Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_588.1442342321380.0
YDR300C (PRO1)42842117940.0
KLLA0C10296g41842116470.0
Kwal_47.1818742142416260.0
CAGL0H01441g42742016130.0
AAL061C42041714930.0
YHR033W42342614710.0
CAGL0D03894g48547114280.0
Scas_690.3642442913810.0
YER052C (HOM3)52740710.98
KLLA0F27599g52253691.7
AGR120C154778691.9
Scas_715.4452853692.0
ADR106W79837673.4
AER213C55752664.4
CAGL0J02882g53040647.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_588.14
         (423 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_588.14                                                           828   0.0  
YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamat...   695   0.0  
KLLA0C10296g 883644..884900 highly similar to sp|P32264 Saccharo...   639   0.0  
Kwal_47.18187                                                         630   0.0  
CAGL0H01441g complement(140740..142023) highly similar to sp|P32...   625   0.0  
AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - ...   579   0.0  
YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with simi...   571   0.0  
CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces c...   554   0.0  
Scas_690.36                                                           536   0.0  
YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate ...    32   0.98 
KLLA0F27599g 2558178..2559746 highly similar to sp|P10869 Saccha...    31   1.7  
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    31   1.9  
Scas_715.44                                                            31   2.0  
ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH] complement...    30   3.4  
AER213C [2715] [Homologous to ScYDL013W (HEX3) - SH] (1028170..1...    30   4.4  
CAGL0J02882g complement(277395..278987) highly similar to sp|P10...    29   7.5  

>Scas_588.14
          Length = 423

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/423 (96%), Positives = 407/423 (96%)

Query: 1   MTMSKCYTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGL 60
           MTMSKCYTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGL
Sbjct: 1   MTMSKCYTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGL 60

Query: 61  RTLNLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNA 120
           RTLNLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNA
Sbjct: 61  RTLNLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNA 120

Query: 121 QNTINELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTD 180
           QNTINELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTD
Sbjct: 121 QNTINELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTD 180

Query: 181 NPRTNPEAKPILVVPDLAKGLPXXXXXXXXXXXXXXXXMETKLIAADLATNAGVHTIIMK 240
           NPRTNPEAKPILVVPDLAKGLP                METKLIAADLATNAGVHTIIMK
Sbjct: 181 NPRTNPEAKPILVVPDLAKGLPGVNTSSGSGSDVGTGGMETKLIAADLATNAGVHTIIMK 240

Query: 241 SDIPGNILKIVEYMQAQDLDTNKKQKYQGDLSSLQDKELATLQSLHVPLHTTFIANDNLH 300
           SDIPGNILKIVEYMQAQDLDTNKKQKYQGDLSSLQDKELATLQSLHVPLHTTFIANDNLH
Sbjct: 241 SDIPGNILKIVEYMQAQDLDTNKKQKYQGDLSSLQDKELATLQSLHVPLHTTFIANDNLH 300

Query: 301 HLKNREFWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDLKLG 360
           HLKNREFWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDLKLG
Sbjct: 301 HLKNREFWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDLKLG 360

Query: 361 KRLPNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHRENLAF 420
           KRLPNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHRENLAF
Sbjct: 361 KRLPNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHRENLAF 420

Query: 421 PPH 423
           PPH
Sbjct: 421 PPH 423

>YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamate
           5-kinase, carries out first step in proline biosynthesis
           pathway [1287 bp, 428 aa]
          Length = 428

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/421 (79%), Positives = 373/421 (88%), Gaps = 2/421 (0%)

Query: 4   SKCYTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRTL 63
           SK YT+VIKLGSSSLVDEKTKEPKLAIMSL+VETVVKLRR+GHKVIIVSSGGIAVGLRT+
Sbjct: 7   SKSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTM 66

Query: 64  NLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQNT 123
            ++KRPKHLAEVQAIAA+GQGRLIGRWDLLFSQF QRIAQIL+TRNDI+DWTQYKNAQNT
Sbjct: 67  RMNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNT 126

Query: 124 INELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNPR 183
           INELL MGV+PIVNENDTLS+ EIKFGDNDTLSAITSAL+ ADYLFLLTDVDCLYTDNPR
Sbjct: 127 INELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPR 186

