Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_576.757555628110.0
YER165W (PAB1)57756824130.0
CAGL0L11792g57956523350.0
Sklu_1838.358957622800.0
Kwal_56.2348658757422060.0
AGR122C58556720880.0
KLLA0C17600g59258820010.0
Sklu_1706.16722963994e-41
YFR023W (PES4)6113913612e-36
AEL016C6782983581e-35
Kwal_0.3705602933461e-34
Scas_607.106052973428e-34
KLLA0A08338g7662003074e-29
YHR015W (MIP6)6592802993e-28
CAGL0I08943g6024002922e-27
Scas_697.106103902823e-26
AFR107W3961762303e-20
Scas_671.44431612305e-20
CAGL0H10604g4161712288e-20
YGR159C (NSR1)4141742242e-19
CAGL0E03245g4251742242e-19
Scas_621.104151732233e-19
KLLA0C11495g4451742234e-19
AGR390C3781602205e-19
Sklu_1879.44211832181e-18
YNL016W (PUB1)4531602182e-18
KLLA0E08745g4751722137e-18
AEL217W8342162132e-17
Scas_637.23773092063e-17
YCL011C (GBP2)4271942074e-17
Kwal_27.114474391602022e-16
Kwal_55.201545223171971e-15
Scas_635.75811751961e-15
Kwal_56.247098282461943e-15
Scas_645.147172211934e-15
YOL123W (HRP1)5341861914e-15
ADR307W5661741899e-15
ADL160W5261361862e-14
AAL018W3371891832e-14
Kwal_23.39858762001863e-14
Scas_558.14352121833e-14
Sklu_2442.114643181825e-14
KLLA0C12925g5701931826e-14
Kwal_55.219605971731811e-13
CAGL0B04169g8611641811e-13
CAGL0M03795g5132341791e-13
CAGL0E01947g4521781763e-13
AGL250W7292041731e-12
Sklu_2307.26971881721e-12
YPR112C (MRD1)8871651703e-12
ADR035C8382061684e-12
CAGL0J11154g3802171638e-12
YOR319W (HSH49)2131721571e-11
KLLA0D14949g8782081651e-11
ABL059W2041681551e-11
KLLA0A05346g8743141641e-11
Sklu_2085.22091191551e-11
Scas_157.12321681552e-11
Scas_665.42191771533e-11
KLLA0D11792g6852011579e-11
CAGL0H02123g5553321551e-10
YNL004W (HRB1)4293221531e-10
CAGL0B04807g4191821522e-10
YPL043W (NOP4)6853121532e-10
CAGL0I09900g2111671453e-10
CAGL0F08217g6784011524e-10
Sklu_905.15151981504e-10
Kwal_27.118326861911505e-10
YHR086W (NAM8)5233481497e-10
Scas_376.14042161477e-10
KLLA0E11011g4322821471e-09
KLLA0F14861g5891701471e-09
Scas_598.15162121471e-09
CAGL0H03861g4432031452e-09
CAGL0L12672g6822131462e-09
Kwal_27.123372091711374e-09
ABL134C3751911414e-09
Kwal_33.144633932111415e-09
Kwal_27.103644432021415e-09
Kwal_0.2502161181341e-08
YGR250C7811301391e-08
KLLA0D05016g2622611341e-08
KLLA0C05522g5402191372e-08
YMR268C (PRP24)4442991362e-08
Scas_705.228691681363e-08
Sklu_1715.13961641325e-08
Kwal_55.20972135951236e-08
KLLA0C14388g2031641276e-08
AAR151W4812181301e-07
KLLA0F18216g7083161301e-07
Kwal_47.18572363851282e-07
YDR432W (NPL3)414731282e-07
KLLA0C08019g301581262e-07
Kwal_55.204142842351262e-07
CAGL0K06655g802771282e-07
CAGL0H04763g383841254e-07
ADR183C320851235e-07
Kwal_14.1851535771255e-07
Scas_717.41379731237e-07
Scas_88.1256641208e-07
KLLA0D13420g1661451169e-07
KLLA0B00979g3421661211e-06
Sklu_2182.3371731211e-06
Sklu_1790.3473681212e-06
YNL175C (NOP13)403901202e-06
KLLA0D08206g3911681192e-06
YBR212W (NGR1)672771193e-06
YOL041C (NOP12)459691183e-06
CAGL0J01914g1691701123e-06
Sklu_2257.4188741115e-06
CAGL0D05236g4431081166e-06
Scas_709.2*1711201106e-06
YIR005W (IST3)148891071e-05
KLLA0F07799g524841132e-05
Kwal_33.13496330721112e-05
CAGL0F01023g396661122e-05
Scas_316.14831691112e-05
ADR017W173871062e-05
Kwal_26.7179456771103e-05
KLLA0B10472g1981311063e-05
AGL038C7123211103e-05
Sklu_2353.5252611064e-05
Scas_701.3321741075e-05
Scas_582.10283821075e-05
AER349C218761055e-05
CAGL0D06182g280881065e-05
ADL063W320611066e-05
CAGL0M12573g299751067e-05
Scas_621.163141111067e-05
KLLA0E00484g2422211031e-04
Scas_643.16448581032e-04
CAGL0L03806g255751003e-04
AFR649W310721013e-04
ACR274W426761013e-04
YIL061C (SNP1)300741004e-04
CAGL0J02200g14494954e-04
Kwal_26.752226273986e-04
Scas_530.46843391006e-04
Sklu_2249.430976979e-04
AER285C426195970.001
YIR001C (SGN1)25076950.001
Sklu_2213.425761940.001
ACL071C298223950.001
Kwal_23.586427885940.002
Sklu_2375.520774920.002
YGL044C (RNA15)29675930.002
AFL050W21870920.002
CAGL0H02211g381157930.003
YFR032C289175930.003
Scas_570.1411379860.003
Kwal_27.1109620170900.004
YNL110C (NOP15)22075900.004
Scas_666.1122475900.004
CAGL0H03267g775174930.004
KLLA0B11594g11484850.005
KLLA0F09383g25865900.005
Scas_565.832292910.005
AGR010C26676900.005
ADL126C46676910.006
KLLA0A03531g73268910.007
YDR429C (TIF35)27460880.009
Kwal_55.2090314783850.009
Scas_714.5923360870.009
YBL051C (PIN4)66838890.012
CAGL0E03630g746137880.015
ADR001C32476860.017
KLLA0D13772g34590860.019
Scas_720.224574850.021
KLLA0B14432g17379830.023
AFL224W20682830.026
CAGL0C01529g23674830.031
KLLA0D16049g42576840.039
Kwal_26.845821975820.043
Kwal_55.2071859487830.052
Sklu_2221.828158820.060
Kwal_23.3650299115810.069
Kwal_26.682473964820.071
YPL178W (CBC2)208130800.072
CAGL0A04213g63938810.10
Sklu_2434.1473648810.11
Kwal_30.1289028063800.11
Scas_241.118680780.11
Sklu_1192.128089790.13
AFL070C75773790.17
Scas_632.7*22989760.22
Kwal_33.1520818678750.25
ADR399C73653780.25
Scas_611.5*78793770.29
AAR022W11480720.32
YNL286W (CUS2)28585760.33
YLL046C (RNP1)24983750.35
YOR361C (PRT1)76354760.36
Sklu_2391.176190760.42
Kwal_23.520429492750.45
Scas_663.1575354750.51
Kwal_55.2103911988700.56
CAGL0K09966g71953750.58
CAGL0E03960g29795730.71
KLLA0B00847g26959720.78
YDR381W (YRA1)22667711.1
YHL024W (RIM4)71379721.1
CAGL0I08393g43063721.2
AFR149C22067701.4
Kwal_27.1115856764711.5
YHL034C (SBP1)29496701.5
CAGL0G05401g67173711.5
CAGL0H04675g27461701.8
AFR062C473108701.9
ADL064W64687702.1
YBR214W (SDS24)52787702.2
Scas_500.662198702.3
Kwal_55.22147468108692.4
Sklu_1984.3284111682.5
YLL013C (PUF3)87924693.1
ADR189W26959664.2
CAGL0C01419g63996674.2
ACR235W57877675.1
KLLA0C07194g29775665.3
Scas_620.1273595666.1
AER449W16867646.4
Kwal_23.3638427108656.7
CAGL0G05511g67468666.7
KLLA0C02585g218565667.8
Sklu_2412.499634658.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_576.7
         (575 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_576.7                                                           1087   0.0  
YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding prot...   934   0.0  
CAGL0L11792g 1259275..1261014 highly similar to sp|P04147 Saccha...   904   0.0  
Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement        882   0.0  
Kwal_56.23486                                                         854   0.0  
AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH] (978634..98...   808   0.0  
KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces...   775   0.0  
Sklu_1706.1 YFR023W, Contig c1706 1364-3382                           158   4e-41
YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA po...   143   2e-36
AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W (...   142   1e-35
Kwal_0.370                                                            137   1e-34
Scas_607.10                                                           136   8e-34
KLLA0A08338g 736461..738761 weakly similar to sp|P39684 Saccharo...   122   4e-29
YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similar...   119   3e-28
CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces c...   117   2e-27
Scas_697.10                                                           113   3e-26
AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH] complement(...    93   3e-20
Scas_671.4                                                             93   5e-20
CAGL0H10604g complement(1033488..1034738) similar to sp|P32588 S...    92   8e-20
YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar ...    91   2e-19
CAGL0E03245g complement(299236..300513) similar to sp|P27476 Sac...    91   2e-19
Scas_621.10                                                            91   3e-19
KLLA0C11495g complement(990832..992169) some similarities with s...    91   4e-19
AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH] (1446842..1...    89   5e-19
Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement         89   1e-18
YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylate...    89   2e-18
KLLA0E08745g 782800..784227 some similarities with sp|P32588 Sac...    87   7e-18
AEL217W [2289] [Homologous to ScYGR250C - SH] complement(225217....    87   2e-17
Scas_637.2                                                             84   3e-17
YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein inv...    84   4e-17
Kwal_27.11447                                                          82   2e-16
Kwal_55.20154                                                          80   1e-15
Scas_635.7                                                             80   1e-15
Kwal_56.24709                                                          79   3e-15
Scas_645.14                                                            79   4e-15
YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylate...    78   4e-15
ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH] complement(...    77   9e-15
ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH] complement(...    76   2e-14
AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C (G...    75   2e-14
Kwal_23.3985                                                           76   3e-14
Scas_558.1                                                             75   3e-14
Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement      75   5e-14
KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383 S...    75   6e-14
Kwal_55.21960                                                          74   1e-13
CAGL0B04169g complement(404713..407298) highly similar to tr|Q06...    74   1e-13
CAGL0M03795g complement(428607..430148) highly similar to sp|Q99...    74   1e-13
CAGL0E01947g 193225..194583 some similarities with sp|Q99383 Sac...    72   3e-13
AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH] complement(...    71   1e-12
Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement         71   1e-12
YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein w...    70   3e-12
ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH] (768392..77...    69   4e-12
CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces...    67   8e-12
YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein a...    65   1e-11
KLLA0D14949g complement(1259860..1262496) similar to sgd|S000631...    68   1e-11
ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH] complement(...    64   1e-11
KLLA0A05346g 485886..488510 some similarities with sp|P53316 Sac...    68   1e-11
Sklu_2085.2 YOR319W, Contig c2085 3158-3787                            64   1e-11
Scas_157.1                                                             64   2e-11
Scas_665.4                                                             64   3e-11
KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces...    65   9e-11
CAGL0H02123g complement(188454..190121) similar to sp|Q00539 Sac...    64   1e-10
YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with simila...    64   1e-10
CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces c...    63   2e-10
YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein r...    64   2e-10
CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces c...    60   3e-10
CAGL0F08217g complement(814508..816544) similar to sp|P53316 Sac...    63   4e-10
Sklu_905.1 YMR268C, Contig c905 196-1743                               62   4e-10
Kwal_27.11832                                                          62   5e-10
YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated ...    62   7e-10
Scas_376.1                                                             61   7e-10
KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces c...    61   1e-09
KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539 S...    61   1e-09
Scas_598.1                                                             61   1e-09
CAGL0H03861g complement(361189..362520) similar to sp|P38922 Sac...    60   2e-09
CAGL0L12672g complement(1359637..1361685) similar to sp|P37838 S...    61   2e-09
Kwal_27.12337                                                          57   4e-09
ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH] (140625..14...    59   4e-09
Kwal_33.14463                                                          59   5e-09
Kwal_27.10364                                                          59   5e-09
Kwal_0.250                                                             56   1e-08
YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein...    58   1e-08
KLLA0D05016g complement(431592..432380) similar to sp|P25555 Sac...    56   1e-08
KLLA0C05522g 494240..495862 some similarities with sp|P32831 Sac...    57   2e-08
YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA...    57   2e-08
Scas_705.22                                                            57   3e-08
Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement          55   5e-08
Kwal_55.20972                                                          52   6e-08
KLLA0C14388g complement(1251548..1252159) similar to sp|Q99181 S...    54   6e-08
AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH] complement(6...    55   1e-07
KLLA0F18216g 1677731..1679857 some similarities with sp|P38741 S...    55   1e-07
Kwal_47.18572                                                          54   2e-07
YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved i...    54   2e-07
KLLA0C08019g complement(704199..705104) some similarities with s...    53   2e-07
Kwal_55.20414                                                          53   2e-07
CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces c...    54   2e-07
CAGL0H04763g 454589..455740 highly similar to sp|Q01560 Saccharo...    53   4e-07
ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH] (1024792..1...    52   5e-07
Kwal_14.1851                                                           53   5e-07
Scas_717.41                                                            52   7e-07
Scas_88.1                                                              51   8e-07
KLLA0D13420g complement(1157491..1157991) some similarities with...    49   9e-07
KLLA0B00979g 77439..78467 some similarities with sp|Q01560 Sacch...    51   1e-06
Sklu_2182.3 YDR432W, Contig c2182 3920-5035                            51   1e-06
Sklu_1790.3 YOL041C, Contig c1790 1701-3122                            51   2e-06
YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleola...    51   2e-06
KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces c...    50   2e-06
YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible R...    50   3e-06
YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein ...    50   3e-06
CAGL0J01914g complement(189309..189818) similar to sp|P40565 Sac...    48   3e-06
Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement         47   5e-06
CAGL0D05236g 499006..500337 weakly similar to sp|P43607 Saccharo...    49   6e-06
Scas_709.2*                                                            47   6e-06
YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in ...    46   1e-05
KLLA0F07799g complement(734889..736463) similar to sp|Q08208 Sac...    48   2e-05
Kwal_33.13496                                                          47   2e-05
CAGL0F01023g complement(108155..109345) similar to tr|Q08208 Sac...    48   2e-05
Scas_316.1                                                             47   2e-05
ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH] complement(...    45   2e-05
Kwal_26.7179                                                           47   3e-05
KLLA0B10472g complement(914512..915108) similar to sgd|S0006099 ...    45   3e-05
AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH] (639306..64...    47   3e-05
Sklu_2353.5 YIL061C, Contig c2353 10817-11575                          45   4e-05
Scas_701.3                                                             46   5e-05
Scas_582.10                                                            46   5e-05
AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,...    45   5e-05
CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces c...    45   5e-05
ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH] complement(...    45   6e-05
CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces...    45   7e-05
Scas_621.16                                                            45   7e-05
KLLA0E00484g complement(45755..46483) similar to sp|P10080 Sacch...    44   1e-04
Scas_643.16                                                            44   2e-04
CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces c...    43   3e-04
AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073...    44   3e-04
ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH] complement...    44   3e-04
YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1 snRNA-a...    43   4e-04
CAGL0J02200g complement(215042..215476) similar to sp|P40561 Sac...    41   4e-04
Kwal_26.7522                                                           42   6e-04
Scas_530.4                                                             43   6e-04
Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement         42   9e-04
AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH] (1162117.....    42   0.001
YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein wi...    41   0.001
Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement         41   0.001
ACL071C [978] [Homologous to ScYHL034C (SBP1) - SH; ScYLL046C (R...    41   0.001
Kwal_23.5864                                                           41   0.002
Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement       40   0.002
YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component...    40   0.002
AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH] complement(...    40   0.002
CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces c...    40   0.003
YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein...    40   0.003
Scas_570.14                                                            38   0.003
Kwal_27.11096                                                          39   0.004
YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein ...    39   0.004
Scas_666.11                                                            39   0.004
CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces c...    40   0.004
KLLA0B11594g complement(1018044..1018388) some similarities with...    37   0.005
KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces c...    39   0.005
Scas_565.8                                                             40   0.005
AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH] (736609..7...    39   0.005
ADL126C [1615] [Homologous to ScYFR032C - SH] (469991..471391) [...    40   0.006
KLLA0A03531g 320828..323026 similar to sp|P06103 Saccharomyces c...    40   0.007
YDR429C (TIF35) [1252] chr4 complement(1324465..1325289) Transla...    39   0.009
Kwal_55.20903                                                          37   0.009
Scas_714.59                                                            38   0.009
YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein wit...    39   0.012
CAGL0E03630g complement(335091..337331) weakly similar to sp|P38...    39   0.015
ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH] (708437..70...    38   0.017
KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4 A...    38   0.019
Scas_720.2                                                             37   0.021
KLLA0B14432g 1267356..1267877 weakly similar to sp|P36036 Saccha...    37   0.023
AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH] complement...    37   0.026
CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces c...    37   0.031
KLLA0D16049g complement(1352380..1353657) some similarities with...    37   0.039
Kwal_26.8458                                                           36   0.043
Kwal_55.20718                                                          37   0.052
Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement       36   0.060
Kwal_23.3650                                                           36   0.069
Kwal_26.6824                                                           36   0.071
YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of nu...    35   0.072
CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces c...    36   0.10 
Sklu_2434.14 YOR361C, Contig c2434 32150-34360                         36   0.11 
Kwal_30.12890                                                          35   0.11 
Scas_241.1                                                             35   0.11 
Sklu_1192.1 YNL286W, Contig c1192 480-1322 reverse complement          35   0.13 
AFL070C [3123] [Homologous to ScYPL190C (NAB3) - SH] (303268..30...    35   0.17 
Scas_632.7*                                                            34   0.22 
Kwal_33.15208                                                          33   0.25 
ADR399C [2139] [Homologous to ScYOR361C (PRT1) - SH] (1420640..1...    35   0.25 
Scas_611.5*                                                            34   0.29 
AAR022W [208] [Homologous to ScYIR009W (MSL1) - SH] complement(3...    32   0.32 
YNL286W (CUS2) [4325] chr14 (95221..96078) Suppressor of U2 snRN...    34   0.33 
YLL046C (RNP1) [3376] chr12 complement(46713..47462) Ribonucleop...    33   0.35 
YOR361C (PRT1) [5138] chr15 complement(1015357..1017648) Transla...    34   0.36 
Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement          34   0.42 
Kwal_23.5204                                                           33   0.45 
Scas_663.15                                                            33   0.51 
Kwal_55.21039                                                          32   0.56 
CAGL0K09966g complement(974102..976261) highly similar to sp|P06...    33   0.58 
CAGL0E03960g 376334..377227 similar to sp|P10080 Saccharomyces c...    33   0.71 
KLLA0B00847g complement(65983..66792) similar to sp|Q04067 Sacch...    32   0.78 
YDR381W (YRA1) [1208] chr4 (1236546..1236830,1237597..1237992) P...    32   1.1  
YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for s...    32   1.1  
CAGL0I08393g complement(818759..820051) similar to sp|P34167 Sac...    32   1.2  
AFR149C [3341] [Homologous to ScYDR381W (YRA1) - SH] (705111..70...    32   1.4  
Kwal_27.11158                                                          32   1.5  
YHL034C (SBP1) [2252] chr8 complement(33191..34075) Single-stran...    32   1.5  
CAGL0G05401g complement(508557..510572) similar to sp|P34761 Sac...    32   1.5  
CAGL0H04675g complement(447256..448080) highly similar to sp|Q04...    32   1.8  
AFR062C [3254] [Homologous to ScYNL137C (NAM9) - SH] (537207..53...    32   1.9  
ADL064W [1677] [Homologous to ScYER068W (MOT2) - SH] complement(...    32   2.1  
YBR214W (SDS24) [395] chr2 (651372..652955) Nuclear protein with...    32   2.2  
Scas_500.6                                                             32   2.3  
Kwal_55.22147                                                          31   2.4  
Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement         31   2.5  
YLL013C (PUF3) [3406] chr12 complement(122074..124713) Protein i...    31   3.1  
ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH] complement...    30   4.2  
CAGL0C01419g complement(153063..154982) similar to sp|Q08925 Sac...    30   4.2  
ACR235W [1282] [Homologous to ScYBL051C (PIN4) - SH] complement(...    30   5.1  
KLLA0C07194g 624694..625587 no similarity, hypothetical start          30   5.3  
Scas_620.12                                                            30   6.1  
AER449W [2949] [Homologous to ScYKL214C - SH] complement(1499913...    29   6.4  
Kwal_23.3638                                                           30   6.7  
CAGL0G05511g complement(522026..524050) similar to sp|P34761 Sac...    30   6.7  
KLLA0C02585g 229274..235831 similar to sp|P21951 Saccharomyces c...    30   7.8  
Sklu_2412.4 YMR124W, Contig c2412 7729-10719                           30   8.5  

