Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_576.950750726490.0
Scas_716.7760850017730.0
YBR015C (MNN2)59749013221e-178
Kwal_56.2311760750212641e-169
CAGL0I04532g61249512541e-167
KLLA0E17831g63841611891e-157
AER018C60650311341e-149
Kwal_33.136935583708671e-110
YJL186W (MNN5)5864228471e-107
Scas_689.95864678151e-102
KLLA0C16467g6074238121e-101
AEL148W5733677832e-97
Sklu_2306.47414317594e-92
CAGL0M02871g6003717191e-87
KLLA0F24574g7114046403e-75
Kwal_56.227796954245615e-64
CAGL0L08096g5644295134e-58
AEL082W6813684862e-53
CAGL0C04004g6322531452e-09
Scas_717.56392691407e-09
CAGL0C03960g6232761381e-08
CAGL0C04048g6202861335e-08
CAGL0C03916g6282761326e-08
CAGL0C03938g6372881327e-08
AEL345W6451311264e-07
CAGL0C03982g6292531238e-07
Kwal_55.209846192611202e-06
KLLA0E09790g7462501166e-06
Scas_643.196572531131e-05
Kwal_23.29265682761112e-05
YIL014W (MNT3)6302531103e-05
CAGL0H09240g6422511094e-05
CAGL0C04026g6361511041e-04
YER001W (MNN1)7622711013e-04
AFL235W3812461004e-04
CAGL0C03894g627130988e-04
CAGL0H09262g625266970.001
AAR183C648129880.012
YNR059W (MNT4)580206860.022
ABR245C641239850.030
Sklu_2225.6797273850.033
YGL257C (MNT2)558181830.046
CAGL0G04279g660272830.051
KLLA0D13376g663164760.36
CAGL0I08019g128535721.2
Kwal_23.5454583142711.3
Kwal_33.15024369149701.6
KLLA0A11880g42345701.7
Kwal_55.2223858451682.8
KLLA0B06732g60165648.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_576.9
         (507 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_576.9                                                           1025   0.0  
Scas_716.77                                                           687   0.0  
YBR015C (MNN2) [208] chr2 complement(267672..269465) Mannosyltra...   513   e-178
Kwal_56.23117                                                         491   e-169
CAGL0I04532g 404659..406497 similar to sp|P38069 Saccharomyces c...   487   e-167
KLLA0E17831g complement(1572985..1574901) some similarities with...   462   e-157
AER018C [2523] [Homologous to ScYBR015C (MNN2) - SH] (661035..66...   441   e-149
Kwal_33.13693                                                         338   e-110
YJL186W (MNN5) [2738] chr10 (80153..81913) Mannosyltransferase r...   330   e-107
Scas_689.9                                                            318   e-102
KLLA0C16467g 1442002..1443825 weakly similar to sp|P46982 Saccha...   317   e-101
AEL148W [2358] [Homologous to ScYJL186W (MNN5) - SH] complement(...   306   2e-97
Sklu_2306.4 , Contig c2306 6263-8488 reverse complement               296   4e-92
CAGL0M02871g 324009..325811 similar to sp|P46982 Saccharomyces c...   281   1e-87
KLLA0F24574g complement(2285387..2287522) weakly similar to sp|P...   251   3e-75
Kwal_56.22779                                                         220   5e-64
CAGL0L08096g complement(884830..886524) some similarities with s...   202   4e-58
AEL082W [2424] [Homologous to ScYBR015C - NSH] complement(474072...   191   2e-53
CAGL0C04004g complement(394614..396512) similar to sp|P40549 Sac...    60   2e-09
Scas_717.5                                                             59   7e-09
CAGL0C03960g complement(389250..391121) similar to sp|P40549 Sac...    58   1e-08
CAGL0C04048g complement(399734..401596) similar to sp|P40549 Sac...    56   5e-08
CAGL0C03916g complement(383989..385875) weakly similar to sp|P40...    55   6e-08
CAGL0C03938g complement(386673..388586) weakly similar to sp|P40...    55   7e-08
AEL345W [2160] [Homologous to ScYIL014W (MNT3) - NSH] complement...    53   4e-07
CAGL0C03982g complement(391909..393798) similar to sp|P40549 Sac...    52   8e-07
Kwal_55.20984                                                          51   2e-06
KLLA0E09790g 867899..870139 similar to sp|P39106 Saccharomyces c...    49   6e-06
Scas_643.19                                                            48   1e-05
Kwal_23.2926                                                           47   2e-05
YIL014W (MNT3) [2651] chr9 (326101..327993) Mannosyltransferase ...    47   3e-05
CAGL0H09240g complement(905670..907598) some similarities with s...    47   4e-05
CAGL0C04026g complement(397303..399213) weakly similar to sp|P40...    45   1e-04
YER001W (MNN1) [1423] chr5 (153519..155807) Alpha-1,3-mannosyltr...    44   3e-04
AFL235W [2960] [Homologous to ScYIL014W (MNT3) - NSH; ScYER001W ...    43   4e-04
CAGL0C03894g complement(381514..383397) weakly similar to sp|P40...    42   8e-04
CAGL0H09262g complement(908258..910135) similar to sp|P40549 Sac...    42   0.001
AAR183C [371] [Homologous to ScYIL014W (MNT3) - NSH] (672091..67...    39   0.012
YNR059W (MNT4) [4642] chr14 (736800..738542) Protein with strong...    38   0.022
ABR245C [839] [Homologous to ScYIL014W (MNT3) - NSH] (854585..85...    37   0.030
Sklu_2225.6 YER001W, Contig c2225 7299-9692                            37   0.033
YGL257C (MNT2) [1743] chr7 complement(12481..14157) Mannosyltran...    37   0.046
CAGL0G04279g complement(404144..406126) weakly similar to sp|P40...    37   0.051
KLLA0D13376g 1150858..1152849 some similarities with sp|P40549 S...    34   0.36 
CAGL0I08019g complement(782863..786720) highly similar to sp|Q08...    32   1.2  
Kwal_23.5454                                                           32   1.3  
Kwal_33.15024                                                          32   1.6  
KLLA0A11880g 1026919..1028190 some similarities with ca|CA0854|I...    32   1.7  
Kwal_55.22238                                                          31   2.8  
KLLA0B06732g 589699..591504 similar to sp|P38228 Saccharomyces c...    29   8.4  

>Scas_576.9
          Length = 507

 Score = 1025 bits (2649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/507 (97%), Positives = 495/507 (97%)

Query: 1   KMSAKDNRHLRGAGNKSSTNTHTMAVLRRRFSKVFKLTLLFCLIAVGLIFFHLGQYSDAV 60
           KMSAKDNRHLRGAGNKSSTNTHTMAVLRRRFSKVFKLTLLFCLIAVGLIFFHLGQYSDAV
Sbjct: 1   KMSAKDNRHLRGAGNKSSTNTHTMAVLRRRFSKVFKLTLLFCLIAVGLIFFHLGQYSDAV 60

Query: 61  PTQYKDYLKXXXXXXXXXXXXAEHDIEQENSSSYNDNNIKSFFDTVFQHILDYSPTGKSE 120
           PTQYKDYLK            AEHDIEQENSSSYNDNNIKSFFDTVFQHILDYSPTGKSE
Sbjct: 61  PTQYKDYLKSYITSNSTSSVSAEHDIEQENSSSYNDNNIKSFFDTVFQHILDYSPTGKSE 120

Query: 121 RIYNKEKCLLNSVVGYSPDNYKDWYKLSYENLGNCLEISDDEYTNLQSNHASFIEEMDKL 180
           RIYNKEKCLLNSVVGYSPDNYKDWYKLSYENLGNCLEISDDEYTNLQSNHASFIEEMDKL
Sbjct: 121 RIYNKEKCLLNSVVGYSPDNYKDWYKLSYENLGNCLEISDDEYTNLQSNHASFIEEMDKL 180

Query: 181 TLPNDIYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTML 240
           TLPNDIYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTML
Sbjct: 181 TLPNDIYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTML 240

Query: 241 NEFDAKCVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQ 300
           NEFDAKCVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQ
Sbjct: 241 NEFDAKCVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQ 300

Query: 301 QEPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEMDV 360
           QEPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEMDV
Sbjct: 301 QEPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEMDV 360

Query: 361 PYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKET 420
           PYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKET
Sbjct: 361 PYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKET 420

Query: 421 FIAGATFYNLPFYQVKTKVGVDGYHKEDGFRGVAMLQHDFVQDYDRYKLAQLKIDKKYLP 480
           FIAGATFYNLPFYQVKTKVGVDGYHKEDGFRGVAMLQHDFVQDYDRYKLAQLKIDKKYLP
Sbjct: 421 FIAGATFYNLPFYQVKTKVGVDGYHKEDGFRGVAMLQHDFVQDYDRYKLAQLKIDKKYLP 480

Query: 481 SNEVLYDKDYTVQKFYDEYFNIEGNET 507
           SNEVLYDKDYTVQKFYDEYFNIEGNET
Sbjct: 481 SNEVLYDKDYTVQKFYDEYFNIEGNET 507

>Scas_716.77
          Length = 608

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/500 (65%), Positives = 398/500 (79%), Gaps = 23/500 (4%)

Query: 24  MAVLRRRFSKVFKLTLLFCLIAVGLIFFHLGQYSDAVPTQ-YKDYLKXXXXXXXXXXXXA 82
           M +LRRRFS+VFKL LL  ++  GL FF+ GQYS+++  + YK+YL+            +
Sbjct: 1   MVLLRRRFSRVFKLALLLSIVGAGLFFFNSGQYSESISVKDYKEYLQNYINSNSDPTPSS 60

Query: 83  EHDIEQE---------------------NSSSYNDNNIKSFFDTVFQHILDYSPTGKSER 121
             +  ++                      S   +D  +K+FF+TVFQHI+DYSP GK+++
Sbjct: 61  SPNAAKQPAANLKDESNKNNNKKNGGSVGSPKTHDEKMKAFFNTVFQHIIDYSPKGKTKK 120

Query: 122 IYNKEKCLLNSVVGYSPDNYKDWYKLSYENLGNCLEISDDEYTNLQSNHASFIEEMDKLT 181
           IYNKEKCLL+  VG  P+NYKDWYKLSY+NLGNCLE+SD E+TNL+++HASF E ++KL 
Sbjct: 121 IYNKEKCLLDGDVGSRPENYKDWYKLSYKNLGNCLEVSDTEFTNLKTSHASFTENLNKLV 180

Query: 182 LPNDIYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLN 241
           LP   Y+GDGIVLV GGKFSLLSYLV+KTIR  GTTLP+EVFIPP+EVE E+EFC   ++
Sbjct: 181 LPKGTYKGDGIVLVGGGKFSLLSYLVIKTIRNLGTTLPIEVFIPPNEVEGESEFCSQTIS 240

Query: 242 EFDAKCVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQ 301
           + DAKC+YISDILP+ M+S F+FKGYQFKSLAIIASSFENLLLLDADN P+KNL+ IF+Q
Sbjct: 241 DLDAKCIYISDILPKDMVSKFEFKGYQFKSLAIIASSFENLLLLDADNTPIKNLNTIFKQ 300

Query: 302 EPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEMDVP 361
           EPY + GL+LWPDFWRRTTQP++Y+IAGI VNLQKRVRN ID+LTPV VY K D  +D+P
Sbjct: 301 EPYASRGLVLWPDFWRRTTQPIYYKIAGIPVNLQKRVRNDIDDLTPVGVYTKPDM-VDIP 359

Query: 362 YHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETF 421
           +HDFEG MPDVSTESG+LMVNK +HL TVLLALYYNVNGPNWYYPIFSQ  AGEGDKETF
Sbjct: 360 FHDFEGTMPDVSTESGQLMVNKSKHLATVLLALYYNVNGPNWYYPIFSQKAAGEGDKETF 419

Query: 422 IAGATFYNLPFYQVKTKVGVDGYHKEDGFRGVAMLQHDFVQDYDRYKLAQLKIDKKYLPS 481
           IAGA FY+LP+YQVK+KVGVDGYH+++GFRGVAMLQHDFVQDY+RYKLA   I ++Y   
Sbjct: 420 IAGANFYDLPYYQVKSKVGVDGYHRKEGFRGVAMLQHDFVQDYNRYKLASADIAREYSNP 479

Query: 482 NEVLYDKDYTVQKFYDEYFN 501
           + V++DK YTVQKFYD+YF+
Sbjct: 480 SSVVFDKSYTVQKFYDKYFD 499

>YBR015C (MNN2) [208] chr2 complement(267672..269465)
           Mannosyltransferase required for forming and extending
           the mannose branches of the outer chain mannans [1794
           bp, 597 aa]
          Length = 597

 Score =  513 bits (1322), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 259/490 (52%), Positives = 343/490 (70%), Gaps = 16/490 (3%)