Query: 184 TNPEAKPILVVPDLAKGLPXXXXXXXXXXXXXXXXMETKLIAADLATNAGVHTIIMKSDI 243
           TNP+A PILVVPDL+KGLP                METKL+AADLATNAGVHT+IMKSD 
Sbjct: 187 TNPDAMPILVVPDLSKGLPGVNTAGGSGSDVGTGGMETKLVAADLATNAGVHTLIMKSDT 246

Query: 244 PGNILKIVEYMQAQDL-DTNK-KQKYQGDLSSLQDKELATLQSLHVPLHTTFIANDNLHH 301
           P NI +IVEYMQ  +L D NK KQ Y GDL+ LQ +E   L++L+VPLHT FIANDN HH
Sbjct: 247 PANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIANDNKHH 306

Query: 302 LKNREFWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDLKLGK 361
           LKNREFWILHGLV++G+V+IDQGAY ALTRKNKAGLLP G+ID++GTFHELECVD+K+GK
Sbjct: 307 LKNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECVDIKVGK 366

Query: 362 RLPNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHRENLAFP 421
           +LP+G LDP+ PLQTVG+ARCNYTS EL++IKGL S+QIEEELGY DSEY AHRENLAFP
Sbjct: 367 KLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHRENLAFP 426

Query: 422 P 422
           P
Sbjct: 427 P 427

>KLLA0C10296g 883644..884900 highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, start by similarity
          Length = 418

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/421 (74%), Positives = 357/421 (84%), Gaps = 3/421 (0%)

Query: 3   MSKCYTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRT 62
           M K + +VIKLGSSSLVDE+TKEPKL+IMSL+VETVVKLRR GHKVIIVSSGGIAVGL+T
Sbjct: 1   MVKQFVIVIKLGSSSLVDEETKEPKLSIMSLIVETVVKLRRRGHKVIIVSSGGIAVGLKT 60

Query: 63  LNLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQN 122
           +N+  RPK L++VQAIAAVGQGRLIGRWD LFS+F QRIAQILITRNDIVDWTQYKNAQN
Sbjct: 61  MNMKGRPKKLSKVQAIAAVGQGRLIGRWDSLFSEFDQRIAQILITRNDIVDWTQYKNAQN 120

Query: 123 TINELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNP 182
           TI+ELL MGVVPIVNENDTLS+SEIKFGDNDTLSAIT+AL GADYLFLLTDVDCLYTDNP
Sbjct: 121 TISELLSMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALTGADYLFLLTDVDCLYTDNP 180

Query: 183 RTNPEAKPILVVPDLAKGLPXXXXXXXXXXXXXXXXMETKLIAADLATNAGVHTIIMKSD 242
           R NP+AKPILVVPD+++GLP                M+TKLIAA+LATNAGVHTIIMKSD
Sbjct: 181 RANPDAKPILVVPDISQGLPGVNTDGGSGSDVGTGGMKTKLIAAELATNAGVHTIIMKSD 240

Query: 243 IPGNILKIVEYMQAQDLDTNKKQKYQGDLSSLQDKELATLQSLHVPLHTTFIANDNLHHL 302
            P NI KIV YMQ +D   N+  +   DL+ LQ  E+ +L + HVPLHT FIAN N HHL
Sbjct: 241 TPENISKIVLYMQERDDGVNELTQ---DLADLQLTEMQSLVNNHVPLHTRFIANSNHHHL 297

Query: 303 KNREFWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDLKLGKR 362
           KNR+FW+LHGLV++G+VIID GAY ALTRKNKAGLLP G+I+++G+FHE EC+D+KLG R
Sbjct: 298 KNRQFWMLHGLVSQGAVIIDIGAYEALTRKNKAGLLPAGVIEVQGSFHEHECIDIKLGVR 357

Query: 363 LPNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHRENLAFPP 422
             +G LD +  L+TVGRARCNYTS ELS+IKGLQS+QIE+ LGYADSEY AHRENLAFPP
Sbjct: 358 DSDGNLDKSVALKTVGRARCNYTSTELSKIKGLQSDQIEDILGYADSEYVAHRENLAFPP 417

Query: 423 H 423
           H
Sbjct: 418 H 418

>Kwal_47.18187
          Length = 421

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/424 (71%), Positives = 352/424 (83%), Gaps = 6/424 (1%)