>Scas_576.7
          Length = 575

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/556 (95%), Positives = 530/556 (95%)

Query: 1   MSDITEKTVEQLENLKIXXXXXXXXXXXXXXXXPASLYVGELDPTVSEALLYDIFSPIGS 60
           MSDITEKTVEQLENLKI                PASLYVGELDPTVSEALLYDIFSPIGS
Sbjct: 1   MSDITEKTVEQLENLKISESEDQPSTTTSTETSPASLYVGELDPTVSEALLYDIFSPIGS 60

Query: 61  VSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPALRKK 120
           VSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPALRKK
Sbjct: 61  VSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPALRKK 120

Query: 121 GSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAI 180
           GSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAI
Sbjct: 121 GSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAI 180

Query: 181 DALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYG 240
           DALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYG
Sbjct: 181 DALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYG 240

Query: 241 NVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQE 300
           NVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQE
Sbjct: 241 NVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQE 300

Query: 301 LKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKG 360
           LKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKG
Sbjct: 301 LKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKG 360

Query: 361 FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQMRYQQXX 420
           FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQMRYQQ  
Sbjct: 361 FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQMRYQQAT 420

Query: 421 XXXXXXXXGIPGQFMPPMFYGVMPPRGVPFNGPNPQQMNGVPPQQFRNGPGYGMPPQGGF 480
                   GIPGQFMPPMFYGVMPPRGVPFNGPNPQQMNGVPPQQFRNGPGYGMPPQGGF
Sbjct: 421 AAAAAAAAGIPGQFMPPMFYGVMPPRGVPFNGPNPQQMNGVPPQQFRNGPGYGMPPQGGF 480

Query: 481 PRNGVPNQFYQKNQRQALGEELYKKVSAKNADEEAAGKITGMILDLPPQEVVSLLENDEL 540
           PRNGVPNQFYQKNQRQALGEELYKKVSAKNADEEAAGKITGMILDLPPQEVVSLLENDEL
Sbjct: 481 PRNGVPNQFYQKNQRQALGEELYKKVSAKNADEEAAGKITGMILDLPPQEVVSLLENDEL 540

Query: 541 FEQHFKEASAAYESFK 556
           FEQHFKEASAAYESFK
Sbjct: 541 FEQHFKEASAAYESFK 556

>YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding protein
           of cytoplasm and nucleus, part of the 3'-end
           RNA-processing complex (cleavage factor I), involved in
           translation termination with Sup35p, has 4 RNA
           recognition (RRM) domains [1734 bp, 577 aa]
          Length = 577

 Score =  934 bits (2413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/568 (80%), Positives = 495/568 (87%), Gaps = 13/568 (2%)

Query: 1   MSDITEKTVEQLENLKIXXXXXXXXXXXXXXX---XPASLYVGELDPTVSEALLYDIFSP 57
           M+DIT+KT EQLENL I                    ASLYVG+L+P+VSEA LYDIFSP
Sbjct: 1   MADITDKTAEQLENLNIQDDQKQAATGSESQSVENSSASLYVGDLEPSVSEAHLYDIFSP 60

Query: 58  IGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPAL 117
           IGSVSSIRVCRDA+TKTSLGYAYVNFNDHEAG+KAIEQLNYTPIKGRLCRIMWSQRDP+L
Sbjct: 61  IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSL 120

Query: 118 RKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAK 177
           RKKGSGNIFIKNLHPDIDNKAL++TFSVFG+ILSSKIATDE GKSKGFGFVHFE E +AK
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFA 237
           EAIDALNGMLLNGQEIYVAPHL+RKERDSQLEETKAH+TN+YVKNIN ETTDE+F ELFA
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240