Query: 26  VLRRRFSKVFKLTLLFCLIAVGLIFFHLGQYSDAVPT--QYKDYLKXXXXXXXXXXXXAE 83
           +L +RFSK+FKLT +  LI  GL F    +Y D   +  +YK+YL             + 
Sbjct: 2   LLTKRFSKLFKLTFI-VLILCGL-FVITNKYMDENTSVKEYKEYLDRYVQSYSNKYSSSS 59

Query: 84  HDIEQENSSSYNDNN------IKSFFDTVFQHILDYSPTGKSERIYNKEKCLLNSVVGYS 137
                ++S+   DN+      +KSF++ VF  ++  SP G + + YN E CLL   +G  
Sbjct: 60  DAASADDSTPLRDNDEAGNEKLKSFYNNVFNFLMVDSPKGSTAKQYN-EACLLKGDIGDR 118

Query: 138 PDNYKDWYKLSYENLGNCLEISDDEYTNLQSNHASFIEEMDKLTLPNDIYQGDGIVLVAG 197
           PD+YKD YKLS + L  CLE+S DE  +L  +H  ++E +  L  P   Y+G GI  V G
Sbjct: 119 PDHYKDLYKLSAKELSKCLELSPDEVASLTKSHKDYVEHIATLVSPKGTYKGSGIATVGG 178

Query: 198 GKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAKCVYISDILPES 257
           GKFSL+++L++KT+R  GTTLPVEV IPP + E E EFC  +L ++++KC+Y+SDILP  
Sbjct: 179 GKFSLMAFLIIKTLRNMGTTLPVEVLIPPGD-EGETEFCNKILPKYNSKCIYVSDILPRE 237

Query: 258 MISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPDFWR 317
            I  F FKGYQFKSLA+IASSFENLLLLDADNFP+K LDNIF +EPY +TGL++WPDFWR
Sbjct: 238 TIEKFVFKGYQFKSLALIASSFENLLLLDADNFPIKPLDNIFNEEPYVSTGLVMWPDFWR 297

Query: 318 RTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEM-DVPYHDFEGAMPDVSTES 376
           RTT P++Y+IAGI+V+ +KRVRN+ D++TP  VY K  +++ DVP  D +G +PDVSTES
Sbjct: 298 RTTHPLYYDIAGIAVDKKKRVRNSRDDITPPAVYTKDLKDLSDVPLSDLDGTIPDVSTES 357

Query: 377 GELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGATFYNLPFYQVK 436
           G+LM+NK +HL T LL+L+YNVNGP WYYPIFSQ  AGEGDKETFIA A FY L FYQV+
Sbjct: 358 GQLMINKTKHLATALLSLFYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVR 417

Query: 437 TKVGVDGYHKEDGFRGVAMLQHDFVQDYDRYKLAQLKIDKKY---LPSNEVLYDKDYTVQ 493
           T+ GV+GYH EDGF GVAMLQHDFVQDY RY  A   I  KY     ++ + +DK+Y+++
Sbjct: 418 TRTGVEGYHDEDGFHGVAMLQHDFVQDYGRYLNAMESIGNKYGGTKSADAIKFDKNYSLE 477

Query: 494 KFYDEYFNIE 503
           K+ +E+F+ E
Sbjct: 478 KYTEEFFDNE 487

>Kwal_56.23117
          Length = 607

 Score =  491 bits (1264), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 245/502 (48%), Positives = 332/502 (66%), Gaps = 28/502 (5%)

Query: 24  MAVLRRRFSKVFKLTLLFCLIAVGLIFFHLGQYSDAVPTQYKDYLKXXXXXXXXXXXXAE 83
           M  L +RFSK+FKL+L+  L  +  +F       D    +Y   +              E
Sbjct: 1   MVFLTKRFSKIFKLSLVAALCCLAFMFSTKYFDKDLTSLEYGKLVDTFMADAGYGKDAQE 60

Query: 84  HDIEQENSSSYNDNN-------------------IKSFFDTVFQHILDYSPTGKSERIYN 124
             +   +S    DNN                   ++ F+  VF  +  +SPTG S+R Y 
Sbjct: 61  --VAGSSSDGTADNNGIGAGAKVSTSSNEKRKIAMRKFYTDVFNSLKKHSPTGVSKREYG 118

Query: 125 KEKCLLNSVVGYSPDNYKDWYKLSYENLGNCLEISDDEYTNLQSNHASFIEEMDKLTLPN 184
            + C L+  +G   D+Y +W KL+ +NLG CL +SD E   L+  H  ++E ++ L LP 
Sbjct: 119 AQ-CKLSGDIGARADDYDNWSKLTSKNLGQCLIVSDKEKRMLKEKHRGYVESLESLVLPK 177

Query: 185 DIYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFD 244
             Y+GDGIV V GGKFS+L++L++KT+R   T+LPVEVFIPP + E E  FC  +L +++
Sbjct: 178 GAYKGDGIVTVGGGKFSMLAFLIIKTLRNLHTSLPVEVFIPPAD-EGETFFCNELLPQYN 236

Query: 245 AKCVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPY 304
           AKC+YISD+LP+ +I +F+FKGYQFKS+AIIASSF+NLLLLDADNFP+K+LDN+F +EPY
Sbjct: 237 AKCIYISDVLPQEIIDNFEFKGYQFKSIAIIASSFDNLLLLDADNFPIKDLDNVFNEEPY 296

Query: 305 TTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEM-DVPYH 363
            + G++LWPDFWRRTT P++Y+IA I VN +KRVRN +D++TP  VY K   ++ +VP H
Sbjct: 297 KSKGMVLWPDFWRRTTNPIYYDIADIEVNYKKRVRNCMDDVTPPAVYTKDMSDLSNVPLH 356

Query: 364 DFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIA 423
           D EG +PDVSTESG+LM+ K +HL T+LL+LYYNVNGP+WYYPIFSQ  +GEGDKETFIA
Sbjct: 357 DLEGTIPDVSTESGQLMIRKSDHLGTILLSLYYNVNGPSWYYPIFSQKASGEGDKETFIA 416

Query: 424 GATFYNLPFYQVKTKVGVDGYHK--EDGFRGVAMLQHDFVQDYDRYKLAQLKIDKKYLPS 481
            A FY+LPFYQVK+   VDGYH+  + GFRGVAMLQHDFVQDY R   AQ++I   +   
Sbjct: 417 AANFYDLPFYQVKSVTAVDGYHQPHDKGFRGVAMLQHDFVQDYGRQMWAQVEIRSHFAGK 476

Query: 482 NE--VLYDKDYTVQKFYDEYFN 501
           +     YD  Y+    Y ++F+
Sbjct: 477 DTQYAKYDPSYSPDAVYKKFFS 498

>CAGL0I04532g 404659..406497 similar to sp|P38069 Saccharomyces
           cerevisiae YBR015c TTP1 type II membrane protein, start
           by similarity
          Length = 612

 Score =  487 bits (1254), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 247/495 (49%), Positives = 335/495 (67%), Gaps = 22/495 (4%)

Query: 26  VLRRRFSKVFKLTLLFCLIAVGLIF---FHLGQYSDAVPTQ---------YKDYLKXXXX 73
           +  RRF+K+ KL L+   I  GL +   F  G  S A+  +         +K Y      
Sbjct: 1   MFNRRFAKLVKLVLITVSIVGGLYYLSGFIDGDTSTALGNRLSQEYMDSFWKTYDSSKSS 60

Query: 74  XXXXXXXXAEHDIEQENSSSYNDNNIKSFFDTVFQHILDYSPTGKSERIYNKEKCLLNSV 133
                   +    E +  S      IK F+ TVF+HILDYSP GK+ R ++ + C  +  
Sbjct: 61  YGSSLLGGSGEKGETDFRSPEAKLKIKDFYKTVFEHILDYSPAGKTAREFD-DSCFDSGD 119

Query: 134 VGYSPDNYKDWYKLSYENLGNCLEISDDEYTNLQSNHASFIEEMDKLTLPNDIYQGDGIV 193
           +   PD+YK+W KLSY  L +C++IS  E  +L+ NH S+++++++L LP   Y+G+GIV
Sbjct: 120 ISTRPDSYKNWKKLSYHQLSHCMKISPSEINHLRGNHKSYVDKINELVLPKGSYKGEGIV 179

Query: 194 LVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAKCVYISDI 253
            V GGKF+L++  ++K +R  GTTLPVEVFIPPDE   E+ FC+++L +++AKC+YISDI
Sbjct: 180 TVGGGKFTLMALTMIKALRTLGTTLPVEVFIPPDE--GESTFCESVLPQYNAKCIYISDI 237

Query: 254 LPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWP 313
           LP+ MI  F FKGYQFKSLA+I SSFENLLLLDADN PVK +D+IF+ + + + GLILWP
Sbjct: 238 LPDDMIQKFTFKGYQFKSLAMITSSFENLLLLDADNIPVKKIDHIFESQIFRSAGLILWP 297

Query: 314 DFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEM-DVPYHDFEGAMPDV 372
           DFWRRTT P +YEIA +  N  KRVRNA D++TP +VY K D ++ +VP+HD EG +PD 
Sbjct: 298 DFWRRTTMPAYYEIANLPYNQNKRVRNAFDDITPPEVYTKPDGDLSEVPFHDMEGTLPDP 357

Query: 373 STESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGATFYNLPF 432
           STESG+L+++K +HL T+LL+LYYNVNGPNWYYPIFSQ  AGEGDKETFI+ A+FY+L +
Sbjct: 358 STESGQLLISKAKHLPTLLLSLYYNVNGPNWYYPIFSQRTAGEGDKETFISAASFYSLSY 417

Query: 433 YQVKTKVGVDGYHKED--GFRGVAMLQHDFVQDYDRYKLAQLKIDKKY----LPSNEVLY 486
           YQVKT VGVDGY + D  G+RGV MLQHDF+QD  +Y  A    + KY         + Y
Sbjct: 418 YQVKTSVGVDGYFRHDGSGYRGVGMLQHDFIQDSKQYMEAFEYSNTKYNNLRSEKGSISY 477

Query: 487 DKDYTVQKFYDEYFN 501
           D  Y   +F+D++F+
Sbjct: 478 DPSYDPNEFFDKFFS 492

>KLLA0E17831g complement(1572985..1574901) some similarities with
           sp|P38069 Saccharomyces cerevisiae YBR015c TTP1 type II
           membrane protein, hypothetical start
          Length = 638

 Score =  462 bits (1189), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 222/416 (53%), Positives = 301/416 (72%), Gaps = 9/416 (2%)

Query: 85  DIEQENSSSYNDNNIKSFFDTVFQHILDYSPTGKSERIYNKEKCLLNSVVGYSPDNYKDW 144
           ++   ++ S     ++ F+  VF+++ ++ P G +   YN +KC LN  +GY  +N   W
Sbjct: 116 NVGASSTPSSKKKQVQGFYGQVFKYLKEFGPVGVNIATYN-QKCSLNGDIGYRQENTDQW 174

Query: 145 YKLSYENLGNCLEISDDEYTNLQSNHASFIEEMDKLTLPNDIYQGDGIVLVAGGKFSLLS 204
           +KL+ E L NCL++S ++   L+  H++++  + KL LP D Y GDGIV V GGKFS+++
Sbjct: 175 WKLTTEELNNCLQLSQEQRLMLKEAHSNYVHALSKLVLPKDTYSGDGIVTVGGGKFSMMA 234

Query: 205 YLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAKCVYISDILPESMISHFDF 264
           +L++KT+R FGTTLPVEVFIPP + E + EFC  +L +++AKC+Y+SD  P  +I   DF
Sbjct: 235 FLIIKTVRNFGTTLPVEVFIPPSD-EGDDEFCNVLLPQYNAKCIYLSDAFPPDLIEKSDF 293

Query: 265 KGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPDFWRRTTQPMF 324
           KGYQFKSLAIIASSF+NLLLLDADNFP+K LD IF+++ Y  TGLILWPDFWRRTT P +
Sbjct: 294 KGYQFKSLAIIASSFKNLLLLDADNFPIKPLDGIFEEKSYKDTGLILWPDFWRRTTHPSY 353

Query: 325 YEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEM-DVPYHDFEGAMPDVSTESGELMVNK 383
           Y IA   ++  +R+RN +D++TP  VY K  +++ DVP HD +G +PD STESG+LM+NK
Sbjct: 354 YSIANTPIS-SERIRNTMDDVTPPSVYTKDLKDLSDVPLHDLDGTIPDASTESGQLMINK 412

Query: 384 VEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGATFYNLPFYQVKTKVGVDG 443
           ++H  TVLL+LYYNV GP+WYY IFSQ  +GEGDKETFIA A FY+LPFYQV+++  VDG
Sbjct: 413 LKHFPTVLLSLYYNVYGPSWYYSIFSQRSSGEGDKETFIAAAHFYDLPFYQVRSEPRVDG 472

Query: 444 YHKE--DGFRGVAMLQHDFVQDYDRYKLAQLKIDKKYLPSNEV-LYDKDYTVQKFY 496
           YH+   +GFRGV MLQHDF QDY RY+ AQ +I  KY  +NE   YD  Y  Q+ Y
Sbjct: 473 YHRHNNEGFRGVCMLQHDFAQDYKRYRQAQNEIGTKY--TNEPDDYDPKYNYQENY 526