Query: 3   MSKCYTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRT 62
           MSK YT+VIKLGSSSLVDEKTKEPKLA M+++VETVV+LRR+GH+V++VSSGGIAVGL+T
Sbjct: 1   MSKTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKT 60

Query: 63  LNLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQN 122
           LNLDKRPKHLA+VQAIAAVGQGRLIGRWD LFSQF QRIAQILITRNDIVDWTQYKNAQN
Sbjct: 61  LNLDKRPKHLAQVQAIAAVGQGRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQN 120

Query: 123 TINELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNP 182
           TI+ELL+MGVVPIVNENDTLS+SEIKFGDNDTLSAIT+AL GADYLFLLTDVDCLYTDNP
Sbjct: 121 TIHELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNP 180

Query: 183 RTNPEAKPILVVP---DLAKGLPXXXXXXXXXXXXXXXXMETKLIAADLATNAGVHTIIM 239
           RTNP AKPILVVP    +++G                  M TKLIAA+LATNAGV+TIIM
Sbjct: 181 RTNPNAKPILVVPATSQMSEGTLGVKTSSGSGSDVGTGGMTTKLIAAELATNAGVNTIIM 240

Query: 240 KSDIPGNILKIVEYMQAQDLDTNKKQKYQGDLSSLQDKELATLQSLHVPLHTTFIANDNL 299
           KS  P NI K+V YMQ  +  T        ++  LQ++E+  LQ   VPLHT F+A+++ 
Sbjct: 241 KSAEPSNISKVVSYMQNCESITGAAAD---NVEHLQEQEMLRLQENCVPLHTRFVADESQ 297

Query: 300 HHLKNREFWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDLKL 359
            HL NREFW+LHGLV++G+++IDQGAY ALTRKNKAGLLP G+I++EG FHE EC+DLK+
Sbjct: 298 MHLSNREFWMLHGLVSKGAIVIDQGAYAALTRKNKAGLLPAGLIEVEGNFHEHECIDLKV 357

Query: 360 GKRLPNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHRENLA 419
           G RL  GELDP  P+ T+GRARCNYTS+EL +IKGLQS+QIE  LGYADSEY AHR NLA
Sbjct: 358 GSRLATGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHRGNLA 417

Query: 420 FPPH 423
           FPPH
Sbjct: 418 FPPH 421

>CAGL0H01441g complement(140740..142023) highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, hypothetical start
          Length = 427

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/420 (70%), Positives = 353/420 (84%), Gaps = 2/420 (0%)

Query: 5   KCYTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRTLN 64
           K +T+VIKLG+SSLVDEKTKEP+LAIMSL+VETVVKLRRLGH V+IVSSG I VGL  L 
Sbjct: 9   KPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNVVIVSSGSIGVGLHILG 68

Query: 65  LDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQNTI 124
           ++KRPKHL+EVQAIAA+GQ +LIGRWD LF+ FGQ IAQIL+TRNDI+DW+QY+NAQNT+
Sbjct: 69  MEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTV 128

Query: 125 NELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNPRT 184
            ELLKMGVVPI+NENDTLS+ EIKFGDNDTLSAIT+ L+ ADYLFLLTDVDCLYT +PR+
Sbjct: 129 EELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRS 188

Query: 185 NPEAKPILVVPDLAKGLPXXXXXXXXXXXXXXXXMETKLIAADLATNAGVHTIIMKSDIP 244
           +P+AKPIL+VPDL+KGLP                M+TKL+AA+LATNAGVHTIIMKSD P
Sbjct: 189 DPDAKPILIVPDLSKGLPGVDTSSGSGSDVGTGGMQTKLVAAELATNAGVHTIIMKSDAP 248

Query: 245 GNILKIVEYMQAQDLDTNKKQK-YQGDLSSLQDKELATLQSLHVPLHTTFIANDNLHHLK 303
            NI KIV+Y+Q+   DT +  K ++GDL  LQ +E   L  + VP HT F+AN    HL+
Sbjct: 249 SNIYKIVKYIQSLH-DTGEDNKVFEGDLMKLQLEEYEKLDRMGVPFHTKFLANSISRHLR 307

Query: 304 NREFWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDLKLGKRL 363
           N+EFWILHGLVT G+VIID+GAY ALTRKNKAGLLPVG+I+IEG+FHE+ECVDLK+GKRL
Sbjct: 308 NKEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVDLKVGKRL 367