Query: 238 KYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYER 297
           K+G ++S+SLEK  DGKLKGFGFV++EKHEDA KAVE LN +E   + L+V RAQKK ER
Sbjct: 241 KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNER 300

Query: 298 MQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGK 357
           M  LKKQYEA RLEKMAKYQGVNLFVKNLDDS+DDEKL+EEFAPYGTITS +VMRT+NGK
Sbjct: 301 MHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK 360

Query: 358 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQMRYQ 417
           SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR QMRYQ
Sbjct: 361 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQ 420

Query: 418 QXXXXXXXXXXGIPGQFMPPMFYGVMPPRGVPFNGPNPQQM--------NGVPPQQFRNG 469
           Q          G+PGQFMPPMFYGVMPPRGVPFNGPNPQQM        NG+PP QFRNG
Sbjct: 421 QATAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMNPMGGMPKNGMPP-QFRNG 479

Query: 470 PGYGMPPQGGFPRNGVP-NQFYQKNQRQALGEELYKKVSAKNADEEAAGKITGMILDLPP 528
           P YG+PPQGGFPRN    NQFYQ+ QRQALGE+LYKKVSAK ++EEAAGKITGMILDLPP
Sbjct: 480 PVYGVPPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGMILDLPP 539

Query: 529 QEVVSLLENDELFEQHFKEASAAYESFK 556
           QEV  LLE+DELFEQH+KEASAAYESFK
Sbjct: 540 QEVFPLLESDELFEQHYKEASAAYESFK 567

>CAGL0L11792g 1259275..1261014 highly similar to sp|P04147
           Saccharomyces cerevisiae YER165w PAB1 mRNA
           polyadenylate-binding protein, start by similarity
          Length = 579

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/565 (77%), Positives = 485/565 (85%), Gaps = 9/565 (1%)

Query: 1   MSDITEKTVEQLENLKIXXXXXXXXXXXXXXXXPASLYVGELDPTVSEALLYDIFSPIGS 60
           M+DITEKT EQLENL +                 ASLYVG+LDP+VSEA LYDIFSPIG+
Sbjct: 1   MADITEKTAEQLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGA 60

Query: 61  VSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPALRKK 120
           VSSIRVCRDA+TKTSLGYAYVNFNDH+A K AIE+LN+TPIKG+LCRIMWSQRDP+LRKK
Sbjct: 61  VSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKK 120

Query: 121 GSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAI 180
           G+GNIFIKNLHPDIDNKAL++TFSVFGNILSSK+ATDETGKSKGFG+VHFE + SA EAI
Sbjct: 121 GAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESASEAI 180

Query: 181 DALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYG 240
           DALNGMLLNGQEIYV PHL++KER+S+ EE KA+FTNVY+KNIN ETTD+EF EL AK+G
Sbjct: 181 DALNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFG 240

Query: 241 NVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQE 300
              S  LE+T +G+ KGFGFV+F  HEDA K VEELN TEFK Q L+V+RAQKKYER QE
Sbjct: 241 KTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQE 300

Query: 301 LKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKG 360
           LKKQYEA+R+EKMAKYQG+NLF+KNLDDSIDD+KL+EEFAPYGTITS +VM T+NGKSKG
Sbjct: 301 LKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKG 360

Query: 361 FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQMRYQQ-X 419
           FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR QMR+QQ  
Sbjct: 361 FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRFQQAS 420

Query: 420 XXXXXXXXXGIPGQFMPPMFYGVMPPRGVPFNGPNPQQM-------NGVPPQQFRNGPGY 472
                    G+PGQFMPPMFYGVMPPRGVPFNGPNPQ         NG+PP QFRNGP Y
Sbjct: 421 AAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQMANMGAMPKNGMPPHQFRNGPVY 480

Query: 473 GMPPQGGFPRNG-VPNQFYQKNQRQALGEELYKKVSAKNADEEAAGKITGMILDLPPQEV 531
           G+PPQGGF RNG   NQFYQ+ QRQALGEELYK++ ++  DEEAAGKITGMILDLPPQEV
Sbjct: 481 GVPPQGGFARNGPAANQFYQQKQRQALGEELYKRIFSRTNDEEAAGKITGMILDLPPQEV 540

Query: 532 VSLLENDELFEQHFKEASAAYESFK 556
           V LLENDELFEQHFKEASAAYESFK
Sbjct: 541 VPLLENDELFEQHFKEASAAYESFK 565

>Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement
          Length = 589

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/576 (75%), Positives = 482/576 (83%), Gaps = 21/576 (3%)

Query: 1   MSDITEKTVEQLENLKI-----XXXXXXXXXXXXXXXXPASLYVGELDPTVSEALLYDIF 55
           MSD+T+KT EQLE LKI                      ASLYVGELDPTV+EALLYD+F
Sbjct: 1   MSDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLF 60

Query: 56  SPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDP 115
           SPIGSVSSIRVCRDA+TKTSLGYAYVNF+DH+AG+ AI++LNYT IKGR CRIMWSQRDP
Sbjct: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP 120

Query: 116 ALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESS 175
           +LRKKGSGNIFIKNLHP IDNKAL +TFSVFGNILS KIATDE G SKGFGFVHFE E S
Sbjct: 121 SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYS 180

Query: 176 AKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNEL 235
           AKEA+DA+NGMLLNGQE+YVAPH+++K+R S+LEE K++FTN+YVKNI+LETT EEF  L
Sbjct: 181 AKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240

Query: 236 FAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKY 295
           F ++G + S+ LE+  +GK +GFGF++FE HE AAKAV+ELN T+FK Q L+V RAQKKY
Sbjct: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300

Query: 296 ERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDN 355
           ER+QEL+KQYE SRLEK+AKYQGVNLFVKNLDDSIDDEKL++EFAP+G ITS +VMR D 
Sbjct: 301 ERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA 360

Query: 356 GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQMR 415
           G SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR QMR
Sbjct: 361 GNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 420

Query: 416 YQQXXXXXXXXXXGIPGQFMPPMFYGVMPPRGVPFNGPNPQQM--------NGV-PPQQF 466
           YQQ          G+PGQFMPPMFYGVMPPRGVPFNGPNPQQM        NGV PPQQF
Sbjct: 421 YQQVTAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMAAMGGMPKNGVIPPQQF 480

Query: 467 R--NGPGYGMP----PQGGFPRNGVPNQFYQKNQRQALGEELYKKVSAKNADEEAAGKIT 520
              NGP YG+P    PQGGFPRNG  NQFY + QRQALGE+LYKKVSAK  DEEAAGKIT
Sbjct: 481 GRPNGPMYGVPPQGAPQGGFPRNG-GNQFYHQKQRQALGEQLYKKVSAKTQDEEAAGKIT 539

Query: 521 GMILDLPPQEVVSLLENDELFEQHFKEASAAYESFK 556
           GMILDLPPQEVV LLEND+LFEQHFKEA AAYESFK
Sbjct: 540 GMILDLPPQEVVPLLENDDLFEQHFKEAFAAYESFK 575

>Kwal_56.23486
          Length = 587

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/574 (74%), Positives = 480/574 (83%), Gaps = 21/574 (3%)

Query: 1   MSDITEKTVEQLENLKIXXX-----XXXXXXXXXXXXXPASLYVGELDPTVSEALLYDIF 55
           MSD+T+KT EQLE L+I                      ASLYVGELDP+V+EALLYD+F
Sbjct: 1   MSDVTDKTAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLF 60

Query: 56  SPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDP 115
           SPIGSVSSIRVCRDA+TKTSLGYAYVNF+DH AG  AIE+LNYTPIKGR CRIMWSQRDP
Sbjct: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDP 120

Query: 116 ALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESS 175
           +LRKKGSGN+FIKNLHP IDNKAL +TFSVFGNILS KIATDETGKS+ FGFVHFE E +
Sbjct: 121 SLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEA 180

Query: 176 AKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNEL 235
           AKEAIDA+NGMLLNG E+YVAPH+++K+R S+L+E K++FTNVYVKNI+ ET  +EF +L
Sbjct: 181 AKEAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKL 240

Query: 236 FAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKY 295
           F++YG + S+ LE   +GKL+GFGFV+FE H  AAKAVEELN T+F  Q L+V RAQKKY
Sbjct: 241 FSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300

Query: 296 ERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDN 355
           ER+QELKKQYE+SR+EK+AKYQGVNLFVKNLDDSIDDEKL+EEFAP+GTITSV+VMR D 
Sbjct: 301 ERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDA 360

Query: 356 GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQMR 415
           G SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRRSQLAQQIQAR QMR
Sbjct: 361 GSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMR 420

Query: 416 YQQXXXXXXXXXXGIPGQFMPPMFYGVMPPRGVPFNGPNPQQM--------NGVPPQQF- 466
           YQQ          G+PGQFM PMFYGVMPPRGVPFNGPNPQQM        NGVPPQQF 
Sbjct: 421 YQQ-ATAAAAAAAGMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNGVPPQQFG 479

Query: 467 -RNGPGYGMP---PQGGFPRNGVPNQFYQKNQRQALGEELYKKVSAKNADEEAAGKITGM 522
             NGP YG+P   PQG FPRNG  NQF+ + QRQALGE+LYK+VSAK  DEEAAGKITGM
Sbjct: 480 RPNGPMYGVPPQGPQGAFPRNG--NQFFHQKQRQALGEQLYKRVSAKTQDEEAAGKITGM 537

Query: 523 ILDLPPQEVVSLLENDELFEQHFKEASAAYESFK 556
           ILDLPPQEVV LLENDELF+QHFKEA AAY+SFK
Sbjct: 538 ILDLPPQEVVPLLENDELFDQHFKEAFAAYDSFK 571

>AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH]
           (978634..980391) [1758 bp, 585 aa]
          Length = 585

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/567 (72%), Positives = 467/567 (82%), Gaps = 12/567 (2%)

Query: 1   MSDITEKTVEQLENLKIXXXXXXXXXXXXX---XXXPASLYVGELDPTVSEALLYDIFSP 57
           MSDIT+KT EQLE LKI                    ASLYVGEL+PTVSEALLYDIFSP
Sbjct: 1   MSDITDKTAEQLEQLKIEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSP 60

Query: 58  IGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPAL 117
           IGSVSSIRVCRDA+T TSLGYAYVNF+DHEAG KAIEQLNYT IKG+ CRIMWSQRDP+L
Sbjct: 61  IGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSL 120

Query: 118 RKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAK 177
           RKKGSGNI+IKNLHP IDNK+L ETFS FGNILS K+ATDE G S+GFGFVHFE+ES A+
Sbjct: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDAR 180

Query: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFA 237
           +AI+A++GML+N QE+YVA H+++K+R S+LEE KA FTNVYVKNI+ ET+ EEF ELF 
Sbjct: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240

Query: 238 KYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYER 297
           KYG + S+ LEK  +GKL+GFGFV+FE H  AAKAV+ELN  EFK Q L+V RAQKKYER
Sbjct: 241 KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYER 300

Query: 298 MQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGK 357
           +QELKKQYEA+RLEK+AKYQGVNLFVKNLDDSIDDEKLKEEFAP+GTITS +VMR + G 
Sbjct: 301 LQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN 360

Query: 358 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQMRYQ 417
           S+GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRR+QLAQQIQAR QMR+Q
Sbjct: 361 SRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQMRFQ 420

Query: 418 QXXXXXXXXXXGIPGQFM-PPMFYGVMPPRGVPFNGPNPQQM----NG-VPPQQF-RNGP 470
                      G+PGQFM PPM+YG +PPR VPF GPNPQ      NG +PPQQF R GP
Sbjct: 421 HANAAAAAAVAGLPGQFMPPPMYYGGIPPR-VPFQGPNPQMAGMPKNGAMPPQQFGRPGP 479

Query: 471 GY-GMPPQGGFPRNGVPNQFYQKNQRQALGEELYKKVSAKNADEEAAGKITGMILDLPPQ 529
            Y G  PQG FPRNG   QFYQ+ QRQALGE+LY+KV AK  D+EAAGKITGMILDLPPQ
Sbjct: 480 MYGGFAPQGQFPRNGQQQQFYQQKQRQALGEQLYQKVFAKTQDDEAAGKITGMILDLPPQ 539

Query: 530 EVVSLLENDELFEQHFKEASAAYESFK 556
           +V+ LLENDEL EQHF+EA AAY+ FK
Sbjct: 540 QVIQLLENDELLEQHFQEAHAAYQKFK 566

>KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces
           cerevisiae YER165w PAB1 mRNA polyadenylate-binding
           protein, start by similarity
          Length = 592

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/588 (67%), Positives = 457/588 (77%), Gaps = 35/588 (5%)

Query: 1   MSDITEKTVEQLENLKIXXXXX---------------XXXXXXXXXXXPASLYVGELDPT 45
           MSDITEKT EQLENL+I                                ASLYVGELDP 
Sbjct: 1   MSDITEKTAEQLENLQINDDQQPAQSASAPSTSASESEASSVSKVENNNASLYVGELDPN 60

Query: 46  VSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRL 105
           ++EALLYD+FSP+G +SSIRVCRDAVTK SLGYAYVN+ D+EAGKKAI++LNY  I GR 
Sbjct: 61  ITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQELNYAEINGRP 120

Query: 106 CRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGF 165
           CRIMWS+RDPA+RKKGSGNIFIKNLHP IDNKAL ETFS FG +LS K+A DE G S+GF
Sbjct: 121 CRIMWSERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGNSRGF 180

Query: 166 GFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINL 225
           GFVHF+ ES AK+AI+A+NGML+NG E+YVA H+ +K+R S+LEE KA+FTN+YVKNI++
Sbjct: 181 GFVHFKEESDAKDAIEAVNGMLMNGLEVYVAMHVPKKDRISKLEEAKANFTNIYVKNIDV 240

Query: 226 ETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQT 285
           ETTDEEF +LF++YG ++S++LEK  +GK KGFGFV+F  H  AAKAVEELNG EFK Q 
Sbjct: 241 ETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELNGKEFKSQA 300

Query: 286 LFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTI 345
           L+V RAQKKYER +ELKKQYE  RLEK+AK+QGVNLF+KNLDDSIDDEKLKEEFAPYGTI
Sbjct: 301 LYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKEEFAPYGTI 360

Query: 346 TSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLA 405
           TS RVMR   G SKGFGFVCFS+PEEATKA+TEKNQQIVAGKPLYVAIAQRKDVRRSQLA
Sbjct: 361 TSARVMRDQEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQRKDVRRSQLA 420

Query: 406 QQIQARTQMRY-QQXXXXXXXXXXGIPGQFMPPMFYGVMPPRGVPFNGPNPQQMNG---- 460
           QQIQAR Q+R+ QQ          G+PGQ+MP MFYGVM PRG P  GPNP  MNG    
Sbjct: 421 QQIQARNQIRFQQQQQQQAAAAAAGMPGQYMPQMFYGVMAPRGFP--GPNP-GMNGPMGA 477

Query: 461 --------VPPQQFR---NGPGY-GMPPQGGFPRNGVPNQFYQKNQRQALGEELYKKVSA 508
                    PPQQF    NGP Y GMPPQ  FPR+   +   Q+ QRQALGE+LYKKVSA
Sbjct: 478 GIPKNGMVPPPQQFAGRPNGPMYQGMPPQNQFPRHQQQHYIQQQKQRQALGEQLYKKVSA 537

Query: 509 KNADEEAAGKITGMILDLPPQEVVSLLENDELFEQHFKEASAAYESFK 556
           K  DE AAGKITGMILDLPPQ+V+ LL+NDE FEQ F+EA AAYE+FK
Sbjct: 538 KIDDENAAGKITGMILDLPPQQVIQLLDNDEQFEQQFQEALAAYENFK 585

>Sklu_1706.1 YFR023W, Contig c1706 1364-3382
          Length = 672

 Score =  158 bits (399), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 97/296 (32%), Positives = 157/296 (53%), Gaps = 40/296 (13%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
            +L++G+LD  V+E +L D F+   S+ S+++C DA++K SLGY Y+NF++ E  +KA E
Sbjct: 102 VALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATE 161

Query: 95  QLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNL---HPDIDNKALFETFSVFGNILS 151
           + NY P+ G+  RIM S R+   RK    N+F  NL   +  +  +A ++TF  +G ILS
Sbjct: 162 EFNYVPLFGKEVRIMPSLRNSFYRKNIGTNVFFSNLPLENLSLTTRAFYDTFKKYGKILS 221

Query: 152 SKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDS----- 206
            K+      + K  GF++F+ ++SAK AID  NG    G  I    H  R+ R S     
Sbjct: 222 CKL-----DRRKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDREVRKSPEFEK 276

Query: 207 ---------------------QLEE----TKA-HFTNVYVKNINLETTDEEFNELFAKYG 240
                                +L+E    TKA H   ++VKN+ +   +++  + F++ G
Sbjct: 277 RKSKLDGMTIIKEKLMTDDEQELQEVAPGTKAPHPNAIFVKNLPVNANEDDILDFFSRIG 336

Query: 241 NVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYE 296
            V S    K        + FV ++K  D ++A+E+LNG  FK + + V+RAQK ++
Sbjct: 337 PVKSVFTSKVPKYN-SSWAFVTYKKGSDTSEAIEKLNGEIFKHRKIEVARAQKNFQ 391

 Score = 87.8 bits (216), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 78/297 (26%), Positives = 143/297 (48%), Gaps = 37/297 (12%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGK-SKGFGFVHFEHESSAKEAIDAL 183
           +FI +L   +  K L +TF+ + +++S KI  D   K S G+G+++F ++  A++A +  
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 184 NGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNI---NLETTDEEFNELFAKYG 240
           N + L G+E+ + P L    R+S   +     TNV+  N+   NL  T   F + F KYG
Sbjct: 164 NYVPLFGKEVRIMPSL----RNSFYRKNIG--TNVFFSNLPLENLSLTTRAFYDTFKKYG 217

Query: 241 NVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFV----SRAQKKYE 296
            +LS  L++      K  GF+ F+K   A  A+++ NG E+    +       R  +K  
Sbjct: 218 KILSCKLDRR-----KNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDREVRKSP 272

Query: 297 RMQELKKQYEASRL--EKMA-----KYQGVN----------LFVKNLDDSIDDEKLKEEF 339
             ++ K + +   +  EK+      + Q V           +FVKNL  + +++ + + F
Sbjct: 273 EFEKRKSKLDGMTIIKEKLMTDDEQELQEVAPGTKAPHPNAIFVKNLPVNANEDDILDFF 332

Query: 340 APYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396
           +  G + SV   +     S  + FV +    + ++AI + N +I   + + VA AQ+
Sbjct: 333 SRIGPVKSVFTSKVPKYNS-SWAFVTYKKGSDTSEAIEKLNGEIFKHRKIEVARAQK 388

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 81/189 (42%), Gaps = 25/189 (13%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLK-GFGFVDFEKHEDAAKAVEEL 276
           +++ +++   T++   + F KY +++S  +      K   G+G+++F   EDA KA EE 
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 277 NGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNL---DDSIDDE 333
           N         +V    K+   M  L+  +    +       G N+F  NL   + S+   
Sbjct: 164 N---------YVPLFGKEVRIMPSLRNSFYRKNI-------GTNVFFSNLPLENLSLTTR 207

Query: 334 KLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 393
              + F  YG I S ++ R      K  GF+ F     A  AI + N +   G  +   I
Sbjct: 208 AFYDTFKKYGKILSCKLDR-----RKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGI 262

Query: 394 AQRKDVRRS 402
              ++VR+S
Sbjct: 263 HFDREVRKS 271

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 319 VNLFVKNLDDSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPEEATKAIT 377
           V LF+ +LD+ + ++ L++ F  Y ++ SV++ +   + +S G+G++ FS  E+A KA  
Sbjct: 102 VALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATE 161

Query: 378 EKNQQIVAGKPLYVAIAQRKDVRRSQLAQQI 408
           E N   + GK + +  + R    R  +   +
Sbjct: 162 EFNYVPLFGKEVRIMPSLRNSFYRKNIGTNV 192

>YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA
           polymerase epsilon mutation, contains four RNA
           recognition motif (RRM) domains [1836 bp, 611 aa]
          Length = 611

 Score =  143 bits (361), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 116/391 (29%), Positives = 187/391 (47%), Gaps = 63/391 (16%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L++G+L  TV+E  L  IF    S  S +VC D+VTK SLG+ Y+NF D E  +KA+E+L
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNL---HPDIDNKALFETFSVFGNILSSK 153
           NYT + G+  RIM S R+   RK    N+F  NL   +P +  +  ++TFS +G ILS K
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRYGKILSCK 212

Query: 154 IATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERD-------- 205
           + +      K  GFV+FE E +A+  I   N     G++I    H  ++ R         
Sbjct: 213 LDS-----RKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCGIHFDKEVRSVPNFETQK 267

Query: 206 SQLE---------------------ETKAHFT----NVYVKNINLETTDEEFNELFAKYG 240
           S+L+                     E+K  ++    ++++KN+   TT ++    F++ G
Sbjct: 268 SRLDAETIIEKEQSLNEKHSKGNDKESKNIYSSSQNSIFIKNLPTITTRDDILNFFSEVG 327

Query: 241 NVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQE 300
            + S  L      K   + FV ++   D+ KA++  N   F+ + L V+RAQ K ER + 
Sbjct: 328 PIKSIYLSNATKVKYL-WAFVTYKNSSDSEKAIKRYNNFYFRGKKLLVTRAQDKEERAKF 386

Query: 301 LKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLK-----EEFAPYGTITSVRVMRTDN 355
           ++ Q  ++            LF++NL    + E LK     E   P+     +++   D 
Sbjct: 387 IESQKIST------------LFLENLSAVCNKEFLKYLCHQENIRPF----KIQIDGYDE 430

Query: 356 GKSKGFGFVCFSTPEEATKAITEKNQQIVAG 386
             S   GF+ F   E+AT+     N ++V G
Sbjct: 431 NSSTYSGFIKFRNFEDATRIFNFLNNRLVGG 461

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 81/188 (43%), Gaps = 27/188 (14%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSS--SLEKTEDGKLKGFGFVDFEKHEDAAKAVEE 275
           +++ +++   T+E    +F KY + +S+   L+      L G G+++FE  E+A KA+EE
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSL-GHGYLNFEDKEEAEKAMEE 151

Query: 276 LNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNL---DDSIDD 332
           LN T+   + + +  +     R    +K +            G N+F  NL   +  +  
Sbjct: 152 LNYTKVNGKEIRIMPSL----RNTTFRKNF------------GTNVFFSNLPLNNPLLTT 195

Query: 333 EKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 392
               + F+ YG I S ++        K  GFV F   + A   I   N     GK +   
Sbjct: 196 RVFYDTFSRYGKILSCKL-----DSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCG 250

Query: 393 IAQRKDVR 400
           I   K+VR
Sbjct: 251 IHFDKEVR 258

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 55/115 (47%), Gaps = 1/115 (0%)

Query: 295 YERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRV-MRT 353
           + R+   K  ++  +L+     + V LF+ +L +++ +E LK  F  Y +  S +V + +
Sbjct: 67  FLRINNNKSGHKNGKLKSFESKKLVPLFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDS 126

Query: 354 DNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQI 408
              KS G G++ F   EEA KA+ E N   V GK + +  + R    R      +
Sbjct: 127 VTKKSLGHGYLNFEDKEEAEKAMEELNYTKVNGKEIRIMPSLRNTTFRKNFGTNV 181

>AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W
           (MIP6) - SH] (605004..607040) [2037 bp, 678 aa]
          Length = 678

 Score =  142 bits (358), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 93/298 (31%), Positives = 147/298 (49%), Gaps = 45/298 (15%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
            +L++G+LD  V+E  L D F+   S  S ++C D+ TK SLGY Y+NF++ E  ++ IE
Sbjct: 116 VALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIE 175

Query: 95  QLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNL---HPDIDNKALFETFSVFGNILS 151
           + NY PI GR  RIM S R+   RK    N+F  NL   +  +  +  ++ F  FG ILS
Sbjct: 176 EFNYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPLENLALTTRVFYDAFKKFGKILS 235

Query: 152 SKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDS-QLEE 210
            K+      + K  GFV+FE +S+AK+AI   NG    G  I    H  R  R S + E+
Sbjct: 236 CKL-----DRRKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNILCGIHFDRNVRKSPEFEK 290

Query: 211 TKA-----------------------------HFTNVYVKNINLETTDEEFNELFAKYG- 240
            KA                             H   V++KN+ L    +   + F++ G 
Sbjct: 291 RKARLEDMTLVKESLVMDNNQEIPSGSKMKGPHPNAVFIKNLPLNPDSDLLLDYFSQIGP 350

