSKKKLK 125

Query: 121 EVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKSVKK 158
           EVHR+IMLANHPDKGGSPYLATKINEAKDFLEKK V+K
Sbjct: 126 EVHRRIMLANHPDKGGSPYLATKINEAKDFLEKKVVRK 163

>ADR345C [2086] [Homologous to ScYLR008C - SH] (1315746..1316222)
           [477 bp, 158 aa]
          Length = 158

 Score =  197 bits (502), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 116/154 (75%), Gaps = 5/154 (3%)

Query: 10  TLEVPQLAIPGEA-SGSPTMTISQPTST----KNGMDLYFDEAMQYMGRHPVMTGVAAFL 64
           T+E+PQL IPGE  S  P   I    +     K GMDLYFD+ + ++G HPV+ G+  F+
Sbjct: 5   TIEIPQLPIPGEDNSAHPAQQIRLEQAAVPQQKRGMDLYFDKVVDFVGEHPVVGGIGGFV 64

Query: 65  TLYAAAGTYKSISTKLNGGKATATFLKGGFDAKMNQKEALQILNLTENKLNMKKLKEVHR 124
            LYAAAG ++++S ++NGGK    FLKGGFD KMN KEAL ILNLTE+ L  K++K+VHR
Sbjct: 65  ALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLTESTLTKKRVKDVHR 124

Query: 125 KIMLANHPDKGGSPYLATKINEAKDFLEKKSVKK 158
           KIMLANHPDKGGSPYLATKINEAKDFLEK+ ++K
Sbjct: 125 KIMLANHPDKGGSPYLATKINEAKDFLEKRGIRK 158

>Sklu_1938.4 YLR008C, Contig c1938 6198-6692 reverse complement
          Length = 164

 Score =  196 bits (497), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 114/159 (71%), Gaps = 12/159 (7%)

Query: 11  LEVPQLAIPGE-----------ASGSPTMTISQPTSTKNGMDLYFDEAMQYMGRHPVMTG 59
            +VPQL IPG            ++ +P  T   P S  +GMDLYFD+A+  MG+HPV+TG
Sbjct: 7   FDVPQLPIPGADNSRLQEPVALSNATPITTNPAP-SQPSGMDLYFDQALDVMGQHPVLTG 65

Query: 60  VAAFLTLYAAAGTYKSISTKLNGGKATATFLKGGFDAKMNQKEALQILNLTENKLNMKKL 119
           +  F TLY  AG Y+S+STKL G    A FLKGGFD KMN  EALQILNL E+ L  KKL
Sbjct: 66  IGGFFTLYFLAGAYRSVSTKLGGNTGAAKFLKGGFDPKMNAGEALQILNLNESTLTKKKL 125

Query: 120 KEVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKSVKK 158
           KEVHR+IMLANHPDKGGSPYLATKINEAKDFLEK+ ++K
Sbjct: 126 KEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGIRK 164

>Kwal_33.15298
          Length = 171

 Score =  194 bits (493), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 97/168 (57%), Positives = 116/168 (69%), Gaps = 20/168 (11%)

Query: 11  LEVPQLAIPGEA-------SGSPTMT-------------ISQPTSTKNGMDLYFDEAMQY 50
           +E PQL IPG+A       S  P  +             I+  ++ K GMD  FD+A+ +
Sbjct: 4   IEAPQLPIPGQAGVDTNTSSQEPVWSGAGGAEGAEMVGKIANASNEKGGMDQAFDDALAF 63

Query: 51  MGRHPVMTGVAAFLTLYAAAGTYKSISTKLNGGKATATFLKGGFDAKMNQKEALQILNLT 110
           MG+HPV++G   FL LY AAG +KS+S  L GG AT  + KGGFD KMN KEA+QILNL 
Sbjct: 64  MGQHPVLSGFGGFLGLYFAAGAFKSVSRALGGGAATTQYAKGGFDPKMNVKEAMQILNLN 123