Query: 364 PNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHRENLAFPPH 423
           PNGELDP+ PL  VGRARCNY SLE+S+IKG QS++IE ELGY +SEY AHREN+AFPPH
Sbjct: 368 PNGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRENMAFPPH 427

>AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - SH]
           (239518..240780) [1263 bp, 420 aa]
          Length = 420

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/417 (68%), Positives = 335/417 (80%), Gaps = 4/417 (0%)

Query: 7   YTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRTLNLD 66
           +T+V+KLGSSSLVDE T EPKL+IMS +VETVVKLRR+GHKV+IVSSG IAVGL+T+  D
Sbjct: 8   FTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVGTD 67

Query: 67  KRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQNTINE 126
           +RPK L+++QAIAAVGQGRLI RWD LF  F ++IAQIL+TRNDIVDW+QYKNAQNT +E
Sbjct: 68  RRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTFHE 127

Query: 127 LLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNPRTNP 186
           LL MGV PIVNENDTLSIS +KFGDNDTLSAIT+ L+GADYLFL+TDVDCLYTDNPRTNP
Sbjct: 128 LLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNP 187

Query: 187 EAKPILVVPDLAKGLPXXXXXXXXXXXXXXXXMETKLIAADLATNAGVHTIIMKSDIPGN 246
           +AKPILVVPDL++GLP                M TK++AADLATNAGVHTIIMKS+ P +
Sbjct: 188 DAKPILVVPDLSQGLPGVNTSSGSGSGVGTGGMATKILAADLATNAGVHTIIMKSERPVD 247

Query: 247 ILKIVEYMQAQDLDTNKKQKYQGDLSSLQDKELATLQSLHVPLHTTFIANDNLHHLKNRE 306
           +++IVE+M+ ++  T        D  +LQ  EL  LQ   VPLHT FIAN     L  RE
Sbjct: 248 MVRIVEFMEWREQCT----AVSADAETLQTDELNLLQEHGVPLHTRFIANVWQPSLNKRE 303

Query: 307 FWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDLKLGKRLPNG 366
           FWILHGLV+ G+VIID+GAY ALTRKNKAGLLP G+I +EG+FHELE VDLK+G R  +G
Sbjct: 304 FWILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVIAVEGSFHELEAVDLKIGVRKADG 363

Query: 367 ELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHRENLAFPPH 423
            LD + PLQTVGRARCNY+S+E+ +IKGLQS QIE  LGY DSEY AHRENLAFPP 
Sbjct: 364 SLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHRENLAFPPR 420

>YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with
           similarity to Pro1p [1272 bp, 423 aa]
          Length = 423

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/426 (64%), Positives = 340/426 (79%), Gaps = 9/426 (2%)

Query: 3   MSKCYTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRT 62
           M+K YT+VIKLGSSSLVDE TKEPKL+IM+L+VETV  L+R+GHKVIIVSSGGIAVGL  
Sbjct: 1   MTKAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDA 60

Query: 63  LNLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQN 122
           LN+  +PK L+EVQAIAAVGQGRLI RW++LFSQ+G++ AQIL+TRNDI+ W QY NA+N
Sbjct: 61  LNIPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARN 120

Query: 123 TINELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNP 182
           TINELL MGV+PIVNENDTLSISEI+FGDNDTLSAIT+ALVGAD+LFLLTDVDCLYTDNP
Sbjct: 121 TINELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNP 180

Query: 183 RTNPEAKPILVVPDLAKGLPXXXXXXXXXXXXXXXXMETKLIAADLATNAGVHTIIMKSD 242
           RTNP+A+PI++VP+L++GLP                M TKLIAADLA+NAG+ TI+MKSD
Sbjct: 181 RTNPDARPIVLVPELSEGLPGVNTSSGSGSEVGTGGMRTKLIAADLASNAGIETIVMKSD 240

Query: 243 IPGNILKIVEYMQ-----AQDLDTNKKQKYQGDLSSLQDKELATLQSLHVPLHTTFIAND 297
            P  + KIV+Y+Q      + +    +Q++      LQD EL  L+   VP+HT F+AND
Sbjct: 241 RPEYVPKIVDYIQHHFRPPRHIGNGTQQQFL----DLQDTELEQLRRYDVPMHTKFLAND 296