Query: 241 --NVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYE 296
             ++ +S++ K        + F+ F+K  DA  A++ LN ++   + + +SRAQK ++
Sbjct: 351 VKSIFTSNVSKLSSA----WAFITFQKGSDAQDAIDNLNHSQLLGRPIELSRAQKNFQ 404

 Score =  102 bits (253), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 87/316 (27%), Positives = 146/316 (46%), Gaps = 36/316 (11%)

Query: 105 LCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSK 163
           + ++  S+  P L  K    +FI +L   +  K L +TF+ F + +S+KI  D  T KS 
Sbjct: 98  IVKLGRSKDSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSL 157

Query: 164 GFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNI 223
           G+G+++F +E  A+  I+  N + + G+E+ + P L    R+S   +     TNV+  N+
Sbjct: 158 GYGYLNFSNEEDAERVIEEFNYIPIFGREVRIMPSL----RNSFYRKNIG--TNVFFSNL 211

Query: 224 ---NLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTE 280
              NL  T   F + F K+G +LS  L++      K  GFV FEK   A +A+ E NG E
Sbjct: 212 PLENLALTTRVFYDAFKKFGKILSCKLDRR-----KNIGFVYFEKDSAAKQAIAEYNGKE 266

Query: 281 FKDQTLFV----SRAQKKYERMQELKKQYEASRLEKMAKYQGVN---------------- 320
           F    +       R  +K    ++ K + E   L K +     N                
Sbjct: 267 FFGNNILCGIHFDRNVRKSPEFEKRKARLEDMTLVKESLVMDNNQEIPSGSKMKGPHPNA 326

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKN 380
           +F+KNL  + D + L + F+  G + S+      +  S  + F+ F    +A  AI   N
Sbjct: 327 VFIKNLPLNPDSDLLLDYFSQIGPVKSIFTSNV-SKLSSAWAFITFQKGSDAQDAIDNLN 385

Query: 381 QQIVAGKPLYVAIAQR 396
              + G+P+ ++ AQ+
Sbjct: 386 HSQLLGRPIELSRAQK 401

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 91/207 (43%), Gaps = 25/207 (12%)

Query: 211 TKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLK-GFGFVDFEKHEDA 269
           T      +++ +++ + T++   + F K+ + +S+ +    + K   G+G+++F   EDA
Sbjct: 111 TSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDA 170

Query: 270 AKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNL--- 326
            + +EE N         ++    ++   M  L+  +         K  G N+F  NL   
Sbjct: 171 ERVIEEFN---------YIPIFGREVRIMPSLRNSF-------YRKNIGTNVFFSNLPLE 214

Query: 327 DDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAG 386
           + ++      + F  +G I S ++ R      K  GFV F     A +AI E N +   G
Sbjct: 215 NLALTTRVFYDAFKKFGKILSCKLDR-----RKNIGFVYFEKDSAAKQAIAEYNGKEFFG 269

Query: 387 KPLYVAIAQRKDVRRSQLAQQIQARTQ 413
             +   I   ++VR+S   ++ +AR +
Sbjct: 270 NNILCGIHFDRNVRKSPEFEKRKARLE 296

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 69/306 (22%), Positives = 119/306 (38%), Gaps = 78/306 (25%)

Query: 46  VSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGR- 104
           ++  + YD F   G + S ++ R    + ++G+ Y  F    A K+AI + N     G  
Sbjct: 218 LTTRVFYDAFKKFGKILSCKLDR----RKNIGFVY--FEKDSAAKQAIAEYNGKEFFGNN 271

Query: 105 -LCRIMWSQ---RDPALRKKG----------------------SGN---------IFIKN 129
            LC I + +   + P   K+                       SG+         +FIKN
Sbjct: 272 ILCGIHFDRNVRKSPEFEKRKARLEDMTLVKESLVMDNNQEIPSGSKMKGPHPNAVFIKN 331

Query: 130 LHPDIDNKALFETFSVFGNILSSKIATDETGK-SKGFGFVHFEHESSAKEAIDALNGMLL 188
           L  + D+  L + FS  G + S  I T    K S  + F+ F+  S A++AID LN   L
Sbjct: 332 LPLNPDSDLLLDYFSQIGPVKS--IFTSNVSKLSSAWAFITFQKGSDAQDAIDNLNHSQL 389

Query: 189 NGQEIYVAPHLTRKERDSQLE--------------------------ETKAHFTNVYVKN 222
            G+ I     L+R +++ Q +                           + ++   VY+ +
Sbjct: 390 LGRPI----ELSRAQKNFQTDIDAANAGAGNNSSTTRSNDSDPCSTQHSSSYKLTVYLSS 445

Query: 223 INLETTDEEFNELFAKYGNVLSS--SLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTE 280
           ++     E+F + F     + +   S+   ++  L   GFV  +   DA +  E LN   
Sbjct: 446 LS-SICSEQFLQCFCAEERIKTKRISIRFYDEATLTFSGFVQCQTRNDANRLFELLNNKL 504

Query: 281 FKDQTL 286
             D T+
Sbjct: 505 LGDSTV 510

>Kwal_0.370
          Length = 560

 Score =  137 bits (346), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 90/293 (30%), Positives = 145/293 (49%), Gaps = 40/293 (13%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           +SL++G+LDP V+E +L D F    S+ S+++C D+ T  SLGY Y+NF   +  + AIE
Sbjct: 15  SSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIE 74

Query: 95  QLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNL---HPDIDNKALFETFSVFGNILS 151
             +Y  + GR  RIM S R+   RK    N+F  NL    P +  +  +ETF  +G +LS
Sbjct: 75  TFSYVNLFGREVRIMPSMRNSYFRKNIGTNVFFSNLPLEQPALTTRVFYETFREYGKVLS 134

Query: 152 SKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDS-QLEE 210
            K+      + K  GFV+FE +++A++AI + N     G  +    H  +  R S + E+
Sbjct: 135 CKL-----DRRKNIGFVYFESDAAARKAIASYNNKEYYGNIVTCGLHFDKDIRRSPEFEK 189

Query: 211 TKA------------------------------HFTNVYVKNINLETTDEEFNELFAKYG 240
            ++                              H  +++VKN+     +E+    F++ G
Sbjct: 190 RRSRLGSLTVAKENLLSENNVELENHDQNSKDPHPNSIHVKNLPFNICNEDLLNYFSRIG 249

Query: 241 NVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQK 293
            V S    K E  +   +GFV ++K  D  KA++ LNG  F D+ L V++A K
Sbjct: 250 PVKSVFTSKLEAYR-SSWGFVTYKKGCDTRKALDSLNGAIFMDRRLEVNKALK 301

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 94/331 (28%), Positives = 149/331 (45%), Gaps = 43/331 (12%)

Query: 109 MWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGF 167
           M +  +P +  +   ++FI +L P++  K L +TF VF +++S KI  D ETG S G+G+
Sbjct: 1   MNNSYNPCVTSQKVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGY 60

Query: 168 VHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLE- 226
           ++F     A+ AI+  + + L G+E+ + P +    R+S   +     TNV+  N+ LE 
Sbjct: 61  LNFYSSKDAETAIETFSYVNLFGREVRIMPSM----RNSYFRKNIG--TNVFFSNLPLEQ 114

Query: 227 --TTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQ 284
              T   F E F +YG VLS  L++      K  GFV FE    A KA+   N  E+   
Sbjct: 115 PALTTRVFYETFREYGKVLSCKLDRR-----KNIGFVYFESDAAARKAIASYNNKEYYGN 169

Query: 285 TLFVS-RAQKKYERMQELKKQYEASRL-------EKMAKYQGVNL--------------- 321
            +       K   R  E +K+   SRL       E +     V L               
Sbjct: 170 IVTCGLHFDKDIRRSPEFEKR--RSRLGSLTVAKENLLSENNVELENHDQNSKDPHPNSI 227

Query: 322 FVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQ 381
            VKNL  +I +E L   F+  G + SV   + +  +S  +GFV +    +  KA+   N 
Sbjct: 228 HVKNLPFNICNEDLLNYFSRIGPVKSVFTSKLEAYRS-SWGFVTYKKGCDTRKALDSLNG 286

Query: 382 QIVAGKPLYV--AIAQRKDVRRSQLAQQIQA 410
            I   + L V  A+    D R   +++  +A
Sbjct: 287 AIFMDRRLEVNKALKNNGDRRDGTVSKNRRA 317

>Scas_607.10
          Length = 605

 Score =  136 bits (342), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 89/297 (29%), Positives = 147/297 (49%), Gaps = 46/297 (15%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
            SL++  L   V+E +LYD+FS   S+ S+++C D+ +K SL Y Y+NF+D    KKA++
Sbjct: 92  TSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFSDELEAKKAVD 151

Query: 95  QLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNL---HPDIDNKALFETFSVFGNILS 151
             NYT + G   ++M S R+   RK    N+F  NL   +  +  +A ++TF  +G ILS
Sbjct: 152 DFNYTILFGNEIKMMPSLRNTIYRKNIGTNVFFANLPLENKHLTTRAFYDTFKGYGEILS 211

Query: 152 SKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKER------- 204
            K+      K K  GFV+F+++  A+  I+  N  +  G +I    H  ++ R       
Sbjct: 212 CKL-----DKRKNIGFVYFDNDKPAQMVINDFNNKIYFGNKIICGLHFDKEIRNFPNFDK 266

Query: 205 -----------DSQLEETKA-------------HFTNVYVKNINLETTDEEFNELFAKYG 240
                      D +LE                 H   ++VKN+  +  DEE  + F+K G
Sbjct: 267 RKANIDNKIIIDDELEAANIGVQFKKNSELILPHPNAIFVKNLPFDVPDEEILDHFSKLG 326

Query: 241 ---NVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKK 294
              +V SS++ K +      + F+ ++K  D  +A    N T+F+ +T+ VSRA+ K
Sbjct: 327 PVKSVFSSNVTKYK----SSWAFITYKKQTDTIRATNHFNNTKFQGKTITVSRAKLK 379

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 136/311 (43%), Gaps = 37/311 (11%)

Query: 113 RDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFE 171
           R+   RK+   ++FI  L  D+    L++ FS + +++S KI  D ++ KS  +G+++F 
Sbjct: 82  RNYRSRKRIVTSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFS 141

Query: 172 HESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLET---T 228
            E  AK+A+D  N  +L G EI + P L    R++   +     TNV+  N+ LE    T
Sbjct: 142 DELEAKKAVDDFNYTILFGNEIKMMPSL----RNTIYRKNIG--TNVFFANLPLENKHLT 195

Query: 229 DEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN----------- 277
              F + F  YG +LS  L+K      K  GFV F+  + A   + + N           
Sbjct: 196 TRAFYDTFKGYGEILSCKLDKR-----KNIGFVYFDNDKPAQMVINDFNNKIYFGNKIIC 250

Query: 278 GTEFKDQTLFVSRAQKKYERMQE---LKKQYEASRLEKMAKYQG-------VNLFVKNLD 327
           G  F  +        K+   +     +  + EA+ +    K            +FVKNL 
Sbjct: 251 GLHFDKEIRNFPNFDKRKANIDNKIIIDDELEAANIGVQFKKNSELILPHPNAIFVKNLP 310

Query: 328 DSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK 387
             + DE++ + F+  G + SV        KS  + F+ +    +  +A    N     GK
Sbjct: 311 FDVPDEEILDHFSKLGPVKSVFSSNVTKYKS-SWAFITYKKQTDTIRATNHFNNTKFQGK 369

Query: 388 PLYVAIAQRKD 398
            + V+ A+ K+
Sbjct: 370 TITVSRAKLKN 380

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 52/102 (50%), Gaps = 1/102 (0%)

Query: 308 SRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVM-RTDNGKSKGFGFVCF 366
           SR  +  K    +LF+  L D + +  L + F+ Y ++ S+++   +D+ KS  +G++ F
Sbjct: 81  SRNYRSRKRIVTSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNF 140

Query: 367 STPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQI 408
           S   EA KA+ + N  I+ G  + +  + R  + R  +   +
Sbjct: 141 SDELEAKKAVDDFNYTILFGNEIKMMPSLRNTIYRKNIGTNV 182

>KLLA0A08338g 736461..738761 weakly similar to sp|P39684
           Saccharomyces cerevisiae YFR023w PES4 DNA-directed DNA
           polymerase epsilon suppressor, start by similarity
          Length = 766