>AER018C [2523] [Homologous to ScYBR015C (MNN2) - SH]
           (661035..662855) [1821 bp, 606 aa]
          Length = 606

 Score =  441 bits (1134), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 222/503 (44%), Positives = 318/503 (63%), Gaps = 34/503 (6%)

Query: 26  VLRRRFSKVFKLTLLFCLIAVGLIFFHLGQY-SDAVPTQYKDYLKXXXXXXXXXXXXAEH 84
           +LRR++SK  KL+L+   +A+G +F    ++     P+ Y +YL+             +H
Sbjct: 1   MLRRKYSKTLKLSLI--TVALGALFLVTNRWLPGEFPSVYTEYLQNRLPNLGSFGKQ-QH 57

Query: 85  DIEQENSS--------------------------SYNDNNIKSFFDTVFQHILDYSPTGK 118
             EQE+ +                          +   + I +F+  VF+ + ++SP+G+
Sbjct: 58  MEEQESQTRQMIEEGEMRSKPSELLEEEAARTEQAERKSQIFAFYQKVFELLAEHSPSGQ 117

Query: 119 SERIYNKEKCLLNSVVGYSPDNYKDWYKLSYENLGNCLEISDDEYTNLQSNHASFIEEMD 178
                 ++  +   V+    D+   W  L+ E+L  CL+++  +   +   H  +++ + 
Sbjct: 118 ISHKSGRQCQVSQVVLQGHLDDTSHWPLLTREHLSKCLKMTQKDKQMVSDKHMHYVDALS 177

Query: 179 KLTLPNDIYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKT 238
            L L    Y G GIV V GGKFS+L+ L++K++RK GT+LPVEV IPP E EEE ++C  
Sbjct: 178 NLKLSKRAYSGAGIVTVGGGKFSMLALLLIKSLRKVGTSLPVEVLIPPGE-EEEYDYCSK 236

Query: 239 MLNEFDAKCVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNI 298
           +L E  AKC+Y+ D+LP ++I++  F+GYQ KS AIIASSF++LLLLDADN P+ NLD+I
Sbjct: 237 LLPEVGAKCIYLKDVLPPAVINNHYFEGYQLKSAAIIASSFKDLLLLDADNIPILNLDDI 296

Query: 299 FQQEPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEM 358
           FQ +PY   GL+LWPDFWRR+T P +YEIA + V+  +RVRN IDNLTP  VY ++ +++
Sbjct: 297 FQSKPYVEHGLVLWPDFWRRSTSPDYYEIARVQVDYNRRVRNHIDNLTPASVYTQNMKDL 356

Query: 359 D-VPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGD 417
             +P HD EG +PD STESG+L+++K  HL TVLL+LYYNVNG  WYYP+FSQG  GEGD
Sbjct: 357 SSIPMHDMEGTLPDPSTESGQLLIDKERHLSTVLLSLYYNVNGETWYYPLFSQGAPGEGD 416

Query: 418 KETFIAGATFYNLPFYQVKTKVGVDGYHKEDGFRGVAMLQHDFVQDYDRYKLAQLKIDKK 477
           KETFIA A FY  P+YQV+T  G +GYH + GF GVAMLQHDF +DY RY+ A+  +  K
Sbjct: 417 KETFIAAANFYRKPYYQVRTSTGAEGYHTKKGFSGVAMLQHDFREDYRRYEAAREDVKTK 476

Query: 478 YLPSNEVLYDKDYTVQKFYDEYF 500
           Y  S +  YD +YTV+ FY +YF
Sbjct: 477 YAKSQQ--YDPEYTVEGFYKKYF 497

>Kwal_33.13693
          Length = 558

 Score =  338 bits (867), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 161/370 (43%), Positives = 243/370 (65%), Gaps = 15/370 (4%)

Query: 149 YENLGNCLEISDDEYTNLQSNHASFIEEM-------DKLTLPNDIYQGD-GIVLVAGGKF 200
           YENL  C   S  ++  LQ+ H +++  +       ++  + N+++  D G V V GG+F
Sbjct: 86  YENLDACFRPSKAQFEGLQAPHTAYLAALRSTFNYQNEPGVFNELFPNDKGFVTVGGGRF 145

Query: 201 SLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAKCVYISDILPESMIS 260
           SLLSY +++T+R+ G+TLP+EV IPP + + E  FC+ +L + + +CV+  D LP S++ 
Sbjct: 146 SLLSYTMIRTMRERGSTLPIEVVIPPQDEKGEEHFCQEILPKLNGRCVFFGDTLPPSIVE 205

Query: 261 HFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPDFWRRTT 320
            + FK YQ K +A++ SSF+ ++ +DAD+ P+KNLD++F+ + +   GL+LWPD WRR T
Sbjct: 206 DWKFKSYQIKVMALLLSSFKKIVFIDADDLPLKNLDDVFESKVFKKNGLVLWPDLWRRMT 265

Query: 321 QPMFYEIAGISVNLQKRVRNAIDNLTPVQVY--DKSDQEMDVPYHDFEGAMPDVSTESGE 378
            P+FY +A I  +L KRVRN  D+++PV  Y    + ++  +P+HDF G +PD +TESG+
Sbjct: 266 APVFYRLANIDTDLTKRVRNLGDDISPVSRYLNPNAKEQKPIPFHDFAGTIPDPTTESGQ 325

Query: 379 LMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGATFYNLPFYQVKTK 438
           ++++KV H +T+LLALYYNV GP+WYY +FSQG AGEGDKETF + A    LP+YQV+TK
Sbjct: 326 MVIDKVRHFQTLLLALYYNVYGPDWYYALFSQGTAGEGDKETFASAAHVLELPYYQVRTK 385

Query: 439 VGVDGYH--KEDGFRGVAMLQHDFVQDYDRYKLAQLKIDKKYLPSNEVLYDKDYTVQK-F 495
           +  DGY   K+ GFRGVA+ QHD  QDY+ Y+ A+  +  K  P     + +DY  +  F
Sbjct: 386 LSFDGYSDPKDGGFRGVALYQHDCTQDYETYEQARELV--KSQPDKYSAFKEDYDSEPDF 443

Query: 496 YDEYFNIEGN 505
           Y      EG 
Sbjct: 444 YQSLMKPEGK 453

>YJL186W (MNN5) [2738] chr10 (80153..81913) Mannosyltransferase
           required for forming and extending the mannose branches
           of the outer chain mannans [1761 bp, 586 aa]
          Length = 586

 Score =  330 bits (847), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 177/422 (41%), Positives = 260/422 (61%), Gaps = 32/422 (7%)

Query: 97  NNIKS-FFDTVFQHILDYSPTGKS---ERIYNKEKC-LLNSVVGYSPDNYKDWYKLSYEN 151
           +N+K+ F+ T+ Q I++  P   S    +++  E C   N+V  +   +  D   LSYE+
Sbjct: 49  SNLKNNFYTTLVQAIVENKPADSSPDLSKLHGAEGCSFANNVAAHDSGHDSD---LSYES 105

Query: 152 LGNCLEISDDEYTNLQSNHASFIEEMD---KLTLPND--IYQG-DGIVLVAGGKFSLLSY 205
           L  C  ++     +L+  H+ F + +      ++P    ++ G +GIV + GGK+S+L+Y
Sbjct: 106 LSKCYNLNKTVQESLREVHSKFTDTLSGKLNFSIPQREALFSGSEGIVTIGGGKYSVLAY 165

Query: 206 LVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAKCVYISDILPESMISHFDFK 265
            ++K +R  GTTLP+EV IPP + E E +FCK  L +F+ KC+Y SDI+P   +S     
Sbjct: 166 TMIKKLRDTGTTLPIEVIIPPQD-EGEDDFCKNWLPKFNGKCIYFSDIVPSKPLSDLKLT 224

Query: 266 GYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPDFWRRTTQPMFY 325
            +Q K   +I SSF+ ++ LDADN+ VKNLD  F    +  TGLILWPDFWRR T P FY
Sbjct: 225 HFQLKVFGLIISSFKRIIFLDADNYAVKNLDLAFNTTSFNDTGLILWPDFWRRVTPPAFY 284

Query: 326 EIAGISVNLQKRVRNAIDNLTPVQVYD-----------KSDQE---MDVPYHDFEGAMPD 371
            I G S+N+ KRVR   D+++PV  YD           K  QE     VP HD +G MPD
Sbjct: 285 NIIGSSINIGKRVRFVSDDISPVSRYDPFVSNSNDYTPKERQEHFLKHVPLHDLDGTMPD 344

Query: 372 VSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGATFYNLP 431
           +S+ESG+++++K+ H  T+LLALYYNV GP WYY + SQG AGEGDK+TF A A   N+P
Sbjct: 345 LSSESGQMVIDKIRHFNTLLLALYYNVYGPTWYYKMISQGTAGEGDKDTFFAAAHALNMP 404

Query: 432 FYQVKTKVGVDG-YHKEDGFRGVAMLQHDFVQDYDRYKLAQLKIDKKYLPSNEVLYDKDY 490
           +YQV+T    DG ++++D ++G+A+LQHDF QDY +Y+ AQ K+       +++  D DY
Sbjct: 405 YYQVRTNFEFDGFFYQKDDYKGLALLQHDFEQDYKQYQKAQQKVKANIEEFSKL--DPDY 462

Query: 491 TV 492
           T+
Sbjct: 463 TL 464

>Scas_689.9
          Length = 586

 Score =  318 bits (815), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 174/467 (37%), Positives = 281/467 (60%), Gaps = 48/467 (10%)

Query: 27  LRRRFSKVFKLTLLFCLIAVGLIFFHLGQYSDAVPTQYKDYLKXXXXXXXXXXXXAEHDI 86
           +RRR + +F L    C + +  +  H+  Y DA   QY+                AE  +
Sbjct: 9   IRRRKNPIFVL----CALLIIYLLLHVSNY-DAKDFQYQ---------FLSGLTTAERKV 54

Query: 87  EQENSSSYNDNNIKSFFDTVFQHILDY---SPTGKSERIYNKEKCLLNSVVGYSPDNYKD 143
            Q          +++F+  +F  I  Y   +P G  E + +K+KC  +  +  + D    
Sbjct: 55  PQ----------VEAFYLDLFNSINQYRPLNPPGNWEDLRDKDKCKWSGDISVNDDGRDA 104

Query: 144 WYKLSYENLGNCLEISDDEYTNLQSNHASFIEEM--------DKLT---LPNDIYQGDGI 192
             +LS ENL  C ++S  +  NL+  H+ +++ +        ++LT    PN++    GI
Sbjct: 105 NERLSMENLDECFKLSSIQLNNLKRAHSGYVKNIRDKFDDKNERLTNSLFPNNV----GI 160

Query: 193 VLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAKCVYISD 252
           V + GG++++L   ++  +R  GT+LP+EV IPP++ E + +FC  +L +++ KCV+  D
Sbjct: 161 VTIGGGRYTVLLMTMIAKLRDTGTSLPIEVIIPPED-EGDDDFCNVILPKWNGKCVFFKD 219

Query: 253 ILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILW 312
           +LP+ +      + YQ K LA++ SSF+ +L LDADN+ +K+LD+IF+ EP+   GLI+W
Sbjct: 220 VLPDELNKKLMLQSYQIKPLAVLLSSFKKILFLDADNYAMKDLDHIFESEPFIENGLIVW 279

Query: 313 PDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEMD-----VPYHDFEG 367
           PD+WRR T P +Y+IA I+++ +KR+RN  D++TP   YD   ++ D     VP HD EG
Sbjct: 280 PDYWRRVTPPAYYKIADINISKKKRIRNINDDITPPSYYDNKLKDRDHLLKEVPMHDLEG 339

Query: 368 AMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGATF 427
            +PD ++ESG+++++KV+H  T+LL+LYYN+ GP+WYY IFSQG +G+GDKETFIA A  
Sbjct: 340 TIPDPTSESGQMVIDKVKHFHTLLLSLYYNLYGPSWYYQIFSQGTSGQGDKETFIAAAHA 399

Query: 428 YNLPFYQVKTKVGVDGYHKEDGFRGVAMLQHDFVQDYDRYKLAQLKI 474
            N P+YQV T +G+ G+  E+ FRG+ +LQ DF QDY +++L +  I
Sbjct: 400 LNKPYYQVTTSLGLKGFFYENEFRGIGLLQRDFQQDYAQHQLVKQTI 446

>KLLA0C16467g 1442002..1443825 weakly similar to sp|P46982
           Saccharomyces cerevisiae YJL186w MNN5 putative
           mannosyltransferase, start by similarity
          Length = 607

 Score =  317 bits (812), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 169/423 (39%), Positives = 259/423 (61%), Gaps = 26/423 (6%)