Query: 111 ENKLNMKKLKEVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKSVKK 158
           EN LN KKLKEVHR+IMLANHPDKGGSPYLATKINEAKDFLEK+ V+K
Sbjct: 124 ENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGVRK 171

>CAGL0D02552g 261991..262422 similar to sp|P42834 Saccharomyces
           cerevisiae YNL328c MDJ2 heat shock protein - chaperone,
           start by similarity
          Length = 143

 Score = 77.8 bits (190), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 56/86 (65%), Gaps = 4/86 (4%)

Query: 77  STKLNGG-KATATFLKGGFDAKMNQKEALQILNLTENK---LNMKKLKEVHRKIMLANHP 132
           S +LN G K      +GGF   M++ EAL ILN+T+ +   LN   LK+ HR  ML NHP
Sbjct: 57  SDRLNPGLKMQLNKWEGGFYHPMSESEALMILNITQKEIMSLNAPLLKKKHRLAMLKNHP 116

Query: 133 DKGGSPYLATKINEAKDFLEKKSVKK 158
           DKGGSPYL+ KINEAK+ LEK  + +
Sbjct: 117 DKGGSPYLSAKINEAKELLEKSVLTR 142

>AGR393W [4704] [Homologous to ScYNL328C (MDJ2) - SH]
           complement(1451330..1451758) [429 bp, 142 aa]
          Length = 142

 Score = 75.5 bits (184), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 51/70 (72%), Gaps = 3/70 (4%)

Query: 92  GGFDAKMNQKEALQILNLTENK---LNMKKLKEVHRKIMLANHPDKGGSPYLATKINEAK 148
           GGF  +MN+ EA+ IL +T ++   L+   LK+ HR+ ML NHPDKGGSPY+A KINEA+
Sbjct: 73  GGFYKRMNEVEAMLILQITGDEIKLLDRNMLKKKHRRAMLLNHPDKGGSPYVAMKINEAR 132

Query: 149 DFLEKKSVKK 158
           D +E+ S+ +
Sbjct: 133 DVMEQSSLVR 142

>YNL328C (MDJ2) [4287] chr14 complement(22834..23274) Protein
           involved in import and folding of mitochondrial
           proteins, has similarity to E. coli DnaJ and other
           DnaJ-like proteins, function partially overlaps that of
           Mdj1p [441 bp, 146 aa]
          Length = 146

 Score = 75.1 bits (183), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 49/66 (74%), Gaps = 3/66 (4%)

Query: 91  KGGFDAKMNQKEALQILNLTE---NKLNMKKLKEVHRKIMLANHPDKGGSPYLATKINEA 147
           +GGF  +M + EAL IL+++    N L+ K LK+ HRK M+ NHPD+GGSPY+A KINEA
Sbjct: 74  QGGFAPRMTEPEALLILDISAREINHLDEKLLKKKHRKAMVRNHPDRGGSPYMAAKINEA 133

Query: 148 KDFLEK 153
           K+ LE+
Sbjct: 134 KEVLER 139

>Scas_716.46
          Length = 144

 Score = 74.3 bits (181), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/81 (51%), Positives = 53/81 (65%), Gaps = 4/81 (4%)

Query: 77  STKL-NGGKATATFLKGGFDAKMNQKEALQILNLTEN---KLNMKKLKEVHRKIMLANHP 132
           STKL N  K      +GGF   M + EA+ IL+++     KL+ K LK  HR  M+ NHP
Sbjct: 57  STKLSNELKTKLDQFQGGFYPTMTESEAILILDISSKDIKKLDEKLLKRKHRGAMILNHP 116

Query: 133 DKGGSPYLATKINEAKDFLEK 153
           DKGGSPYLATKINEA++ LE+
Sbjct: 117 DKGGSPYLATKINEAREVLER 137

>Sklu_2034.5 YNL328C, Contig c2034 7065-7493 reverse complement
          Length = 142