 Score =  122 bits (307), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 109/200 (54%), Gaps = 9/200 (4%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
            +L++G+L   V+E +L++IF+   S +S+++C D+ TK SLGY Y+NF D +  + A++
Sbjct: 138 TALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVD 197

Query: 95  QLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPD---IDNKALFETFSVFGNILS 151
           + NY PI GR  R+M S R+   RK    N+F  NL  D   +  +  ++ F  FG ILS
Sbjct: 198 EYNYMPIFGREIRMMPSLRNTYFRKNIGTNVFFSNLPLDNTKLTTRVFYDEFKKFGKILS 257

Query: 152 SKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDS-QLEE 210
            K+      + K  GF++FE++++AKEAI   NG       I    H  R  R S + E+
Sbjct: 258 CKL-----DRRKNIGFIYFENDAAAKEAIKQYNGKEFFDSTIMCGVHFDRNVRKSPEFEQ 312

Query: 211 TKAHFTNVYVKNINLETTDE 230
                 N+ V    LE  D+
Sbjct: 313 KINRINNLTVVKEKLEMEDD 332

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 86/195 (44%), Gaps = 33/195 (16%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLK---GFGFVDFEKHEDAAKA 272
           T +++ ++    T++  + +F K+ +   +S++   D   K   G+G+++F   +DA  A
Sbjct: 138 TALFIGDLPGNVTEDMLHNIFNKFKSF--NSVKICVDSNTKKSLGYGYLNFGDPKDAENA 195

Query: 273 VEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDD 332
           V+E N         ++    ++   M  L+  Y         K  G N+F  NL   +D+
Sbjct: 196 VDEYN---------YMPIFGREIRMMPSLRNTY-------FRKNIGTNVFFSNL--PLDN 237

Query: 333 EKLK-----EEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK 387
            KL      +EF  +G I S ++ R      K  GF+ F     A +AI + N +     
Sbjct: 238 TKLTTRVFYDEFKKFGKILSCKLDR-----RKNIGFIYFENDAAAKEAIKQYNGKEFFDS 292

Query: 388 PLYVAIAQRKDVRRS 402
            +   +   ++VR+S
Sbjct: 293 TIMCGVHFDRNVRKS 307

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 88/191 (46%), Gaps = 15/191 (7%)

Query: 214 HFTNVYVKNINLETTDEEFNELFAKYG---NVLSSSLEKTEDGKLKGFGFVDFEKHEDAA 270
           H   ++VKN+ +  + +     F+K G   +V +S + K +      + F+ +++ +D  
Sbjct: 384 HPNAIFVKNLPINPSHDNLLNFFSKIGPVKSVYTSDVSKFDSS----WAFITYKRIQDTK 439

Query: 271 KAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSI 330
            A+E+LNG ++  +T+ V    KK ER    + Q+E +   +   Y+   +F+ NL    
Sbjct: 440 TAIEKLNGCKYMKRTIEV----KKTERHHLEESQFENN--TRPNNYKKT-VFLTNLSVIC 492

Query: 331 DDEKLKEEFAPYGTITSVRVMRTDNGKSKGF-GFVCFSTPEEATKAITEKNQQIVAGKPL 389
           ++E L          T   V+R    K+  + G+V  ++  +A +       +++    +
Sbjct: 493 NEEFLNFLCGQERIKTERVVVRYYEEKTDTYSGYVRCASRNDAQRLFELMENKLLGDSEV 552

Query: 390 YVAIAQRKDVR 400
             +  Q KDV+
Sbjct: 553 KASWQQPKDVK 563

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 73/191 (38%), Gaps = 17/191 (8%)

Query: 125 IFIKNL--HPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDA 182
           IF+KNL  +P  DN  L   FS  G +  S   +D +     + F+ ++     K AI+ 
Sbjct: 388 IFVKNLPINPSHDN--LLNFFSKIGPV-KSVYTSDVSKFDSSWAFITYKRIQDTKTAIEK 444

Query: 183 LNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNV 242
           LNG     + I V         +SQ E       N Y K + L       NE F  +  +
Sbjct: 445 LNGCKYMKRTIEVKKTERHHLEESQFENNTR--PNNYKKTVFLTNLSVICNEEFLNF--L 500

Query: 243 LSSSLEKTEDGKLKGF--------GFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKK 294
                 KTE   ++ +        G+V      DA +  E +      D  +  S  Q K
Sbjct: 501 CGQERIKTERVVVRYYEEKTDTYSGYVRCASRNDAQRLFELMENKLLGDSEVKASWQQPK 560

Query: 295 YERMQELKKQY 305
             ++ E++  Y
Sbjct: 561 DVKLIEVEPSY 571

>YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similarity
           to Pes4p and Pab1p in the N-terminal region, contains
           four RNA recognition (RRM) domains [1980 bp, 659 aa]
          Length = 659

 Score =  119 bits (299), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 86/280 (30%), Positives = 136/280 (48%), Gaps = 34/280 (12%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           SL++G L  TV+E +L  IF    S  S +VCRD +TK SLGY Y+NF D    + A ++
Sbjct: 112 SLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKE 171

Query: 96  LNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNL---HPDIDNKALFETFSVFGNILSS 152
            NYT   G+  +IM S ++   RK    N+F  NL   +P +  ++ +     +GN+LS 
Sbjct: 172 FNYTVFFGQEVKIMPSMKNTLFRKNIGTNVFFSNLPLENPQLTTRSFYLIMIEYGNVLSC 231

Query: 153 KIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKER-------- 204
            +      + K  GFV+F+++ SA+  I   N     G +I    H  ++ R        
Sbjct: 232 LLE-----RRKNIGFVYFDNDISARNVIKKYNNQEFFGNKIICGLHFDKEVRTRPEFTKR 286

Query: 205 ------DSQLEE---------TKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSL-E 248
                 D  +E+           A    + VKN+  +TT EE  + F+  G + S  + E
Sbjct: 287 KKMIGSDIVIEDELLASNNLSDNARSKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISE 346

Query: 249 KTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFV 288
           K  +   K   FV ++  E++ KA + LN T FK+ T++V
Sbjct: 347 KQANTPHK--AFVTYKNEEESKKAQKCLNKTIFKNHTIWV 384

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 77/195 (39%), Gaps = 26/195 (13%)

Query: 211 TKAHFTN-VYVKNINLETTDEEFNELFAKYGNVLSSSLEKT-EDGKLKGFGFVDFEKHED 268
           TK   TN +++ N+    T+E   ++F +Y +  S+ + +     K  G+G+++F+   D
Sbjct: 105 TKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKND 164

Query: 269 AAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNL-- 326
           A  A +E N T F  Q + +         M  +K            K  G N+F  NL  
Sbjct: 165 AESARKEFNYTVFFGQEVKI---------MPSMKNTL-------FRKNIGTNVFFSNLPL 208

Query: 327 -DDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVA 385
            +  +           YG + S  + R      K  GFV F     A   I + N Q   
Sbjct: 209 ENPQLTTRSFYLIMIEYGNVLSCLLER-----RKNIGFVYFDNDISARNVIKKYNNQEFF 263

Query: 386 GKPLYVAIAQRKDVR 400
           G  +   +   K+VR
Sbjct: 264 GNKIICGLHFDKEVR 278

>CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces
           cerevisiae YFR023w PES4 DNA-directed DNA polymerase
           epsilon suppressor, hypothetical start
          Length = 602

 Score =  117 bits (292), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 100/400 (25%), Positives = 173/400 (43%), Gaps = 60/400 (15%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L+VG L   ++   L ++F    S  S +VC +A    SLG+ Y+NF + E  ++A E 
Sbjct: 65  ALFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATED 124

Query: 96  LNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNL---HPDIDNKALFETFSVFGNILSS 152
            NY  I G+  RIM S RD   RK    NIF  NL      + ++  ++ F  +GN+LS 
Sbjct: 125 FNYNKIMGKEIRIMPSIRDSVYRKNFGTNIFFSNLPLQKEKLTHRMFYDIFRKYGNVLSV 184

Query: 153 KIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKER-------- 204
           K+ +     SK  GFV+FE ++ A++ I   N     G  I    H  ++ R        
Sbjct: 185 KLDS-----SKNIGFVYFEDDTIARDVIKEFNNKEFLGNIISCGLHFDKELRKKPNFDKQ 239

Query: 205 ------DSQLEETKAHFTN-------------------VYVKNINLETTDEEFNELFAKY 239
                 D  +E+ K  F +                   +++KN+ L+T + E   +F++ 
Sbjct: 240 ISKLDDDIIIEKEKEIFDSNKVEIKIDKDKVAIIQPNGIFIKNLPLDTNNNEILAIFSEV 299

Query: 240 GNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQ 299
           G + S  L    + +   + FV ++      KA+   NG    ++ +FV+ A  KY    
Sbjct: 300 GPIKSVFLSPLNESREYLWAFVTYKDKASVEKAISLFNGKAIGNRNVFVTHAYSKYN--- 356

Query: 300 ELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTI-TSVRVMRTDNGKS 358
                        +   + + LF+ NL    D + LK+           ++V +++N + 
Sbjct: 357 -------------IPTPKPI-LFLSNLSPICDRKFLKQIMNQLSVKPEDIKVHQSENPEH 402

Query: 359 -KGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397
               G + F T ++  KA    N ++V+G  +Y    + K
Sbjct: 403 VTSTGTIQFKTQDDLDKAKKFLNNKLVSGSIIYATTRKSK 442

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 1/92 (1%)

Query: 318 GVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVM-RTDNGKSKGFGFVCFSTPEEATKAI 376
            + LFV NL + I  E+L E F  Y +  S +V    D+ +S G G++ F   E+A +A 
Sbjct: 63  NIALFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERAT 122

Query: 377 TEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQI 408
            + N   + GK + +  + R  V R      I
Sbjct: 123 EDFNYNKIMGKEIRIMPSIRDSVYRKNFGTNI 154

>Scas_697.10
          Length = 610

 Score =  113 bits (282), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 108/390 (27%), Positives = 168/390 (43%), Gaps = 58/390 (14%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
            +L++G+L+  V++  L  IF    S  S +VC D  T  SLG+ Y+NF D E  +KAI+
Sbjct: 101 TALFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAID 160

Query: 95  QLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDN-----KALFETFSVFGNI 149
             N   +  ++ RIM S R    +K    N+F  NL PD DN     +  FE F  FG I
Sbjct: 161 DFNCMKLGDKVIRIMPSLRGKNTKKSIGTNVFFTNL-PDEDNRLFHSRKFFEIFRQFGKI 219

Query: 150 LSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVA---------PHLT 200
           LS ++       +K  GF+ FEHE  AK  +   N  +  G  I            P + 
Sbjct: 220 LSCRL-----DPNKNIGFISFEHEEVAKTVVKKYNNSMFFGNRITCGILSEDNSKKPIME 274

Query: 201 RKERDSQ-------------------LEETKAHF--TNVYVKNINLETTDEEFNELFAKY 239
            K+  ++                   L  T   F    V+V N+    T EE    F K 
Sbjct: 275 EKQEQAKQFSQLNKKYDLNEKNMPRALLNTNNLFIENTVFVSNLPTSITVEEIRNHFNKI 334

Query: 240 GNVLSSSL-EKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERM 298
           GN+++  + +K     L  + FV +     A +A++ELN T  + + + VS+A ++ E  
Sbjct: 335 GNIMNLFISDKISSNAL--WAFVKYSTAACAIRAIKELNNTFIRKKQIVVSQAFRRGE-- 390

Query: 299 QELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTIT--SVRVMRTDNG 356
                Q+  SR     K     L++K L   I D+    +F     I    + + + +  
Sbjct: 391 ----TQFHLSR-----KPTKRILYLKEL-SRICDKDFVSQFCHQRRIKFDEISLTKVNLE 440

Query: 357 KSKGFGFVCFSTPEEATKAITEKNQQIVAG 386
           KS     +   T E+A K     N +++AG
Sbjct: 441 KSTHTARIKCRTDEDARKLYNSINNRLIAG 470

>AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH]
           complement(628898..630088) [1191 bp, 396 aa]
          Length = 396

 Score = 93.2 bits (230), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 59/176 (33%), Positives = 90/176 (51%), Gaps = 14/176 (7%)

Query: 34  PASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
           PA+++VG L  +V +  L   F  IG V   RV  +  T  S GY YV+F D    +KA+
Sbjct: 166 PATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVDFEDVSYAEKAV 225

Query: 94  EQLNYTPIKGRLCRIMWSQRDPA-------LRKKG------SGNIFIKNLHPDIDNKALF 140
           ++++   I GR      S   PA        +K G      S  +F+ NL  + D  ALF
Sbjct: 226 KEMHGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRDALF 285

Query: 141 ETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
           E FS  GN++S +I T  E+ + KGFG+V +     A+ A+DAL G  ++ + + +
Sbjct: 286 ELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVRI 341

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 90/192 (46%), Gaps = 19/192 (9%)

Query: 209 EETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSL--EKTEDGKLKGFGFVDFEKH 266
           ++T      ++V  ++    DE     F   G V+ + +  E+  D K +G+G+VDFE  
Sbjct: 160 QKTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTD-KSRGYGYVDFEDV 218

Query: 267 EDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGV------N 320
             A KAV+E++G E   + +    +           K   A R ++  KY          
Sbjct: 219 SYAEKAVKEMHGKEIDGRAINCDMS---------TSKPASAPREDRAKKYGDTPSQPSDT 269

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPEEATKAITEK 379
           LF+ NL  + D + L E F+ +G + SVR+    ++ + KGFG+V + + EEA  A+   
Sbjct: 270 LFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDAL 329

Query: 380 NQQIVAGKPLYV 391
             + +  +P+ +
Sbjct: 330 QGEYIDNRPVRI 341

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 6/105 (5%)

Query: 299 QELKKQYEASRLEKMAKYQGVN-----LFVKNLDDSIDDEKLKEEFAPYGTITSVRVM-R 352
           +E KK+   S  + +AK Q  +     +FV  L  S+DDE LK EF   G +   RV+  
Sbjct: 142 EESKKRSAESEDDAVAKKQKTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYE 201

Query: 353 TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397
               KS+G+G+V F     A KA+ E + + + G+ +   ++  K
Sbjct: 202 RGTDKSRGYGYVDFEDVSYAEKAVKEMHGKEIDGRAINCDMSTSK 246

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L++G L        L+++FS  G+V S+R+     +    G+ YV +   E  + A++ 
Sbjct: 269 TLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDA 328

Query: 96  LNYTPIKGRLCRIMWSQRDP 115
           L    I  R  RI +S   P
Sbjct: 329 LQGEYIDNRPVRIDFSSPRP 348

>Scas_671.4
          Length = 443

 Score = 93.2 bits (230), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 90/161 (55%), Gaps = 3/161 (1%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           LYVG LD +++E LL   F   G ++ +++  D     ++ YA++ +        A++ L
Sbjct: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDANVALQTL 143

Query: 97  NYTPIKGRLCRIMWS-QRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIA 155
           N   I+G+  RI W+ Q         + N+F+ +L+ D+D++ L   F  F + + + + 
Sbjct: 144 NGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVM 203

Query: 156 TD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
            D +TG+S+G+GFV F  +  A+EA++ + GM +NG+ + +
Sbjct: 204 WDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 82/182 (45%), Gaps = 16/182 (8%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277
           +YV N++    ++   + F   G +    +   +      + F+++ K  DA  A++ LN
Sbjct: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144

Query: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKE 337
           G + + +T+ ++ A   ++  Q                    NLFV +L+  +DDE L  
Sbjct: 145 GIQIEGKTVRINWA---FQSQQTTNSD------------DTFNLFVGDLNVDVDDETLSH 189

Query: 338 EFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396
            F  + +     VM     G+S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249

Query: 397 KD 398
           ++
Sbjct: 250 RE 251

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L+VG+L+  V +  L   F    S     V  D  T  S GY +V+F D E  ++A+  
Sbjct: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231

Query: 96  LNYTPIKGRLCRIMWSQR 113
           +   PI GR  RI W+ +
Sbjct: 232 MQGMPINGRAVRINWATK 249

>CAGL0H10604g complement(1033488..1034738) similar to sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1, hypothetical
           start
          Length = 416

 Score = 92.4 bits (228), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 98/171 (57%), Gaps = 4/171 (2%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           LYVG LD +++E LL   F   G + ++++  D +    + YA+V +        A++ L
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118

Query: 97  NYTPIKGRLCRIMWS-QRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIA 155
           N   ++ +  +I W+ +   A     + N+F+ +L+ D+D++ L  TF  F   + + + 
Sbjct: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178

Query: 156 TD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERD 205
            D +TG+S+G+GFV F ++  A++A+DA+ G  L+G++I +    T++ER+
Sbjct: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRIN-WATKRERN 228

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 89/182 (48%), Gaps = 16/182 (8%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277
           +YV N++   T++   + F   G + +  + +    +   + FV++ +  DA  A++ LN
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119

Query: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKE 337
           G + +++TL ++ A   +E  Q  +                 NLFV +L+  +DDE L  
Sbjct: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164

Query: 338 EFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396
            F  + T     VM     G+S+G+GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224

Query: 397 KD 398
           ++
Sbjct: 225 RE 226

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 80/175 (45%), Gaps = 6/175 (3%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +++ NL   I    L + F   G I + KI  D   +   + FV +     A  A+  LN
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119

Query: 185 GMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLS 244
           G+ L  + + +      +    Q  E    F N++V ++N++  DE     F ++   + 
Sbjct: 120 GVQLENKTLKINWAFETQ----QAAENDDTF-NLFVGDLNVDVDDETLAGTFREFPTFIQ 174

Query: 245 SS-LEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERM 298
           +  +   + G+ +G+GFV F   E+A KA++ + G +   + + ++ A K+   M
Sbjct: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATKRERNM 229

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L+VG+L+  V +  L   F    +     V  D  T  S GY +V+F++ E  +KA++ 
Sbjct: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206

Query: 96  LNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKN 129
           +    + GR  RI W+ +    R++  GN F  N
Sbjct: 207 MQGKDLSGRQIRINWATK----RERNMGNNFGNN 236

>YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar
           protein involved in processing 20S to 18S rRNA, has 2
           RNA recognition (RRM) domains and is member of GAR
           (glycine/arginine-rich repeats) family of proteins [1245
           bp, 414 aa]
          Length = 414

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 90/174 (51%), Gaps = 12/174 (6%)

Query: 34  PASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
           PA+++VG L  ++ +  L   F  IG V   RV  +  T  S GY YV+F +    +KAI
Sbjct: 167 PATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAI 226

Query: 94  EQLNYTPIKGRLCRIMWSQRDPA-----LRKKG------SGNIFIKNLHPDIDNKALFET 142
           +++    I GR      S   PA      +K G      S  +F+ NL  + D  A+FE 
Sbjct: 227 QEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFEL 286

Query: 143 FSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
           F+  G ++S +I T  ET + KGFG+V F +   AK+A+DAL G  ++ + + +
Sbjct: 287 FAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRL 340

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 95/194 (48%), Gaps = 13/194 (6%)

Query: 201 RKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSL--EKTEDGKLKGF 258
           +K+++ + EE       ++V  ++    DE   + F   G V+ + +  E+  D + +G+
Sbjct: 157 KKQKNEETEEP----ATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTD-RSRGY 211

Query: 259 GFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQG 318
           G+VDFE    A KA++E+ G E   + +    +  K     +  K++  +  E       
Sbjct: 212 GYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSD---- 267

Query: 319 VNLFVKNLDDSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPEEATKAIT 377
             LF+ NL  + D + + E FA +G + SVR+    +  + KGFG+V FS  E+A KA+ 
Sbjct: 268 -TLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALD 326

Query: 378 EKNQQIVAGKPLYV 391
               + +  +P+ +
Sbjct: 327 ALQGEYIDNRPVRL 340

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 319 VNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVM-RTDNGKSKGFGFVCFSTPEEATKAIT 377
             +FV  L  SIDDE LK+EF   G +   RV+      +S+G+G+V F     A KAI 
Sbjct: 168 ATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQ 227

Query: 378 EKNQQIVAGKPLYVAIAQRK 397
           E   + + G+P+   ++  K
Sbjct: 228 EMQGKEIDGRPINCDMSTSK 247

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L++G L        ++++F+  G V S+R+     T+   G+ YV F++ E  KKA++ 
Sbjct: 268 TLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDA 327

Query: 96  LNYTPIKGRLCRIMWSQRDP 115
           L    I  R  R+ +S   P
Sbjct: 328 LQGEYIDNRPVRLDFSSPRP 347

>CAGL0E03245g complement(299236..300513) similar to sp|P27476
           Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, start by
           similarity
          Length = 425

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 91/174 (52%), Gaps = 14/174 (8%)

Query: 34  PASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
           PA+++VG L  ++ +  L   F  IG V + RV  +  T  S GY YV+F D    +KA+
Sbjct: 175 PATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKAV 234

Query: 94  EQLNYTPIKGRLCRIMWSQRDPAL-----RKKGSGNI--------FIKNLHPDIDNKALF 140
           ++++   I GR   +  S   P +     R+K  G+I        F+ NL  + D   ++
Sbjct: 235 KEMHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNADRDNIY 294

Query: 141 ETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEI 193
           E F  FG I+S +I T  ET + KGFG+V +     AK+A++AL G  ++ + +
Sbjct: 295 EIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRPV 348

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 92/164 (56%), Gaps = 9/164 (5%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAIDA 182
            +F+  L   ID++ L + F   G ++++++  +  T +S+G+G+V FE +S A++A+  
Sbjct: 177 TVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKAVKE 236

Query: 183 LNGMLLNGQEIYV-----APHLT-RKERDSQLEETKAHFTN-VYVKNINLETTDEEFNEL 235
           ++G  ++G+ I V      P +  R++R  +  +  +  ++ +++ N++     +   E+
Sbjct: 237 MHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNADRDNIYEI 296

Query: 236 FAKYGNVLSSSL-EKTEDGKLKGFGFVDFEKHEDAAKAVEELNG 278
           F K+G ++S  +    E  + KGFG+V +   +DA KA+E L G
Sbjct: 297 FGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQG 340

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 89/183 (48%), Gaps = 7/183 (3%)

Query: 210 ETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSL--EKTEDGKLKGFGFVDFEKHE 267
           +T      V+V  ++    DE   + F   G V+++ +  E+  D + +G+G+VDFE   
Sbjct: 170 KTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTD-RSRGYGYVDFEDKS 228

Query: 268 DAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLD 327
            A KAV+E++G E   + + V  +  K        +Q    R   +       LF+ NL 
Sbjct: 229 YAEKAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQ---KRFGDIPSEPSDTLFLGNLS 285

Query: 328 DSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAG 386
            + D + + E F  +G I SVR+    +  + KGFG+V +++ ++A KA+     + +  
Sbjct: 286 FNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDN 345

Query: 387 KPL 389
           +P+
Sbjct: 346 RPV 348

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 3/89 (3%)

Query: 312 KMAKYQG--VNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVM-RTDNGKSKGFGFVCFST 368
           K AK  G    +FV  L  SIDDE LK+EF   G + + RVM      +S+G+G+V F  
Sbjct: 167 KKAKTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFED 226

Query: 369 PEEATKAITEKNQQIVAGKPLYVAIAQRK 397
              A KA+ E + + + G+P+ V ++  K
Sbjct: 227 KSYAEKAVKEMHGKEIDGRPINVDMSTSK 255

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 38/80 (47%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L++G L        +Y+IF   G + S+R+     T+   G+ YV +   +  KKA+E 
Sbjct: 278 TLFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEA 337

Query: 96  LNYTPIKGRLCRIMWSQRDP 115
           L    I  R  R+ +S   P
Sbjct: 338 LQGEYIDNRPVRLDYSTPKP 357

>Scas_621.10
          Length = 415

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/173 (33%), Positives = 90/173 (52%), Gaps = 13/173 (7%)

Query: 34  PASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
           PA+++VG L  ++ +  L   F  IG V S RV  +  T  S GY YV+F D    +KAI
Sbjct: 161 PATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAI 220

Query: 94  EQLNYTPIKGRLCRIMWSQRDPAL----RKKGSGNI--------FIKNLHPDIDNKALFE 141
           +++    I GR   +  S   PA     R K  G++        F+ NL  + D  A+ E
Sbjct: 221 KEMQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISE 280

Query: 142 TFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEI 193
            FS +G I+S +I T  ET + KGFG+V + +   AK+A++ L G  ++ + +
Sbjct: 281 LFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPV 333

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 90/162 (55%), Gaps = 8/162 (4%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAIDAL 183
           IF+  L   ID++ L + F   G ++S+++  +  T +S+G+G+V FE +S A++AI  +
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEM 223