Query: 102 FFDTVFQHILDYSPTGKS---ERIYNKEKCLLNSVVGYSPDNYKDWYKLSYENLGNCLEI 158
           FF T+F  +   +P  +      I  KE C +  V G+  +   +  +LSY+NL  CL++
Sbjct: 71  FFKTLFAQLEGAAPMKREFGWGDIKAKE-CDMGDV-GFDSNGRDE--RLSYDNLAKCLQL 126

Query: 159 SDDEYTNLQSNHASFIEEMDKL-TLPNDIYQ----GDGIVLVAGGKFSLLSYLVVKTIRK 213
            +  Y +L++ H  F++ +  + T  + + Q      GIV V G ++SLLSYL++  +R+
Sbjct: 127 PESNYNSLKNGHEKFVKYLSTVDTSASQLEQIYATKRGIVTVGGRRYSLLSYLMINMVRR 186

Query: 214 FGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAKCVYISDILPESMISHFDFKGYQFKSLA 273
            G+ LP+EV IPPD+ E E EFC+++L +F+A+C+Y  D LP S++++   K YQ K +A
Sbjct: 187 SGSKLPIEVVIPPDD-EPETEFCESIL-QFNARCIYFKDRLPTSLLANLSVKSYQVKGIA 244

Query: 274 IIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPDFWRRTTQPMFYEIAGISVN 333
           ++ SSF+  +L+D+DN P+KN+D +F    +   G+++WPD WRR T P FY++A + ++
Sbjct: 245 LLLSSFQEFVLIDSDNMPLKNIDEVFDYNVFRDHGMVIWPDIWRRMTSPQFYQLAEVPID 304

Query: 334 LQKRVRNAIDNLTPVQVYDK-----SDQEMDVPYHDFEGAMPDVSTESGELMVNKVEHLK 388
             KRVRNA D L+PV  YDK     S+ +  VP HDF G +PD +TESG+++VNK  HLK
Sbjct: 305 FTKRVRNAGDELSPVSRYDKLENTVSENKAKVPMHDFLGTLPDPTTESGQMIVNKKTHLK 364

Query: 389 TVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGATFYNLPFYQVKTKVGVDGY---- 444
            +LLALYYN  GP +YY +FSQG +G+GDKETF   A     PFYQVK   G   Y    
Sbjct: 365 MLLLALYYNQYGPEYYYQLFSQGTSGQGDKETFAMAAHILKEPFYQVKKTFGFAAYMDPR 424

Query: 445 HKEDGFRGVAMLQHDFVQDYDRYKLAQLKIDKKYLPSNEVLYDKDYTVQK-FYDEYFNIE 503
             +  F+G  +LQHD  QDY  + + + +I+ +        +D+DY ++K FYD+     
Sbjct: 425 EGKSEFQGAGLLQHDPEQDYRYWNILKTEIEGQ--QEKYGTFDEDYHIKKTFYDKMLGKV 482

Query: 504 GNE 506
           G++
Sbjct: 483 GDQ 485

>AEL148W [2358] [Homologous to ScYJL186W (MNN5) - SH]
           complement(351089..352810) [1722 bp, 573 aa]
          Length = 573

 Score =  306 bits (783), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 150/367 (40%), Positives = 234/367 (63%), Gaps = 22/367 (5%)

Query: 148 SYENLGNCLEISDDEYTNLQSNHASFIEEMD-------KLTLPNDIYQ-GDGIVLVAGGK 199
           SY+ L  C  +  D    L+  H+ F+  +        K  L   +Y    GIV V GG+
Sbjct: 101 SYDGLAKCFRLERDHLEGLRQGHSEFLRTIHGELAISAKSALFKTLYPLPAGIVTVGGGR 160

Query: 200 FSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAKCVYISDILPESMI 259
           +S+L+ ++++ +RK GTTLPVEVF+  D+ ++EA FC + +  F+AKCV  SD LP+S++
Sbjct: 161 YSILAMVMIRALRKRGTTLPVEVFLTDDDADDEA-FC-SYIEHFNAKCVLFSDRLPKSVL 218

Query: 260 SHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPDFWRRT 319
           +     G++ K++A++ SS++ ++ +DADN P+K LD++F+ +P    GL+LWPD W+R 
Sbjct: 219 ASQKLSGFELKAVALLLSSYQQVIFIDADNVPLKPLDDVFKSKPLAEYGLVLWPDIWKRV 278

Query: 320 TQPMFYEIAGISVNLQKRVRNAIDNLTPVQVY------DKSDQEMDVPYHDFEGAMPDVS 373
           T P FY+IAGI V+ ++RVR + D+++P   Y      D+S     VP HDF G MP++S
Sbjct: 279 TAPAFYDIAGIPVDFKRRVRFSADDVSPPSRYTKPGEVDESFNRAHVPLHDFAGTMPELS 338

Query: 374 TESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGATFYNLPFY 433
           +ESG+L+++K  H+ T+LL LYYNV+G + +Y + +QG +GEGDKETF   A     P+Y
Sbjct: 339 SESGQLLIDKARHMDTLLLILYYNVHGKHLFYRLSTQGTSGEGDKETFAMAAQALGKPYY 398

Query: 434 QVKTKVGVDGYHKEDGFRGVAMLQHDFVQDYDRYKLAQLKIDKKYLPSNEVLYDKDYTVQ 493
           QVKTK+   GYH    + G A+LQHDFVQD++++  A+ ++ ++  PS    Y+  Y V 
Sbjct: 399 QVKTKLRFQGYHTPSQYVGAALLQHDFVQDHEQWLRAREEVARR--PSELAAYNPAYNV- 455

Query: 494 KFYDEYF 500
              DE+F
Sbjct: 456 ---DEHF 459

>Sklu_2306.4 , Contig c2306 6263-8488 reverse complement
          Length = 741

 Score =  296 bits (759), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 176/431 (40%), Positives = 260/431 (60%), Gaps = 48/431 (11%)

Query: 86  IEQENSS--SYND-NNIKSFFDTVFQHILDYSPTGKSERIYNKEKCLLNSVVGYSPDNYK 142
           +E +NS   ++ND  N+K+F+ ++ + I DYSP G  +R    + C +  +      N K
Sbjct: 145 LEDDNSKEETHNDAQNLKAFYTSILKEIKDYSPEGTLDRTKGSD-CKIGDI---GATNIK 200

Query: 143 DWYKLSYENLGNCLEISDDEYTNLQSNHASFIEEMDKLTLP--NDI---YQGDGIVLVAG 197
           D+ KLS   L  C++I  D    L+  H  F E +    LP  N I   Y+G+GIV+V G
Sbjct: 201 DFGKLSESELSKCIQIPKDTSDMLKDLHTRFYETVKTKILPSFNSIEAPYKGEGIVIVGG 260

Query: 198 GKFSLLSYLVVKTIR-----KFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFD----AKCV 248
           GKFSL+    +K IR     +  +++PVE+ IPP + +E+ EFCK +L + D     +CV
Sbjct: 261 GKFSLIGLPAIKAIRVNSGHRLQSSIPVEIMIPPSD-DEDVEFCKNVLPKVDPTGLTRCV 319

Query: 249 YISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTG 308
           + SDI  E ++   D KGYQ K+LA++ SSF  +L+LDADN+ V +++N F    +   G
Sbjct: 320 FFSDIFEEEILK--DIKGYQLKALALLVSSFRKVLMLDADNYVVNSIENFFDSPVFNEKG 377

Query: 309 LILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEMDVPYHDFEGA 368
           L+LWPDFWRR   P FYEI GI VN  + +R +IDN+TP +VY  +D +  +P+HD   +
Sbjct: 378 LVLWPDFWRRLHHPKFYEIIGIDVNRNESIRYSIDNVTPPEVYRDNDDD-SIPFHDLANS 436

Query: 369 MPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGATFY 428
           +PD+STESG+L+V+K +HL T+LL+ YYN NGP++YYP+  QG AGEGDK+TFIA A   
Sbjct: 437 IPDISTESGQLLVDKQKHLDTLLLSCYYNYNGPSFYYPLLGQGYAGEGDKDTFIAAAHVT 496

Query: 429 NL----PFYQVKTKVGVDGYH-------------------KEDGFRGVAMLQHDFVQDYD 465
           +      ++Q++T V V G+                    K   +RGVAMLQ ++++D++
Sbjct: 497 HPSESGSYHQIQTPVRVQGHWCDEFEISIDDNPDDIIAEVKNKKYRGVAMLQSNYIEDHE 556

Query: 466 RYKLAQLKIDK 476
           R K AQ  I K
Sbjct: 557 RLKEAQSAIPK 567

>CAGL0M02871g 324009..325811 similar to sp|P46982 Saccharomyces
           cerevisiae YJL186w MNN5 or sp|P38069 Saccharomyces
           cerevisiae YBR015c TTP1, hypothetical start
          Length = 600

 Score =  281 bits (719), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 154/371 (41%), Positives = 225/371 (60%), Gaps = 44/371 (11%)

Query: 148 SYENLGNCLEISDDEYTNLQSNHASFIEEMDKLTLPND-----IYQGD---------GIV 193
           S +NL  CL + D     L   H+ +++     TL ND     I + D         GIV
Sbjct: 114 SAKNLKACLNLDDYAIKTLSEAHSRYMK-----TLFNDKGEFAISKSDFKKLYPNEKGIV 168

Query: 194 LVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAKCVYISDI 253
            + GG++++L+ L+++T+R+ G+TLPVEV  PP++ E E +FC   L + + +CV +S  
Sbjct: 169 TLGGGRYTILAMLMIETVRRHGSTLPVEVMFPPED-EGEFDFCNNWLPKHNGRCVMMSQE 227

Query: 254 LPESMIS---HFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLI 310
           +P  ++       FK YQ KSLA++ +SF+  + +DADN  +KN+D+IF  E + T GLI
Sbjct: 228 VPFEILQKDKEVRFKSYQIKSLALLLTSFKQFVFIDADNNAMKNIDHIFDTEAFKTHGLI 287

Query: 311 LWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYD-----------KSDQEM- 358
           LWPD W+R T P FY+IAG+  +L KRVRN  D+ +P + YD           K  +E+ 
Sbjct: 288 LWPDLWKRFTNPGFYDIAGVKYDLGKRVRNVNDDASPPETYDPNHSIYTTHDLKQREEIA 347

Query: 359 -----DVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLA 413
                DV   D +G + D +TESG++MV+  +HL T+LLALYYN+ GP+ YY + S G A
Sbjct: 348 KHLYEDVSLADLDGTIADTTTESGQMMVDNKKHLSTLLLALYYNIYGPDLYYYMMSMGTA 407

Query: 414 GEGDKETFIAGATFYNLPFYQVKTKVGVDGYHK--EDGFRGVAMLQHDFVQDYDRYK--L 469
           GEGDKETFI+ A   +LP+YQVKT +G DGY    ++ F+GV ++Q DF QDY R+K  L
Sbjct: 408 GEGDKETFISAAHVLHLPYYQVKTNIGFDGYVNDVDNQFKGVGLMQTDFEQDYQRHKQVL 467

Query: 470 AQLKIDKKYLP 480
            +L  +K   P
Sbjct: 468 KELATEKPLEP 478

>KLLA0F24574g complement(2285387..2287522) weakly similar to
           sp|P38069 Saccharomyces cerevisiae YBR015c TTP1 type II
           membrane protein, start by similarity
          Length = 711

 Score =  251 bits (640), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 147/404 (36%), Positives = 231/404 (57%), Gaps = 44/404 (10%)

Query: 97  NNIKSFFDTVFQHILDYSPTGKSERIYNKEKCLLNSVVGYSPDNYKDWYKLSYENLGNCL 156
           +++K F+  +   + + +  GK E +   E C L S  G    + +    L+ +NL  CL
Sbjct: 113 SDLKDFYQEIMTTLKETALKGKLE-VKKPEGCKL-SDTGVENTDSEKLSTLTKDNLLKCL 170

Query: 157 EISDDEYTNLQSNHASFIEEMDKLTLPN---------DIYQGDGIVLVAGGKFSLLSYLV 207
            ISD++   ++  H +F + +    +PN          +Y+G+GI +V GGK++L++  V
Sbjct: 171 PISDEDVKEVKEAHNNFKKLLQDKLMPNFKKLNTEKDPVYKGEGISIVGGGKYTLMALPV 230

Query: 208 VKTIR-----KFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFD----AKCVYISDILPESM 258
           +K+IR        +++P+E+ IPP +   + + C+ ++   D     KCVY+S+     +
Sbjct: 231 IKSIRMNSGLTLKSSVPIEIVIPPSD-NADRKVCENIIPTIDPSGLTKCVYLSEFFDSEI 289

Query: 259 ISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPDFWRR 318
           +   D  GYQ KSL+++ SSFE +LLLDADN+ + +L N F  + +  TGLILWPD+WRR
Sbjct: 290 LK--DITGYQLKSLSLLISSFEKVLLLDADNYVINSLGNFFDGDIFRETGLILWPDYWRR 347

Query: 319 TTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEMDVPYHDFEGAMPDVSTESGE 378
              P  Y+I  I V   K  R + D +T  +++ +SD    +P+HD EGA+PD STESG+
Sbjct: 348 VHSPKLYDIVDIKVQ-DKLARYSTDYITNSRLFPESDP-AKIPFHDLEGAIPDGSTESGQ 405