 Score = 74.3 bits (181), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 46/65 (70%), Gaps = 3/65 (4%)

Query: 92  GGFDAKMNQKEALQILNLTENK---LNMKKLKEVHRKIMLANHPDKGGSPYLATKINEAK 148
           GGF ++M + EAL IL ++  +   LN   LK  HR+ ML NHPDKGGSPYLA KINEA+
Sbjct: 70  GGFYSRMTETEALLILGISSEEIEHLNATMLKRKHRRAMLQNHPDKGGSPYLAMKINEAR 129

Query: 149 DFLEK 153
           + LE+
Sbjct: 130 ETLER 134

>KLLA0E02024g complement(191062..191502) similar to sp|P42834
           Saccharomyces cerevisiae YNL328c MDJ2 heat shock protein
           - chaperone singleton, start by similarity
          Length = 146

 Score = 68.9 bits (167), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 49/70 (70%), Gaps = 3/70 (4%)

Query: 92  GGFDAKMNQKEALQILNLTENK---LNMKKLKEVHRKIMLANHPDKGGSPYLATKINEAK 148
           GGF  KM++ EAL IL ++  +   L+ + L++ HR+ M+ NHPDKGGSP++A+KIN+A+
Sbjct: 73  GGFYDKMSETEALLILGISAREIEALDERLLRQKHRRAMIMNHPDKGGSPFIASKINQAR 132

Query: 149 DFLEKKSVKK 158
           D L    + K
Sbjct: 133 DLLANSVILK 142

>Kwal_55.22136
          Length = 145

 Score = 68.9 bits (167), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 3/73 (4%)

Query: 82  GGKATATFLKGGFDAKMNQKEALQILNLTENK---LNMKKLKEVHRKIMLANHPDKGGSP 138
           G KA      GGF +KM   EAL IL ++ ++   L+   LK  HR+ ++ NHPD+GGSP
Sbjct: 65  GLKARLNQYGGGFSSKMTDSEALLILGISGSEVAALDENLLKRKHRQAIVHNHPDRGGSP 124

Query: 139 YLATKINEAKDFL 151
           YLA KINEA+D L
Sbjct: 125 YLALKINEARDIL 137

>YJL104W (PAM16) [2811] chr10 (227244..227693) Mitochondrial protein
           with a role in respiration [450 bp, 149 aa]
          Length = 149

 Score = 36.2 bits (82), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 7/102 (6%)

Query: 56  VMTGVAAFLTLYAAAGTYKSISTKLNGGKATATFLKG---GFDAKMNQKEALQILNLTEN 112
           ++TG   F   +A A  Y+  +++     AT    +G   G    +   E+ +ILN+ E+
Sbjct: 10  IITGTQVFGKAFAEA--YRQAASQSVKQGATNASRRGTGKGEYGGITLDESCKILNIEES 67

Query: 113 K--LNMKKLKEVHRKIMLANHPDKGGSPYLATKINEAKDFLE 152
           K  LNM K+      +   N  +KGGS YL +K+  A + L+
Sbjct: 68  KGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLK 109

>KLLA0C02981g 268669..269157 similar to sp|P47138 Saccharomyces
           cerevisiae YJR097w singleton, start by similarity
          Length = 162

 Score = 30.0 bits (66), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 11/69 (15%)

Query: 100 QKEALQILNLTENKLNMKKLKEVHRKIMLANHPDKGG----------SPYLATKINEAKD 149
           Q+   +IL +  +  N++ +K  +R ++L  HPDK G          S +  T I EA  
Sbjct: 2   QRSFYEILGIESDASNIE-IKRAYRAMLLETHPDKSGLNYNSNGNNTSSHSVTDIQEAYQ 60

Query: 150 FLEKKSVKK 158
            L  + ++K
Sbjct: 61  TLIDQDLRK 69

>CAGL0G02783g 256580..258052 similar to sp|P40486 Saccharomyces
           cerevisiae YIL104c, start by similarity
          Length = 490