Query: 298 NLHHLKNREFWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDL 357
           N H LKNREFWILHGL+T+G++IID+ +Y+ L  K+ A L P  +I++   FHELECVDL
Sbjct: 297 NKHKLKNREFWILHGLITKGAIIIDENSYDKLLSKDMASLTPNAVIEVRDNFHELECVDL 356

Query: 358 KLGKRLPNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHREN 417
           K+G+RLPNGELD + P+Q+VG  R NYTSLEL++IKGL SE+I + LGY+ SEY AHREN
Sbjct: 357 KIGQRLPNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHREN 416

Query: 418 LAFPPH 423
           +AFPP 
Sbjct: 417 IAFPPQ 422

>CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces
           cerevisiae YDR300c PRO1 or sp|P38690 Saccharomyces
           cerevisiae YHR033w, hypothetical start
          Length = 485

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/471 (59%), Positives = 346/471 (73%), Gaps = 56/471 (11%)

Query: 8   TLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRTLNLDK 67
           T+VIKLG+SSLVDEKT+EPKL+IM+ +VETV++L+R GHKV+IVSSGGIAVGL  + +DK
Sbjct: 4   TIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKVVIVSSGGIAVGLNAMEMDK 63

Query: 68  RPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQNTINEL 127
           +P  LAE+QAIAA+GQGRLIGRW +LF Q+G++IAQILITRNDI+ WTQYKNAQNTI +L
Sbjct: 64  KPTDLAEIQAIAAIGQGRLIGRWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTILQL 123

Query: 128 LKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNPRTNPE 187
           L+MGVVPIVNENDTLSISEIKFGDNDTLSAIT+ALV AD+LFLLTDVDCLYT+NPRTNP+
Sbjct: 124 LEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPD 183

Query: 188 AKPILVVPDLAKGLP-XXXXXXXXXXXXXXXXMETKLIAADLATNAGVHTIIMKSDIPGN 246
           AKPI++VP++ +G+P                 M TKLIAADLATNAGV+TIIMKSD P N
Sbjct: 184 AKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDAPSN 243

Query: 247 ILKIVEYM--------------------QAQDLDTNKKQKY-----------QGDLSSLQ 275
           +  IV+Y+                    +   LD  K   Y           + DL SLQ
Sbjct: 244 VKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEEDLLSLQ 303

Query: 276 DKELATLQSLHVPLHTTFIANDNLHHLKNREFWILHGLVTRGSVIIDQGAYNALTRKN-- 333
           D EL  ++  +VPLHT F+A D  HHLKNREFWILHGLVT+G +IID+ AYN LT ++  
Sbjct: 304 DAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLTNESGD 363

Query: 334 ----------------------KAGLLPVGIIDIEGTFHELECVDLKLGKRLPNGELDPN 371
                                   GLLP  +I+++G+FHELECVD+K+GKRLPNG+LDP+
Sbjct: 364 EEHVSEAYVSEVEDDEMSEVDQDHGLLPKDVIEVKGSFHELECVDIKVGKRLPNGKLDPD 423

Query: 372 TPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHRENLAFPP 422
            PL+ VGRARCN+TS+EL+RIKGL  +++++ LGY  SEY AH++NLAFPP
Sbjct: 424 APLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDNLAFPP 474

>Scas_690.36
          Length = 424

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/429 (62%), Positives = 323/429 (75%), Gaps = 14/429 (3%)

Query: 3   MSKCYTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRT 62
           M+K  T+VIKLGSSSLVDE T+EPKL+ M+ +VE V  L+RLGHKV+IVSSGGIAVGL  
Sbjct: 1   MTKSNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKVVIVSSGGIAVGLDA 60

Query: 63  LNLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQN 122
           +NL K+P  L+E+QAIAA+GQG+LIGRW++LF Q+ ++IAQIL+TR DI  WTQ+KNAQN
Sbjct: 61  MNLKKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQN 120

Query: 123 TINELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNP 182
           TIN LLKMGVVPIVNENDTLS+SEIKFGDNDTLSAITSALV ADYLFLLTDVDCLYTDNP
Sbjct: 121 TINALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNP 180

Query: 183 RTNPEAKPILVVPDL-----AKGLPXXXXXXXXXXXXXXXXMETKLIAADLATNAGVHTI 237
           + N +AKPIL V D+     +K L                 M TK+ AADLATN G+HTI
Sbjct: 181 KVNKDAKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTI 240