Query: 379 LMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGATFYNLPFYQVKTK 438
           L+VNK  HL  ++L+LYYN NGP++YY +  QG++GEGDK+TFI  AT     +YQV+T 
Sbjct: 406 LLVNKASHLDALILSLYYNYNGPSYYYRLLGQGISGEGDKDTFILAATVLKHRYYQVRTP 465

Query: 439 VGVDGY-------------------HKEDGFRGVAMLQHDFVQD 463
           V   GY                     E  +RG+AM+QHD+ +D
Sbjct: 466 VRPQGYWGKIENEVRIQDDLVDDTPSNEKKYRGIAMIQHDYNED 509

>Kwal_56.22779
          Length = 695

 Score =  220 bits (561), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 154/424 (36%), Positives = 227/424 (53%), Gaps = 47/424 (11%)

Query: 85  DIEQENSSSYNDNNIKSFFDTVFQHILDYSPTGKSERIYNKEKCLLNSVVGYSPDNYKDW 144
           D E E       N  +  F+   + +  YSP GK +     + C +  +      +   +
Sbjct: 89  DAESEGLGVAISNETRKAFNDALELVKKYSPDGKLDTT-KGDDCEIGDI---RITDTSQF 144

Query: 145 YKLSYENLGNCLEISDDEYTNLQSNHASFIEEMDKLTLPN-DIYQGDG--------IVLV 195
           +KL+ E+L  CL + D+    L   H  F   + K  LP+ D+ +  G        IV+V
Sbjct: 145 HKLTKESLEKCLNVPDETVKKLNKLHEDFKGAIRKSILPSFDVLEAQGNPAFKGDGIVIV 204

Query: 196 AGGKFSLLSYLVVKTIR-----KFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFD----AK 246
            GG+FS+ +   +K IR     K   T+P+E+ IPP +  +   FC+ +L + D     K
Sbjct: 205 GGGRFSVFALPAIKAIRENSGVKTKNTIPIEIIIPPHDKGDRG-FCENVLPKVDPSGLTK 263

Query: 247 CVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTT 306
           CV++ +IL    +SH +  GYQ K++A+  S FE +L+LDADN+ V +LD  F  +    
Sbjct: 264 CVFLDEILSPETLSHIE--GYQIKAVALFVSQFERVLMLDADNYVVNSLDEYFTHQKLKE 321

Query: 307 TGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEMDVPYHDFE 366
            GLILWPD+WRR   P  Y+I  + V+  K  R +IDN TP  VY K  +E   P+HDF 
Sbjct: 322 KGLILWPDYWRRLHHPKTYDIVNLGVS-TKSQRYSIDNATPDFVYKKDAKE--TPFHDFF 378

Query: 367 GAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGAT 426
            A+PD STESG+++++K +HL ++L+ LYYN NG +++YP+  QG AGEGDK+TF  G  
Sbjct: 379 DALPDGSTESGQVLIDKKKHLDSLLMTLYYNFNGKSYFYPLLGQGFAGEGDKDTFALGCR 438

Query: 427 FYNLP--FYQVKTKVGVDGYHKE---------------DG--FRGVAMLQHDFVQDYDRY 467
             + P  +YQVKT V   G+  +               DG  FRG AM+QHDF  D    
Sbjct: 439 VMHGPEAYYQVKTPVDTLGHWADKDEIRIPDEDLEKSIDGKQFRGTAMIQHDFTDDVRFS 498

Query: 468 KLAQ 471
            LA+
Sbjct: 499 SLAR 502

>CAGL0L08096g complement(884830..886524) some similarities with
           sp|P46982 Saccharomyces cerevisiae YJL186w or sp|P38069
           Saccharomyces cerevisiae YBR015c, hypothetical start
          Length = 564

 Score =  202 bits (513), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 123/429 (28%), Positives = 212/429 (49%), Gaps = 22/429 (5%)

Query: 96  DNNIKSFFDTVFQHILDY---SPTGKSERIYNKEKCLLNSVVGYSPDNYKDWYKLSYENL 152
           D  ++ F+  +F+ I  Y   +P  K +++  K+KC L + +     +     +LSY  L
Sbjct: 50  DAAVEQFYLDLFRSINQYRPMNPPAKKQKLVFKDKCTLVAPISVEETSDDTLKQLSYMTL 109

Query: 153 GNCLEISDDEYTNLQSNHASFIEEMDKLTLPNDIYQGD-------GIVLVAGGKFSLLSY 205
             C  +S  +  NL++ H  +   ++ L    D Y  D       GIV + G + +L   
Sbjct: 110 DYCFHLSPTQTNNLKTAHNGYCRRVETLFGSLDEYLRDSLMPRYKGIVTLGGNERTLSLL 169

Query: 206 LVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAKCVYISDILPESMISHFDFK 265
             +  +RK G+TLP+EV  PP  V  E +FC   L  ++ KC+Y+S  LPE ++    F 
Sbjct: 170 ASIPRLRKMGSTLPIEVIFPP-YVSNEDKFCDDFLPRYNGKCIYMSKALPEYVLKAHKFD 228

Query: 266 GYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPDFWRRTTQPMFY 325
               +    + S+F+++L +++++F   N+D  F  + +T TGL+LWP   RR+T P FY
Sbjct: 229 EKMIRMFTPLVSTFKSILYMESNDFANTNVDKAFDSKSFTDTGLVLWPGRSRRSTSPAFY 288

Query: 326 EIAGISVNLQKRVRNAIDNLTPVQVYDKSDQE-------MDVPYHDFEGAMPDVSTESGE 378
           +I    ++L  R RN  D+++    Y     E          P HD +GA+PD  T  G 
Sbjct: 289 QIVNRKIDLNNRTRNLADDVSRPTRYTSQALENIQFNLLAHTPMHDLDGAIPDAVTHVGH 348

Query: 379 LMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGATFYNLPFYQVK-T 437
            M++K +H KT++LA+YY V+G  W+  +F+      G +E  +A A    L +YQV   
Sbjct: 349 YMIDKQKHFKTLMLAMYYAVHGEMWFDMMFAPEKGSSGYRENIVAAAHALELSYYQVHLI 408

Query: 438 KVGVDGYHKEDGFRGVAMLQHDFVQDYDRYKLAQLKIDKKYLPSNEVLYDKDYTVQKFYD 497
              + G  K+    G   +  D   DY +++    K+  K +  +   +D+ YT  + ++
Sbjct: 409 PRSMRGGSKDTLQSGETFMHFDPDFDYRKHQALADKVKSKLIDVHS--FDRKYTAIRTFE 466

Query: 498 EYFNIEGNE 506
           +   + GN+
Sbjct: 467 KDL-LAGNQ 474

>AEL082W [2424] [Homologous to ScYBR015C - NSH]
           complement(474072..476117) [2046 bp, 681 aa]
          Length = 681

 Score =  191 bits (486), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 113/368 (30%), Positives = 197/368 (53%), Gaps = 32/368 (8%)

Query: 100 KSFFDTVFQHILDYSPTGKSERIYNKEKCLLNSVVGYSPDNYKDWYKLSYENLGNCLEIS 159
           ++F + + + +  Y P G + ++  +  CLL  V      + + +  L+   L  C+++S
Sbjct: 89  RTFVEEILRTVQAYPP-GAALQV--QADCLLERVRA---TDERKFGSLTASKLQGCVDLS 142

Query: 160 DDEYTNLQSNHASFIEEMDKLTLPNDI-------YQGDGIVLVAGGKFSLLSYLVVKTIR 212
            D + + +  HA  ++ + K +LP  +       Y  DGIV++ GG  ++ +   +++IR
Sbjct: 143 GDAFAHAKEQHALMMKVIQK-SLPEHLSDLDHYPYISDGIVILGGGHKTIAAIPAIRSIR 201

Query: 213 K-----FGTTLPVEVFIPPDEVEEEAEFCKTMLNEFD----AKCVYISDILPESMISHFD 263
           +        ++P+EV IP    +EE  FC  +L   D     +CV++ D +  S++S   
Sbjct: 202 ENSGITVRNSMPIEVVIP-GPADEEKVFCSKILPVLDPSGLTRCVHLGDTISSSLLS--K 258

Query: 264 FKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPDFWRRTTQPM 323
            K    ++LA++ASSF  +L LD+    +  +D  F  E +   GL+LWPD+WRR   P 
Sbjct: 259 VKPSDHRTLALLASSFSRVLYLDSSVQVINAIDGYFHHELFNERGLVLWPDYWRRLHHPK 318

Query: 324 FYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEMDVPYHDFEGAMPDVSTESGELMVNK 383
            YE+AG  V+  +R R +ID  +P+++Y   D E   P HD + ++PD S+ SG L+++K
Sbjct: 319 LYELAGSKVDTGRRERYSIDKGSPIELYGGKDGEW--PMHDCKDSIPDASSSSGVLLIDK 376

Query: 384 VEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGATFYNL---PFY-QVKTKV 439
            +H KT+ LALYYNV+G  ++YP+       E +K+T +  A   +    P Y QV T  
Sbjct: 377 KKHFKTLALALYYNVHGEPFFYPLLDPKAPREAEKDTIVFAAHVLSRGGGPLYHQVTTPK 436

Query: 440 GVDGYHKE 447
             +G+ K+
Sbjct: 437 RSEGHRKD 444

>CAGL0C04004g complement(394614..396512) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 632

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 107/253 (42%), Gaps = 34/253 (13%)

Query: 189 GDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDA--- 245
           G GI +            + + +++ G T P++V      +++  E    ++ +      
Sbjct: 246 GKGIAITVNPDDVEFMIRLFRVLKELGNTYPIQV------IQKGGELTSPLIEQIKKTAI 299

Query: 246 ---KCVYISDILP--ESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQ 300
              + V I D+ P  +   +      +  K  A + ++FE +LLLDAD  P  +LD  F 
Sbjct: 300 ETNQAVSIVDLSPILDEKFAREQITSFHNKFFAAMFNTFEEVLLLDADVVPYVSLDEFFN 359

Query: 301 QEPYTTTGLILWPDFWRRTTQPMFYEIAGISVN--------LQKRVRNAIDNLTPVQVYD 352
            + Y  TGL  W D  R +    F    G+ +         L   ++  I++L   +V  
Sbjct: 360 LKGYKDTGLQFWRDRNRGSDTHKFCSNLGVYLEPSLEEHNLLGTELKFRINSLAKKKV-- 417

Query: 353 KSDQEMDVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGL 412
           +S +E    +H F   +   + +SG +++NK + L ++++   +  NG          G 
Sbjct: 418 RSSEER--AFHRFFNELKVHNIDSGIIVLNKKQKLHSLIMGEIFYTNG--------RFGR 467

Query: 413 AGEGDKETFIAGA 425
              GDKE F+ GA
Sbjct: 468 CAYGDKEMFMMGA 480

>Scas_717.5
          Length = 639

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 114/269 (42%), Gaps = 27/269 (10%)

Query: 188 QGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIP-----PDEVEEEAEFCKTMLNE 242
            G GIVL  G +   +    ++ +   G  LP+++        P+ +++  +F KT   E
Sbjct: 240 HGKGIVLTMGERDVDMFKKQLRVLDHLGNKLPIQLVTAGSEYSPEFLKDLTDFLKTTNQE 299

Query: 243 FDAKCVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQE 302
                V  S IL    +S +    +  K +AI+ ++FE L+L+DAD  P   L + F+ E
Sbjct: 300 --VYLVEASPILDPEFVSKYIVFFFH-KWIAILLNTFEELVLIDADVVPFVPLKSFFKSE 356

Query: 303 PYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEMDVPY 362
            Y TTGL+L+ D  R       +     S+   +  R   + +    + D S +E+  P 
Sbjct: 357 GYKTTGLLLFKD--RNMKGEHTFTYCMESLKYMEPSRQETEYIQTNLLID-STKELPSPT 413

Query: 363 HDFEGAM-----PDVS---TESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAG 414
              E A+      D+     +SG + VNK E +  +L++   ++NG              
Sbjct: 414 SSEEAAVYNHFFKDLRLHHVDSGLVTVNKNEKMNGLLMSFMLHLNG--------KIQRCV 465

Query: 415 EGDKETFIAGATFYNLPFYQVKTKVGVDG 443
            GDKE F  G  F    +       GV G
Sbjct: 466 YGDKEFFWLGQLFAGQDYSIHPMDAGVAG 494

>CAGL0C03960g complement(389250..391121) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 623

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 121/276 (43%), Gaps = 34/276 (12%)

Query: 188 QGDGIVL-VAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAK 246
           +G GI L VA     LL  L  K + K G   PVEV     E+  + E       E   +
Sbjct: 233 RGRGITLTVAPDDIKLLRSLF-KVLEKLGNEYPVEVVHKGGEMTPKMEDLIRQYAEETNQ 291