 Score = 27.7 bits (60), Expect = 4.2,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 35/81 (43%), Gaps = 9/81 (11%)

Query: 86  TATFLKGGFDAKMNQKEALQI--------LNLTENKLNMKKLKEVHRKIMLANHPDKGGS 137
           T +  K GFDA+ N    + I        LN  EN     ++KE   K  L   PD   S
Sbjct: 159 TLSLNKYGFDAQYNGLIGVSIPNGNDINELNDPENTTENDRIKERLSKENLKFDPDYYVS 218

Query: 138 PYLATKINEAKDFLEKKSVKK 158
            Y+ +K    +D LE   +KK
Sbjct: 219 EYMVSKYGSEED-LEVNGIKK 238

>Scas_681.6
          Length = 1204

 Score = 27.7 bits (60), Expect = 4.7,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 21/44 (47%)

Query: 71  GTYKSISTKLNGGKATATFLKGGFDAKMNQKEALQILNLTENKL 114
           GT     TKL     +   + G FD K      L ++NLT+NKL
Sbjct: 929 GTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNLALMNLTDNKL 972

>Kwal_14.915
          Length = 822

 Score = 27.7 bits (60), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 37/94 (39%), Gaps = 7/94 (7%)

Query: 50  YMGRHPVMTGVAAFLTLYAAAGTYKSISTKLNGGKATATFLK--GGFDAKMNQKEALQIL 107
           YM R  + T     +   AA G Y   S  L+    T T ++  G   A + + + L+++
Sbjct: 621 YMDREYLFTSACTLVLFNAAFGIYDQTSEHLDHALLTFTKMRNLGNNPAGLRRAQLLKLM 680

Query: 108 NLTE-----NKLNMKKLKEVHRKIMLANHPDKGG 136
              +     N+L  K L  +       NH DK  
Sbjct: 681 RSLDFKGCMNELIQKHLDNLKPDAQFDNHSDKAA 714

>KLLA0F09790g complement(901211..901738) no similarity, hypothetical
           start
          Length = 175

 Score = 26.9 bits (58), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 21/42 (50%), Gaps = 4/42 (9%)

Query: 54  HPVMTGVAAFLTLYAAAGTYKSISTKLNGGKATATFLKGGFD 95
           H +   V AF TL  AA    SI+T LNG      FLKG  D
Sbjct: 106 HELQNPVVAFNTLLGAA----SITTLLNGYANKRRFLKGKSD 143

>YDR125C (ECM18) [972] chr4 complement(701391..702752) Protein
           possibly involved in cell wall structure or biosynthesis
           [1362 bp, 453 aa]
          Length = 453

 Score = 26.9 bits (58), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%)

Query: 5   NNNTNTLEVPQLAIPGEASGSPTMTISQPTSTKNGMDLY 43
           N NT+T+  P L I G A+ S +   + P  +K+  +LY
Sbjct: 119 NENTSTVRTPTLLIHGYAASSMSFFRNYPGLSKHIRNLY 157

>YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein
           involved in protein import into mitochondria and ER,
           homolog of E. coli DnaJ [1230 bp, 409 aa]
          Length = 409

 Score = 26.9 bits (58), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 118 KLKEVHRKIMLANHPDKGGSPYLATKINEA 147
           ++K+ +RK  L  HPDK  S   A K  EA
Sbjct: 21  EIKKAYRKCALKYHPDKNPSEEAAEKFKEA 50

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.127    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,176,499
Number of extensions: 204777
Number of successful extensions: 679
Number of sequences better than 10.0: 41
Number of HSP's gapped: 667
Number of HSP's successfully gapped: 41
Length of query: 158
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 65
Effective length of database: 13,376,635
Effective search space: 869481275
Effective search space used: 869481275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 57 (26.6 bits)