Query: 238 IMKSDIPGNILKIVEYMQAQDLDTNKKQKYQGDLSSLQDKELATLQSLHVPLHTTFIAND 297
           IM S  P NILKI+EYM+  +L      K  G + S  D EL  L +  VPLHT FIAN+
Sbjct: 241 IMSSQTPANILKIIEYMETSNL------KVDGGVCSNNDLELKNLIAHDVPLHTKFIANE 294

Query: 298 NLH-HLKNREFWILHGLVTRGSVIIDQGAYNALTRKNK--AGLLPVGIIDIEGTFHELEC 354
           N   +LKNREFWILHGLVT+GS+IID+ +Y  L RK +   GLLP+ IID E  FHELEC
Sbjct: 295 NSETYLKNREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELEC 354

Query: 355 VDLKLGKRLPNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAH 414
           V+LK+G+RLPNG+++    L+ VGRARCNYTS E+++IKGL+S+QI E LGY DS Y  H
Sbjct: 355 VELKVGERLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVVH 414

Query: 415 RENLAFPPH 423
            ENLA  P 
Sbjct: 415 NENLALTPR 423

>YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate
           kinase (L-aspartate 4-P-transferase), catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis [1584 bp, 527 aa]
          Length = 527

 Score = 32.0 bits (71), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 150 GDNDTLSAITSALVGADYLFLLTDVDCLYTDNPRTNPEAK 189
           G  D  +A+ +  V AD L +  +VD ++T +PR  PEA+
Sbjct: 231 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPEAR 270

>KLLA0F27599g 2558178..2559746 highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3 L-aspartate
           4-P-transferase singleton, start by similarity
          Length = 522

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 150 GDNDTLSAITSALVGADYLFLLTDVDCLYTDNPRTNPEAKPI-LVVPDLAKGL 201
           G  D  +A+ +  + AD L +  +VD ++T +PR  P+A+ +  V PD A  L
Sbjct: 228 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAEL 280

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 26/78 (33%)

Query: 338  LPVGIIDIEGTFHELECVDLKLGKRLPNGELDPNTPLQTVGRARCNYTSLELSRIKGLQS 397
            +P+G+ID                K  P+   DP TPL +   AR    SLE++R + LQ+
Sbjct: 1476 IPMGLID----------------KTAPHSRADPTTPLGSEDSAR---YSLEVTRREMLQT 1516

Query: 398  EQIEEELGYADSEYAAHR 415
             Q+       DS Y+  R
Sbjct: 1517 HQL-------DSRYSVER 1527

>Scas_715.44
          Length = 528

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 150 GDNDTLSAITSALVGADYLFLLTDVDCLYTDNPRTNPEAKPIL-VVPDLAKGL 201
           G  D  +A+ +  V AD L +  +VD ++T +PR  P+A+ +  V P+ A  L
Sbjct: 227 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASEL 279

>ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH]
           complement(894781..897177) [2397 bp, 798 aa]
          Length = 798

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 127 LLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALV 163
           L +M ++ + NENDTLS  +I+ G N T   I  +++
Sbjct: 622 LFQMAILLMFNENDTLSFEQIQEGTNLTTQHIILSML 658

>AER213C [2715] [Homologous to ScYDL013W (HEX3) - SH]
           (1028170..1029843) [1674 bp, 557 aa]
          Length = 557

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 242 DIPGNILKIVEYMQAQDLDTNKKQKYQGDLSSLQDKELATLQSLHVPLHTTF 293
           ++  NI+ I++  + +DLD+ +K+KY  D  S Q   +A  Q L    + +F
Sbjct: 346 EVTQNIIDIIQAREERDLDS-RKRKYMEDTKSQQQAFVARAQRLPEGYYASF 396

>CAGL0J02882g complement(277395..278987) highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3, hypothetical
           start
          Length = 530

 Score = 29.3 bits (64), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 150 GDNDTLSAITSALVGADYLFLLTDVDCLYTDNPRTNPEAK 189
           G  D  +A+ +  + AD L +  +VD ++T +PR  P+A+
Sbjct: 231 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQAR 270

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,109,646
Number of extensions: 546116
Number of successful extensions: 1528
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1529
Number of HSP's successfully gapped: 20
Length of query: 423
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 319
Effective length of database: 12,995,837
Effective search space: 4145672003
Effective search space used: 4145672003
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)