Query: 247 CVYISDILP--ESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPY 304
            VY+ ++ P  +   +  + K +  K LA + ++FE ++LLDAD     + D+ F+ + Y
Sbjct: 292 EVYVINLSPILDPDFAEENIKRFSNKWLAAMFNTFEEVMLLDADVVLYNHPDHFFELKGY 351

Query: 305 TTTGLILWPD--------FWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQ 356
             TGL+LW D        + + T    F+E +     L    +        ++ +++S+ 
Sbjct: 352 QDTGLMLWKDREITDTDVYDKCTAMAPFFEPSLEEHKLLGTTQKYRLTGPSLEAHNESEA 411

Query: 357 EMDVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAG-- 414
              + Y  F     +V  +SG ++ NK + L  ++L+ YY++N          +   G  
Sbjct: 412 TTLIDY--FRKKRLNV-IDSGVVIFNKKQKLHALVLSNYYHIN----------RKFLGCV 458

Query: 415 EGDKETF-----IAGATFYNLPFYQVKTKVGVDGYH 445
            GDKE F      AG  ++  P  Q    +G  G+H
Sbjct: 459 HGDKEFFEFGVLAAGEDYHIAP--QRAAALGPIGFH 492

>CAGL0C04048g complement(399734..401596) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 620

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 114/286 (39%), Gaps = 50/286 (17%)

Query: 188 QGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAKC 247
           +G GIVL        L     +  ++ G  LP++V     E+  E E     + E+  + 
Sbjct: 231 RGKGIVLTVSQSDVPLLRQQFRVWKELGNKLPIQVVHKGTEINAELE---QKIKEYAIEM 287

Query: 248 ---VYISDILP-------ESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDN 297
              VY+ D+ P       E+ I +F  K Y     A I ++FE L+L+DAD  P    ++
Sbjct: 288 EQDVYVVDLSPVIDPDFAENSIQNFHNKWY-----AAIFNTFEELILIDADAIPYVPAED 342

Query: 298 IFQQEPYTTTGLILWPD---FWRRTT----------QPMFYEIAGISVNLQKRVRNAIDN 344
             + + Y  TGL LW D      RT           +P   E   I   L  R       
Sbjct: 343 FLKSKSYKKTGLRLWRDRDITHERTLHFCVEMAPYFEPTLEEHNLIGTTLSYR------- 395

Query: 345 LTPVQVYDKSDQEMDVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWY 404
           LT   + D  D E    Y  F+  M     +SG ++++K + + +++++   + +     
Sbjct: 396 LTDSGLKDAKDSEGRALYEFFQ-KMYLHHVDSGLVVIDKKDKIHSLIMSEILHSHT---- 450

Query: 405 YPIFSQGLAGEGDKETFIAGATFYNLPF---YQVKTKVGVDGYHKE 447
                 G    GDKE F+ GA      +    Q    +G  GY KE
Sbjct: 451 ----RFGRCTYGDKELFMLGAYMVGESYTLEAQSAAIIGTVGYEKE 492

>CAGL0C03916g complement(383989..385875) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 628

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 116/276 (42%), Gaps = 34/276 (12%)

Query: 188 QGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAKC 247
           +G GI L A  K   L   + K   K G T P+++     E+    E   +++ ++  + 
Sbjct: 237 KGRGIALTAAPKDVKLLRSLFKVFEKLGNTYPIQIVQKGGEMSPTME---SLIKDYAIET 293

Query: 248 ---VYISDILP--ESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQE 302
              V+I D+ P  +   +    + +Q K  A I ++FE ++L+DAD       ++ F  +
Sbjct: 294 NQNVFIVDLSPVLDPDFATDHIRKFQNKWFASIFNTFEEVMLIDADVVIYTEPESFFNLD 353

Query: 303 PYTTTGLILWPD--------FWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKS 354
            Y  TGL+LW D          R T    ++E A     L   V+        ++ +D+ 
Sbjct: 354 GYKNTGLLLWRDREIVDAKTHERCTDMAPYFEPALEEHRLLGTVQKYRLTGPSLETHDEP 413

Query: 355 DQEMDVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAG 414
           + E      DF         +SG ++ NK + L  ++LA Y++           S+  AG
Sbjct: 414 EAET---LFDFFHRRIVTIIDSGVVIYNKKQKLHGLILAEYFHN----------SKQFAG 460

Query: 415 --EGDKETFIAGATFYNLPFY---QVKTKVGVDGYH 445
              GDKE F  GA      ++   +    +G  GYH
Sbjct: 461 CVYGDKEYFEFGALVAGEDYHVEAEKAVAIGAVGYH 496

>CAGL0C03938g complement(386673..388586) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 637

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 121/288 (42%), Gaps = 30/288 (10%)

Query: 188 QGDGIVL-VAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAK 246
           +G GI L VA     LL  L  K + K G   PVEV     E+  + E       E   +
Sbjct: 246 RGRGITLTVAPDDIKLLRSLF-KVLEKLGNEYPVEVVHKGGEMTPKMEDLIRQYAEETNQ 304

Query: 247 CVYISDILP--ESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPY 304
            VY+ ++ P  +   +  + K ++ K  A + ++FE  +LLD D     + +  F+ + Y
Sbjct: 305 EVYVINLSPILDPDFASQNIKSFKNKWFAAMFNTFEEAILLDVDVVLYASPEYFFELDGY 364

Query: 305 TTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEMD----- 359
             TGL+LW D  R  T+    +         +      + L  +Q Y  +  +++     
Sbjct: 365 KKTGLMLWKD--REYTEVETSDRCASMAPYFEPSEEEHELLGTIQKYRLTGPDLETHNES 422

Query: 360 --VPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGD 417
                +DF         +SG +++NK + L  +LLA YY+++    Y+     G    GD
Sbjct: 423 EATTLNDFFNNKLATIIDSGVVLINKKQKLNALLLAAYYHMSK---YF-----GGCTYGD 474

Query: 418 KETF-----IAGATFYNLPFYQVKTKVGVDGYH--KEDGFRGVAMLQH 458
           KE F      AG  +Y  P       +G  GYH  +E  +   A + H
Sbjct: 475 KELFEIAALAAGEDYYVDP--NKAGAIGPIGYHPPREKYYVCSAQMGH 520

>AEL345W [2160] [Homologous to ScYIL014W (MNT3) - NSH]
           complement(1961..3898) [1938 bp, 645 aa]
          Length = 645

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 67/131 (51%), Gaps = 7/131 (5%)

Query: 188 QGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVF----IPPDEVEEEAEFCKTMLNEF 243
           +G GI + AG +   +   ++  +   G TLP+E+     +PP  +++ A++ +   N+ 
Sbjct: 243 KGRGITITAGAEHVEMLPRLLNVLDHIGNTLPIELINAADLPPTTIDKIAKYVQMKSNQ- 301

Query: 244 DAKCVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEP 303
             + V     L  S  S     G++ K LA I ++FE  + +D D  P  +L+ +F+ E 
Sbjct: 302 TVRLVDCGKTLEHSYRSLI--TGFRHKWLAYIFNTFEEAVFIDLDAVPFVDLEKLFEVEG 359

Query: 304 YTTTGLILWPD 314
           Y + G++++ D
Sbjct: 360 YKSEGILMFRD 370

>CAGL0C03982g complement(391909..393798) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 629

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 111/253 (43%), Gaps = 31/253 (12%)

Query: 188 QGDGIVL-VAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAK 246
           +G GI L +A G   LL  L  K +++ G   PV++     E+  + E   +++ ++  +
Sbjct: 237 KGKGITLTIAPGDIKLLRSLF-KVLQRQGNEYPVQIIQKGGEMTPKME---SLIKKYALE 292

Query: 247 C---VYISDILP--ESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQ 301
               VYI D+ P  +   +      +Q K  A + ++FE  LLLDAD       ++ F+ 
Sbjct: 293 TEQDVYIIDLAPILDPAFAIQRITKFQNKWFASMFNTFEEALLLDADVVLYTEPEHFFKM 352

Query: 302 EPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVR-------NAIDNLTPVQVYDKS 354
           + Y  TGL+LW D    T        A ++ +L+  V             LT   +   +
Sbjct: 353 KGYQDTGLLLWRDR-ELTALETPDRCAALAPHLEPSVEEYSLLGTRQKYRLTESSLKIHN 411

Query: 355 DQEMDVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAG 414
           + E    Y  F   +  +  +SG ++ NK + L  ++ A Y+++          S+  AG
Sbjct: 412 EPEARTLYEYFHKKIVTI-IDSGVVVYNKRQKLHALMTAEYFHI----------SRKFAG 460

Query: 415 --EGDKETFIAGA 425
              GDKE F  GA
Sbjct: 461 CVYGDKEYFEFGA 473

>Kwal_55.20984
          Length = 619

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 112/261 (42%), Gaps = 34/261 (13%)

Query: 184 NDIYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEE-----AEFCKT 238
           N   +G G+V   G +       ++K + +   +LP+++   P E+ +       EF ++
Sbjct: 217 NSFSKGKGLVFSLGERHLDPFLRLLKILDQQNNSLPIQIVQQPHELSDAFLGNLTEFLQS 276

Query: 239 MLNE-FDAKCVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDN 297
              E +   C  + D   ++ +++F       K LA I ++F  ++L+DAD  P   +++
Sbjct: 277 SHQEVYYIDCEALLDTTYKAYMTYF-----VNKWLASIFNTFSEVVLMDADVVPFVPVES 331

Query: 298 IFQQEPYTTTGLILWPDFWRRTTQPMFYEIAGISVNL-----QKRVRNAIDNLTPVQVYD 352
            FQ+E Y  TG++L+ D  R   Q   ++    +  L     Q+ V       T   V D
Sbjct: 332 FFQEEQYKATGVLLYKD--RDMPQETTFDYCITTFKLLEPSSQEVVLMNHRMKTNSSVVD 389

Query: 353 KSDQ----EMDVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVN--GPNWYYP 406
                   E D  YH F       + +SG ++++K E L  +L++   N++    N  Y 
Sbjct: 390 PGAHIFANEKDKVYHRFFYNETLHNVDSGLVVLHKTERLSGLLISFIMNLDQKASNCIY- 448

Query: 407 IFSQGLAGEGDKETFIAGATF 427
                    GDKE F  G  F
Sbjct: 449 ---------GDKELFWLGQLF 460

>KLLA0E09790g 867899..870139 similar to sp|P39106 Saccharomyces
           cerevisiae YER001w MNN1 alpha-1, 3-mannosyltransferase,
           start by similarity
          Length = 746

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 108/250 (43%), Gaps = 28/250 (11%)

Query: 191 GIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVF----IPPDEVEEEAEFCK-TMLNEFDA 245
           GI+L AG         ++ T+R  G  LP+++     +    V+  +E  K T  +   A
Sbjct: 336 GIILAAGDGQVDQCIRLIATLRAQGNALPIQIIHNNQLNEKSVKLLSEAAKSTEFSSGRA 395

Query: 246 KCVYISDILP---ESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQE 302
           + +++ ++ P    SM S+F    ++ K L++I ++FE  + +D D     N+ + F  +
Sbjct: 396 QSLWLVNVGPTLESSMKSNFG--RFKNKWLSVIFNTFEEFIFIDTDAISYINMADYFNFK 453

Query: 303 PYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAID-NLTPVQVYDKSDQE---M 358
            Y +TG + + D  R        +   +   L+ R+      N  P+   D  +Q+   M
Sbjct: 454 EYKSTGTLFFKD--RSLAIGTEQKCGPLFETLEPRILEMYYFNTLPMINGDYVEQQCMGM 511

Query: 359 DVP----YHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAG 414
             P    Y  F       + ESG L +NK EH+  ++ A   N+  P         G  G
Sbjct: 512 LTPEEKVYKRFFEVGHQHNLESGLLAINKNEHIMGLVTATVLNI-APK-------VGGCG 563

Query: 415 EGDKETFIAG 424
            GDKE F  G
Sbjct: 564 WGDKEFFWLG 573

>Scas_643.19
          Length = 657

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/253 (20%), Positives = 105/253 (41%), Gaps = 26/253 (10%)

Query: 184 NDIYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEA-----EFCKT 238
           N++ +G GIV+        L   ++ T+++   TLP+++     + E+E       F +T
Sbjct: 244 NEVSKGKGIVINMKETEKDLFMSLIATLQEVKNTLPIQIITTGQDFEKETFESMNRFLQT 303

Query: 239 ---MLNEFDAKCVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNL 295
               ++  D   +  +D + E + SH        K    + ++FE +++LDAD+ P    
Sbjct: 304 TDQQVSLIDCSSILDADFVKEHIASHL------HKWFGTLFNTFEEVVILDADSVPFVAP 357

Query: 296 DNIFQQEPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSD 355
           +  F+ + Y   G   + D      +   Y I  I      +  + + N       +   
Sbjct: 358 ETFFKNKEYKDAGSFFFRDKTLGNERTYQYCIEMIEAMEPSKAESGLINTKLKFTSNNPP 417

Query: 356 QEMDVP----YHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQG 411
           ++   P    Y+ F G     + +SG +++ K E L ++L+    N++          Q 
Sbjct: 418 EDNSSPAASVYNTFFGKYKHKNLDSGVVVLKKKEKLTSLLMGFMMNLDAK------MKQC 471

Query: 412 LAGEGDKETFIAG 424
           ++GE  KE F  G
Sbjct: 472 VSGE--KELFWLG 482

>Kwal_23.2926
          Length = 568

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 108/276 (39%), Gaps = 20/276 (7%)

Query: 191 GIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEF-DAKCVY 249
           GIVL        L   ++K +      LP++V    D  E         L+   +   V 
Sbjct: 182 GIVLSFPDSHVSLVIRLLKVLHHQKNELPIQVIHKGDLSEASKNLISEALSPSQNLWFVD 241

Query: 250 ISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGL 309
           +S +L +  +   DF GY+ K LA+I ++F   + +DAD   + + ++ F+   Y  TG 
Sbjct: 242 VSSMLNKRFVR--DFSGYKNKWLAMILNTFSEAVFIDADAVSMMSFEDYFEMGLYNQTGA 299

Query: 310 ILWPD------FWRRTTQPMFYEI-AGISVNLQKRVRNAIDNLTPVQVYDKSDQEMDVPY 362
           + + D      F      PM   +  G       + R  + +L      D S ++  +  
Sbjct: 300 LFFKDRAFDHKFDYDFCVPMIKSLQPGKHETRYFQHRKRLIDLQLRNTQDPSTEQTIIK- 358

Query: 363 HDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFI 422
            DF         +SG +++ K +HL  +L A++ N+       P  S+     GDKETF 
Sbjct: 359 -DFFEGYQRHQMDSGLVLIEKGKHLTPLLAAVFLNLA------PKLSK--CTHGDKETFW 409

Query: 423 AGATFYNLPFYQVKTKVGVDGYHKEDGFRGVAMLQH 458
                 N  F     +    G   E+G      L H
Sbjct: 410 LAFLLMNHEFSFHPEEASAIGKADENGEICSVQLGH 445

>YIL014W (MNT3) [2651] chr9 (326101..327993) Mannosyltransferase
           that adds the final mannose to O-linked oligosaccharide
           chains [1893 bp, 630 aa]
          Length = 630

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 108/253 (42%), Gaps = 20/253 (7%)

Query: 184 NDIYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEF 243
           N + +G G VL    K   L    +K +      LP ++    +E+  E+    +   + 
Sbjct: 229 NRLSKGRGFVLTIAEKDVPLFLKQLKVMEFSKNELPFQIVSTGNELSAESIAKISETAKE 288

Query: 244 DAKCVYISDI--LPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQ 301
             + VY+ D   + ++  ++     +Q K +A + ++FE  +LLDAD  P    D  F  
Sbjct: 289 TEQRVYLVDCSTVLDTNFANTYISFFQNKWVATLFNTFEEYILLDADVVPFVGSDYFFDS 348

Query: 302 EPYTTTGLILWPDFWRRTTQPMFYEIA---GISVNLQKR----VRNAIDNLTPVQVYDKS 354
             Y  +G++L+ D      Q   Y I     +  + Q+R     R   D+  P     ++
Sbjct: 349 PSYRESGILLFKDRVMENEQTFQYCIEMLNEVEPSAQERRFIGSRLVFDSSLPFS--SET 406

Query: 355 DQEMDVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAG 414
            +E  V Y++F   +     +SG ++VNK+E L  +L++   N++G              
Sbjct: 407 SEEASV-YYNFFKKLRLHHVDSGLVVVNKLEKLNGLLMSFMLNLDG--------KLQRCV 457

Query: 415 EGDKETFIAGATF 427
            GDKE F  G  +
Sbjct: 458 YGDKEIFWLGQLY 470

>CAGL0H09240g complement(905670..907598) some similarities with
           sp|P40549 Saccharomyces cerevisiae YIL014w MNT3,
           hypothetical start
          Length = 642

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/251 (20%), Positives = 104/251 (41%), Gaps = 23/251 (9%)

Query: 186 IYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDA 245
           I  G GIVL A      +    +   ++ G   P++V     E+  + E       E   
Sbjct: 240 IASGRGIVLSAKPDDIDMLRQQLSVWKELGNKYPIQVVHKGGELTRDNEISLKQFAEETD 299

Query: 246 KCVYISDILP--ESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEP 303
           + +YI D  P  +   +      +  K + ++ ++FE  +++DAD  P  + ++ F+ E 
Sbjct: 300 QNIYIVDAGPVLDKNFADEHITKFHNKWVGVLFNTFEEYIMVDADTVPFISAEDFFESEN 359

Query: 304 YTTTGLILWPDFWRRTTQPMFYE-IAGISVNLQKRVRN--------AIDNLTPVQVYDKS 354
           +  +G+ +W D  R  T     E    +++ L+  +              L P    +K+
Sbjct: 360 FKKSGMRMWRD--RTLTNRHIREHCPDLALKLEPSLEEHRILGTTLRFKLLDPDLKQEKT 417

Query: 355 DQEMDVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAG 414
            +E    ++     +     +SG +++NK E L ++LL+ ++        + +F +    
Sbjct: 418 SEER--AFNQMRTNLALHHVDSGLVVINKKEKLHSLLLSEFFQ------NHALFRR--CS 467

Query: 415 EGDKETFIAGA 425
            GDKE F   A
Sbjct: 468 YGDKELFWYAA 478

>CAGL0C04026g complement(397303..399213) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 636

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 68/151 (45%), Gaps = 8/151 (5%)

Query: 185 DIYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFD 244
           ++ +G GI +    K   + + +   + + G  LP+++    D+ E      K ++  + 
Sbjct: 245 NMAKGKGIAVSVSPKEIRMLHSLFAVLNQQGNKLPIQII---DKGETLTLADKELIKSYA 301

Query: 245 AKC---VYISDILP--ESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIF 299
            K    V + D+ P  ++  +  +  G   K  A + ++FE +LLLD D  P    +  F
Sbjct: 302 VKTNQDVSVVDLSPIIDAEYADENIIGMHNKWFAAMFNTFEEVLLLDVDVIPFVGTEKFF 361

Query: 300 QQEPYTTTGLILWPDFWRRTTQPMFYEIAGI 330
           Q EPYT+  ++ W +   +   P +   A I
Sbjct: 362 QLEPYTSRHILFWRNRDIKKKNPKYCPEAAI 392

>YER001W (MNN1) [1423] chr5 (153519..155807)
           Alpha-1,3-mannosyltransferase, required for complex
           glycosylation of both N- and O-oligosaccharides [2289
           bp, 762 aa]
          Length = 762

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 100/271 (36%), Gaps = 56/271 (20%)

Query: 189 GDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEE----------AEFCKT 238
           G GIVL  G     L+   + ++R  G TLP++V    DE+ +E          +   K 
Sbjct: 317 GRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQELVDKLIYAARSPDFKP 376

Query: 239 MLNEFDAKCVYISDI--LPESMISH----FDFKGYQFKSLAIIASSFENLLLLDADNFPV 292
           + N +D       +I  L  S   H     DF  Y+ K L ++ +  +  + LD D    
Sbjct: 377 VENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLDIDAISY 436

Query: 293 KNLDNIFQQEPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYD 352
           + +DN F+   Y  TG +             FY    +  N+ +R     + L P  +  
Sbjct: 437 EKIDNYFKTTEYQKTGTV-------------FYRERALRENVNERCIARYETLLPRNLES 483

Query: 353 KSDQEMDV--PYHDFEGAMPDVST-----------------ESGELMVNKVEHLKTVLLA 393
           K+ Q   +  P H        ++T                 E+G   V+K +H   ++LA
Sbjct: 484 KNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIPLVLA 543

Query: 394 LYYNVNGPNWYYPIFSQGLAGEGDKETFIAG 424
              ++          +      GDKE F  G
Sbjct: 544 AMIHLAK--------NTAHCTHGDKENFWLG 566

>AFL235W [2960] [Homologous to ScYIL014W (MNT3) - NSH; ScYER001W
           (MNN1) - NSH] complement(2..1147) [1146 bp, 381 aa]
          Length = 381

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 100/246 (40%), Gaps = 52/246 (21%)

Query: 215 GTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAKCVYISD----ILPESMISHFDFKGYQFK 270
           G TLP+E+ +      E  +     L +   + + I D    + P      FDF+   +K
Sbjct: 9   GNTLPIELVLTESPSHERIQKIAHYLRDKTKQSLRIVDCKKILEPSYRPLIFDFR---YK 65

Query: 271 SLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPD---------------- 314
            LA + +S E ++ +D D  P  ++D  F+ E Y +TG++++ D                
Sbjct: 66  WLAYLLNSSEEVVFIDLDVVPFVSIDKFFEMEGYKSTGILMFQDRVFNSIKNSKCRTAIH 125

Query: 315 --FWRRTTQPMFYEIAGISVNLQK-RVRNAIDNLTPVQVYDKSDQEMDVPYHDFEGAMPD 371
                   Q ++   A  +    K R++N  D+     VYD+            EG    
Sbjct: 126 HILPSHAEQTLWKHQAKYTKEKAKHRLKNFPDDAGAASVYDRY----------LEGDRMH 175

Query: 372 VSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKE-----TFIAGAT 426
           +  ESG ++V+K + + +++++L  ++N     Y          GDKE       ++G  
Sbjct: 176 M-VESGLVVVDKRKKISSLIISLMLHMNIAECSY----------GDKEYLWLGQLVSGED 224

Query: 427 FYNLPF 432
           +Y  P 
Sbjct: 225 YYIHPL 230

>CAGL0C03894g complement(381514..383397) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 627

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 59/130 (45%), Gaps = 4/130 (3%)

Query: 188 QGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEA-EFCKTMLNEFDAK 246
           +G GIV+    + + +   ++  +      LP+++ I  ++      E  K    E   +
Sbjct: 221 RGRGIVVTFKEEEANMMMKLIAVLGHLKNRLPIQIVIQGNKFGSRTIEMLKEKAIE-KKQ 279

Query: 247 CVYISDILPESM--ISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPY 304
            +YI D     M   +    +GY  K +A I ++FE  +LLD D  P  N    F+++ Y
Sbjct: 280 QIYIVDATKLLMEKYAEVHIQGYTNKWIASIFNTFEEFILLDVDTVPFINPKKFFEKKGY 339

Query: 305 TTTGLILWPD 314
            TTG  ++ D
Sbjct: 340 RTTGFYMYQD 349

>CAGL0H09262g complement(908258..910135) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 625

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 105/266 (39%), Gaps = 57/266 (21%)

Query: 188 QGDGIVLVAG---GKFSLLSYLVVKTIRKFGTTLPVEVF-----IPPDEVEEEAEFCKTM 239
           +G GIV+ A     +F    + V K +   G T P++V      +PP+ + +  E+    
Sbjct: 234 KGRGIVVTASVNDCRFLRSQFFVWKEL---GNTYPIQVVTKGKEMPPELIAKIKEYATEA 290

Query: 240 LNEFDAKCVYISDI-------LPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPV 292
             E     VYI D+         E  I +F  K Y     A + ++FE  +L+DAD    
Sbjct: 291 DQE-----VYIVDLQNVLDPNYAEKYIENFHNKWY-----AAMFNTFEEAILVDADVVSY 340

Query: 293 KNLDNIFQQEPYTTTGLILWPD---------FWRRTTQPMFY----EIAGISVNLQKRVR 339
            + D  F+   +  TGL LW D          +     P F     E   +   L+ R  
Sbjct: 341 VHPDEYFESADFKKTGLKLWRDRDIPDIHVHIYCLNMAPYFLPSKEEHRTLGTTLKYR-- 398

Query: 340 NAIDNLTPVQVYDKSDQEMDVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVN 399
                L    + D    E D   H F         +SG ++ NK + L +++++ +++ +
Sbjct: 399 -----LEEESLKDAGTSEAD-GLHKFFFEKSGSIVDSGLVVFNKKKKLHSLIISEFFHTD 452

Query: 400 GPNWYYPIFSQGLAGEGDKETFIAGA 425
               + P         GDKE F+ GA
Sbjct: 453 AK--FKP------CTYGDKEIFMLGA 470

>AAR183C [371] [Homologous to ScYIL014W (MNT3) - NSH]
           (672091..674037) [1947 bp, 648 aa]
          Length = 648

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 59/129 (45%), Gaps = 4/129 (3%)

Query: 189 GDGIVL-VAGGKFSLLSYLVVKTIRKFGTTLPVE-VFIPPDEVEEEAEFCKTMLNEFDAK 246
           G GIV  VA      L  L+   + + G  LP+E V+   D      +  K  + +   +
Sbjct: 257 GRGIVATVADIHLDQLKRLL-HVLDELGNKLPIELVYKGNDFSRLPIKRLKRYVRQHTKQ 315

Query: 247 CVYISDILPESMISHF-DFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYT 305
            V + D       +H    K +  K LA I +SFE ++LLD D  P+  +D+ F+   YT
Sbjct: 316 RVRLVDCSRVLRSTHIPKIKRFMNKWLATIFNSFEEIILLDVDVVPLVPIDSYFKLPGYT 375

Query: 306 TTGLILWPD 314
            TG + + D
Sbjct: 376 KTGALFFKD 384

>YNR059W (MNT4) [4642] chr14 (736800..738542) Protein with strong
           similarity to mannosyltransferases Mnn1p, Mnt2p and
           Mnt3p [1743 bp, 580 aa]
          Length = 580

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 41/206 (19%), Positives = 89/206 (43%), Gaps = 22/206 (10%)

Query: 189 GDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNE-----F 243
             G+V+         +  +++ +R    +LP+E+    D  E   +       E     +
Sbjct: 197 SKGVVMSVSEYLVADTIRLIRVLRLLNNSLPIEIVHKSDLHESSQQLLIAAARESGSLNY 256

Query: 244 DAKCVY---ISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQ 300
             + ++   + D+L +  ++ F  K +  K LAI   SF+  + LD+D  P   LD +++
Sbjct: 257 PPQELWFLDVKDMLNDEYLARF--KRFSNKWLAITFCSFQIPIFLDSDTVPFVPLDTLYE 314

Query: 301 QEPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEMDV 360
            + +  TG + + D    T++     ++ + V + K++ N       + V   S+Q  ++
Sbjct: 315 IDGFKRTGTLFFKDRSFPTSK-----LSPLQVKVLKQIIN-----NSLDVSSDSEQGFEI 364

Query: 361 PYHDFEGAMPDVSTESGELMVNKVEH 386
             H+    M   + E+  L+  K +H
Sbjct: 365 LKHNLNDEMAIDAIEA--LIFKKQKH 388

>ABR245C [839] [Homologous to ScYIL014W (MNT3) - NSH]
           (854585..856510) [1926 bp, 641 aa]
          Length = 641

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 49/239 (20%), Positives = 93/239 (38%), Gaps = 44/239 (18%)

Query: 188 QGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEE-----AEFCKTMLNE 242
            G GI +  G     +   ++  +   G  LP+E+     E+ ++      EF +    +
Sbjct: 243 HGKGITMSVGDGHLEMLLRMLTVLDYLGNELPIEIVEKGGELSQQFRDKLTEFVRNKSKQ 302

Query: 243 FDAKCVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQE 302
              + +  +  L E+  +   F G+  K +A++ ++FE  + LD D  P    +  F  E
Sbjct: 303 -KVRIISCARTLDETH-ARLIF-GFSCKWVALMFNTFEEAIFLDVDAVPYILPEQFFDME 359

Query: 303 PYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQ------------- 349
            Y +TG++L+ D               I  ++ K   +A+  + P Q             
Sbjct: 360 GYKSTGIMLFRD-------------RLIDQHVSKECPDAVRQMIPTQEETSIWNHKAKFS 406

Query: 350 -------VYDKSDQEMDVPYHD--FEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVN 399
                   YD +  E     +D  F      V  ESG ++ NK   L++++ +   N+N
Sbjct: 407 GPAANKEAYDNTKDEGAAAVYDRFFRDHYYHV-VESGVVVFNKKNKLQSIVNSFMLNLN 464

>Sklu_2225.6 YER001W, Contig c2225 7299-9692
          Length = 797

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 57/273 (20%), Positives = 112/273 (41%), Gaps = 37/273 (13%)

Query: 191 GIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPD----------EVEEEAEFCKTML 240
           GIV+  G         ++ T+R  G  LP++V    D          +V + AEF     
Sbjct: 377 GIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEF-DIPP 435

Query: 241 NEFDAKC--------VYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPV 292
           N FD           V +S  L  S+I+ FD   ++ K LA++ + F+  + +D D    
Sbjct: 436 NSFDNTTDVKQELWFVDVSTTLNPSVINEFD--RFKNKWLAVVFNLFDEFVFIDVDAISY 493

Query: 293 KNLDNIFQQEPYTTTGLILWPD--FWRRTTQPMFYEIAGISVN-LQKRVRNAIDNLTPVQ 349
            ++++ F+   Y  +G + + D      +    F   + +    L+ +   +   +    
Sbjct: 494 VSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMPKALESKYFQSFSMIDDDY 553

Query: 350 VYDKSDQEM---DVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYP 406
           V+D+  + +   +  + +F         ESG + ++K +H+  ++++   N++       
Sbjct: 554 VFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMPLVISTILNMSK------ 607

Query: 407 IFSQGLAGEGDKETFIAG--ATFYNLPFYQVKT 437
               G  G GDKE F  G   + +   FY V+ 
Sbjct: 608 --KIGGCGHGDKEFFWLGFMVSGHRYSFYDVEA 638

>YGL257C (MNT2) [1743] chr7 complement(12481..14157)
           Mannosyltransferase required for addition of terminal
           mannose residues to O-linked oligosaccharides [1677 bp,
           558 aa]
          Length = 558

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 77/181 (42%), Gaps = 34/181 (18%)

Query: 264 FKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPDFWRRTTQPM 323
           F  Y  K LA+  SSFE  +L+D+D  P  +++  ++ E +  TG++ + D  R  +  +
Sbjct: 255 FTTYSNKWLALTFSSFEIPILMDSDTVPFVSIEKFYELEEFQKTGVLFFKD--RVISDDL 312

Query: 324 F------------YEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEMDVPYHDFEGAMPD 371
           F            Y   G+ +  + ++   +++    QV     + M +  +        
Sbjct: 313 FESSELKILREIVYGCIGLDLEDESKIHEQVEDPVVAQVL----ENMFIKKYKHH----- 363

Query: 372 VSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGATFYNLP 431
              ESG ++++K +HL ++L ++    +    Y+          GDK+ F  G    N  
Sbjct: 364 --LESGLVILHKGKHLFSMLTSIALQFSPIAEYF---------HGDKDFFWLGELLSNNR 412

Query: 432 F 432
           F
Sbjct: 413 F 413

>CAGL0G04279g complement(404144..406126) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 660

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 55/272 (20%), Positives = 115/272 (42%), Gaps = 33/272 (12%)

Query: 188 QGDGIVL-VAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAK 246
           +G G+V+ +      +L  L  K +++ G TLP+++    +     A F   +++  +  
Sbjct: 254 KGKGLVITIESNNLHILRKLF-KFLKENGNTLPIQLVFKRNVTL--ARFKDAIISYAEES 310

Query: 247 CVYISDILPESMI----SHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQE 302
             +++ I  E++I    +   F GY  K LA I ++FE+++++D +  P  N + + + E
Sbjct: 311 DQHVTIIEIEALIDDSFNKGTFVGYDDKFLASIFNTFEDVVMMDIEVIPYVNPEELLENE 370

Query: 303 PYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPV-----------QVY 351
            Y  +GL +W D   +    + +  A I  ++ K +  ++D    +           ++ 
Sbjct: 371 EYKNSGLYMWRD---KYLGALLH--AYICTDVMKSLEPSMDEYKTIGSKFPLRMNDPRLT 425

Query: 352 DKSDQEMDVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQG 411
           D SD  M    H +         + G +++NK + L  +++ +  N++            
Sbjct: 426 DTSD-PMGAILHGYYNLYLMHQVDGGVILLNKKQKLGGLIMGMVMNMHR--------DYA 476

Query: 412 LAGEGDKETFIAGATFYNLPFYQVKTKVGVDG 443
               G KE F  G     + F       G+ G
Sbjct: 477 HCSTGTKEAFWFGPYVAGMEFAVGTIDAGIIG 508

>KLLA0D13376g 1150858..1152849 some similarities with sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3 alpha-1,
           3-mannosyltransferases responsible for adding the
           terminal mannose residues of O-linked oligosaccharides,
           hypothetical start
          Length = 663

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 77/164 (46%), Gaps = 17/164 (10%)

Query: 270 KSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPDFWRRTTQPMFY---E 326
           K +A++ ++F   +LLDAD+    +L++ F  + Y  TG++L+ D      +   Y    
Sbjct: 351 KWMALLFNTFSECILLDADSVSFASLESYFDFKGYQDTGMLLFRDRNIIGEKTFIYCTDT 410

Query: 327 IAGISVNLQKRVRNAIDNLTPVQVYDKSDQEMDV------PYHDFEGAMPDVSTESGELM 380
           +  +  ++++    +  +  P+++ +  +  +D        Y+ F   +     +SG ++
Sbjct: 411 LKKLFPSVEETHFMSHRSTFPLELVENDNINIDTLSMEEQIYYKFFHNLQLHHIDSGLVV 470

Query: 381 VNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAG 424
           V++V+ L ++L++   N++G               GDKE F  G
Sbjct: 471 VDRVKKLSSLLISTMMNIDG--------KLQRCVYGDKEIFWLG 506

>CAGL0I08019g complement(782863..786720) highly similar to sp|Q08234
           Saccharomyces cerevisiae YOL075c, hypothetical start
          Length = 1285

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 255 PESMISHFDFKGYQFKSLAIIASSFENLLLLDADN 289
           PE MI HFD  GY+  S   IA  F +L+ ++  N
Sbjct: 917 PEEMIKHFDLMGYKCPSFTNIADFFLDLISVNTQN 951

>Kwal_23.5454
          Length = 583

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 58/142 (40%), Gaps = 14/142 (9%)

Query: 187 YQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPD-EVEEEAEFCKTMLNEFDA 245
           Y G GIV+  G         +++ +R    TLP+++    D          +    + + 
Sbjct: 186 YSGKGIVISIGEGGVDEVIRLLRVLRALKNTLPIQLVHKGDVSASSMNMIIQAGRGKIED 245

Query: 246 KCVYISDIL--PESMI----------SHFD-FKGYQFKSLAIIASSFENLLLLDADNFPV 292
           K    SDI   P+ +            + D F+ +  K +A + +SFE ++L+D+D  P 
Sbjct: 246 KQGIYSDISEHPQEIWFVNAARSIKKGNLDLFQRFSNKWIASLFNSFEEMILMDSDVVPF 305

Query: 293 KNLDNIFQQEPYTTTGLILWPD 314
            N   +F    Y  TG   + D
Sbjct: 306 LNPKELFDATEYRETGAYFFKD 327

>Kwal_33.15024
          Length = 369

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 66/149 (44%), Gaps = 18/149 (12%)

Query: 202 LLSYLVVKTIRKFG-----TTLPVEVFIPPDEVE--EEAEFCKTMLNEFDAKCVYISDIL 254
           L S L  ++ R+F      T  P  V    D+V   EE    +   + +D K + I    
Sbjct: 71  LKSDLSQRSGRRFSQGGSTTVSPTRVQFKDDQVRGFEERALIEKTEDPWDLKSL-IRKTF 129

Query: 255 PESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPD 314
            E +  ++DFKG+++ S  ++ S+  N+L  +AD      +++ FQ+      GL    D
Sbjct: 130 TEKLPDNYDFKGWKYPSKRLV-SNIVNILENNAD----LAIESTFQKYKSECAGLFQPRD 184

Query: 315 FW--RRTTQPMFYEIAGISVNLQKRVRNA 341
               R++   M Y   G    ++ R+R +
Sbjct: 185 VKNVRKSKARMLYNTIG---KIEHRIRKS 210

>KLLA0A11880g 1026919..1028190 some similarities with
           ca|CA0854|IPF8854 Candida albicans, hypothetical start
          Length = 423

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 264 FKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTG 308
           F+ +  K +A + +SFE ++L+D D  PV N   +F+ + Y   G
Sbjct: 282 FQRFNNKWIASLFNSFEEMILMDTDVAPVVNPAELFETKEYLDNG 326

>Kwal_55.22238
          Length = 584

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 28/51 (54%)

Query: 264 FKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPD 314
           FK +  K +A + +SFE ++L+D D  P  + + +F    Y  +G + + D
Sbjct: 277 FKRFSNKWIASLFNSFEEIILMDCDAVPFVDPELLFNTTEYKESGALFFVD 327

>KLLA0B06732g 589699..591504 similar to sp|P38228 Saccharomyces
           cerevisiae YBR044c TCM62 chaperone required for assembly
           of mitochondrial succinate dehydrogenase singleton,
           start by similarity
          Length = 601

 Score = 29.3 bits (64), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 292 VKNLDNIFQQEPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVY 351
           VK LD I  +  Y  +  +L+   ++R  Q +    A  +V +   VRN IDN+T  Q Y
Sbjct: 73  VKLLDEILSRISYDRS--VLYTPKYKRIPQLV---TAKDTVRMGTLVRNFIDNITMDQAY 127

Query: 352 DKSDQ 356
           D S Q
Sbjct: 128 DVSKQ 132

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,994,068
Number of extensions: 834368
Number of successful extensions: 2436
Number of sequences better than 10.0: 62
Number of HSP's gapped: 2403
Number of HSP's successfully gapped: 63
Length of query: 507
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 401
Effective length of database: 12,926,601
Effective search space: 5183567001
Effective search space used: 5183567001
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)