Query: 184 NGMLLNGQEIYV-----APHLTRKERDSQLEETKAHFT-NVYVKNINLETTDEEFNELFA 237
            G  ++G+EI V      P     +R  +  +  +  +  +++ N++     +  +ELF+
Sbjct: 224 QGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELFS 283

Query: 238 KYGNVLSSSL-EKTEDGKLKGFGFVDFEKHEDAAKAVEELNG 278
           KYG ++S  +    E  + KGFG+V +   EDA KA+E L G
Sbjct: 284 KYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQG 325

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 89/184 (48%), Gaps = 8/184 (4%)

Query: 209 EETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSS--LEKTEDGKLKGFGFVDFEKH 266
           ++T+     ++V  ++    DE   + F   G V+S+   +E+  D + +G+G+VDFE  
Sbjct: 155 QKTEGEPATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTD-RSRGYGYVDFEDK 213

Query: 267 EDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNL 326
             A KA++E+ G E   + + V  +  K            A +   +       LF+ NL
Sbjct: 214 SYAEKAIKEMQGKEIDGREINVDMSTSK----PAAGNNDRAKKFGDVPSEPSETLFLGNL 269

Query: 327 DDSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVA 385
             + D + + E F+ YG I SVR+    +  + KGFG+V ++  E+A KA+     + + 
Sbjct: 270 SFNADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYID 329

Query: 386 GKPL 389
            +P+
Sbjct: 330 NRPV 333

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 319 VNLFVKNLDDSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPEEATKAIT 377
             +FV  L  SIDDE LK+EF   G + S RV M     +S+G+G+V F     A KAI 
Sbjct: 162 ATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIK 221

Query: 378 EKNQQIVAGKPLYVAIAQRK 397
           E   + + G+ + V ++  K
Sbjct: 222 EMQGKEIDGREINVDMSTSK 241

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L++G L        + ++FS  G + S+R+     T+   G+ YV + + E  KKA+E 
Sbjct: 263 TLFLGNLSFNADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEG 322

Query: 96  LNYTPIKGRLCRIMWSQRDP 115
           L    I  R  R+ +S   P
Sbjct: 323 LQGEYIDNRPVRLDYSTPRP 342

>KLLA0C11495g complement(990832..992169) some similarities with
           sp|P27476 Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, hypothetical
           start
          Length = 445

 Score = 90.5 bits (223), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 59/174 (33%), Positives = 90/174 (51%), Gaps = 14/174 (8%)

Query: 34  PASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
           PA+++VG L  ++ +  L   F PIG V S RV  +  T  S GY YV+F D    +KAI
Sbjct: 195 PATIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAI 254

Query: 94  EQLNYTPIKGRL--CRIMWSQ-----RDPALRKKG------SGNIFIKNLHPDIDNKALF 140
           ++++   I GR   C +  S+     RD   +K G      S  +F+ NL  + D   L+
Sbjct: 255 KEMHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLY 314

Query: 141 ETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEI 193
           E F  +G I+S +I T  ET + KGFG+V +     A +A + L G  +N + +
Sbjct: 315 EIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRPV 368

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 88/163 (53%), Gaps = 9/163 (5%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAIDAL 183
           IF+  L   ID++ L   F   G ++S+++  +  T +S+G+G+V FE +S A++AI  +
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKEM 257

Query: 184 NGMLLNGQEIYVAPHLT------RKERDSQLEETKAHFTN-VYVKNINLETTDEEFNELF 236
           +G  ++G+ I      +      R +R  +  +  +  ++ +++ N++ E   +   E+F
Sbjct: 258 HGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLYEIF 317

Query: 237 AKYGNVLSSSL-EKTEDGKLKGFGFVDFEKHEDAAKAVEELNG 278
            KYG ++S  +    E  + KGFG+V +   EDA KA E L G
Sbjct: 318 GKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQG 360

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 86/181 (47%), Gaps = 19/181 (10%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSL--EKTEDGKLKGFGFVDFEKHEDAAKAVEE 275
           ++V  ++    DE     F   G V+S+ +  E+  D + +G+G+VDFE    A KA++E
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTD-RSRGYGYVDFEDKSYAEKAIKE 256

Query: 276 LNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGV------NLFVKNLDDS 329
           ++G E   + +    +           K   A R ++  K+  V       LF+ NL   
Sbjct: 257 MHGKEIDGRPINCDMS---------TSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFE 307

Query: 330 IDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 388
            D + L E F  YG I SVR+    +  + KGFG+V + + E+ATKA      + +  +P
Sbjct: 308 ADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRP 367

Query: 389 L 389
           +
Sbjct: 368 V 368

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 319 VNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVM-RTDNGKSKGFGFVCFSTPEEATKAIT 377
             +FV  L  SIDDE LK EF P G + S RVM      +S+G+G+V F     A KAI 
Sbjct: 196 ATIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIK 255

Query: 378 EKNQQIVAGKPLYVAIAQRK 397
           E + + + G+P+   ++  K
Sbjct: 256 EMHGKEIDGRPINCDMSTSK 275

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L++G L        LY+IF   G + S+R+     T+   G+ YV +   E   KA E 
Sbjct: 298 TLFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEG 357

Query: 96  LNYTPIKGRLCRIMWS 111
           L    I  R  R+ +S
Sbjct: 358 LQGEYINNRPVRLDYS 373

>AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH]
           (1446842..1447978) [1137 bp, 378 aa]
          Length = 378

 Score = 89.4 bits (220), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 89/160 (55%), Gaps = 2/160 (1%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           LYVG LD T++EA L   F   G +++++V  D   + +  YA+V +        A + L
Sbjct: 37  LYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYRQPRDANVAFQTL 95

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           +   I+  + +I W+ +   +    + N+F+ +L+ D+D++ L  TF  F   + + +  
Sbjct: 96  DGKQIENNVIKINWAFQSQQVSSDDTFNLFVGDLNVDVDDETLSSTFKEFPTFIQAHVMW 155

Query: 157 D-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
           D ++G+S+G+GFV F  +  A++A+DA  G  LNG+ I V
Sbjct: 156 DMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRV 195

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 87/186 (46%), Gaps = 17/186 (9%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277
           +YV N++    +    + F   G + +  +   ++ +   + FV++ +  DA  A + L+
Sbjct: 37  LYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYRQPRDANVAFQTLD 96

Query: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKE 337
           G + ++  + ++ A +                 ++++     NLFV +L+  +DDE L  
Sbjct: 97  GKQIENNVIKINWAFQS----------------QQVSSDDTFNLFVGDLNVDVDDETLSS 140

Query: 338 EFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396
            F  + T     VM    +G+S+G+GFV F   EEA KA+  K    + G+ + V  A +
Sbjct: 141 TFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAK 200

Query: 397 KDVRRS 402
           ++ + +
Sbjct: 201 RESQHA 206

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 38/78 (48%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L+VG+L+  V +  L   F    +     V  D  +  S GY +V+F + E  +KA++ 
Sbjct: 123 NLFVGDLNVDVDDETLSSTFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDA 182

Query: 96  LNYTPIKGRLCRIMWSQR 113
                + GR  R+ W+ +
Sbjct: 183 KQGFNLNGRAIRVNWAAK 200

>Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement
          Length = 421

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 95/183 (51%), Gaps = 14/183 (7%)

Query: 34  PASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
           PA+++VG L  ++ +  L   F  IG V S RV  +  +  S GY YV+F D    +KA+
Sbjct: 172 PATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAV 231

Query: 94  EQLNYTPIKGRL--CRIMWSQ-----RDPALRKKG------SGNIFIKNLHPDIDNKALF 140
           ++++   I GR   C +  S+     RD   +K G      S  +F+ NL  + D   LF
Sbjct: 232 KEMHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLF 291

Query: 141 ETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHL 199
           E FS  G ++S +I T  ET + KGFG+V +     AK+A +AL G  ++ + + +   +
Sbjct: 292 EIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPVRLDYSI 351

Query: 200 TRK 202
            R+
Sbjct: 352 PRQ 354

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 87/163 (53%), Gaps = 9/163 (5%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAIDAL 183
           IF+  L   ID++ L   F   G ++S+++  +  + +S+G+G+V FE +  A++A+  +
Sbjct: 175 IFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKEM 234

Query: 184 NGMLLNGQEIYVAPHLT------RKERDSQLEETKAHFTN-VYVKNINLETTDEEFNELF 236
           +G  ++G+ I      +      R +R  +  +  +  ++ +++ N++     +   E+F
Sbjct: 235 HGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFEIF 294

Query: 237 AKYGNVLSSSL-EKTEDGKLKGFGFVDFEKHEDAAKAVEELNG 278
           +++G V+S  +    E  + KGFG+V +   +DA KA E L G
Sbjct: 295 SQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQG 337

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 87/183 (47%), Gaps = 19/183 (10%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSL--EKTEDGKLKGFGFVDFEKHEDAAKAV 273
             ++V  ++    DE     F   G V+S+ +  E+  D + +G+G+VDFE    A KAV
Sbjct: 173 ATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSD-RSRGYGYVDFEDKHYAEKAV 231

Query: 274 EELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGV------NLFVKNLD 327
           +E++G E   + +    +           K   A R ++  K+  V       LF+ NL 
Sbjct: 232 KEMHGKEIDGRPINCDMS---------TSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLS 282

Query: 328 DSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAG 386
            + D + L E F+ +G + SVR+    +  + KGFG+V + + ++A KA      + +  
Sbjct: 283 FNADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDN 342

Query: 387 KPL 389
           +P+
Sbjct: 343 RPV 345

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 319 VNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVM-RTDNGKSKGFGFVCFSTPEEATKAIT 377
             +FV  L  SIDDE LK EF   G + S RV+    + +S+G+G+V F     A KA+ 
Sbjct: 173 ATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVK 232

Query: 378 EKNQQIVAGKPLYVAIAQRK 397
           E + + + G+P+   ++  K
Sbjct: 233 EMHGKEIDGRPINCDMSTSK 252

>YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylated
           RNA-binding protein of nucleus and cytoplasm, contains
           three RNA recognition (RRM) domains and three
           Gln/Asn-rich regions [1362 bp, 453 aa]
          Length = 453

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 89/160 (55%), Gaps = 2/160 (1%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           LYVG LD  ++E +L   F   G +++I++  D   K ++ YA+V ++       A++ L
Sbjct: 77  LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNK-NVNYAFVEYHQSHDANIALQTL 135

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           N   I+  + +I W+ +        + N+F+ +L+ ++D++ L   F  F + LS  +  
Sbjct: 136 NGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW 195

Query: 157 D-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
           D +TG S+G+GFV F  +  A+ A+D++ G  LNG+ + +
Sbjct: 196 DMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRI 235

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 90/182 (49%), Gaps = 17/182 (9%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277
           +YV N++   T++   + F   G + +  +   ++ K   + FV++ +  DA  A++ LN
Sbjct: 77  LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLN 136

Query: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKE 337
           G + ++  + ++ A          + Q  +S           NLFV +L+ ++DDE L+ 
Sbjct: 137 GKQIENNIVKINWA---------FQSQQSSSD-------DTFNLFVGDLNVNVDDETLRN 180

Query: 338 EFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396
            F  + +  S  VM     G S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 181 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAK 240

Query: 397 KD 398
           +D
Sbjct: 241 RD 242

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L+VG+L+  V +  L + F    S  S  V  D  T +S GY +V+F   +  + A++ 
Sbjct: 163 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDS 222

Query: 96  LNYTPIKGRLCRIMWSQR 113
           +    + GR  RI W+ +
Sbjct: 223 MQGQDLNGRPLRINWAAK 240

>KLLA0E08745g 782800..784227 some similarities with sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1 major
           polyadenylated RNA-binding protein of nucleus and
           cytoplasm, hypothetical start
          Length = 475

 Score = 86.7 bits (213), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 94/172 (54%), Gaps = 2/172 (1%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           LYVG L  ++ + LL   F   GS+SS+++  D  ++    YA+V + +      A + L
Sbjct: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDANVAYQTL 157

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           N   ++G++ +I W+ +   +    + N+F+ +L+ D+D+  L  TF  F + + + +  
Sbjct: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217

Query: 157 D-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQ 207
           D ++G+S+G+GFV F  +  A+ A++   G  LNG+ + +     R+ + SQ
Sbjct: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ 269

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 87/178 (48%), Gaps = 7/178 (3%)

Query: 118 RKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAK 177
           R+K    +++ NL   ID+  L + F + G+I S KI  D+  +   + FV +     A 
Sbjct: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151

Query: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFA 237
            A   LNG  + G+ + +      ++ +S  +ET     N++V ++N++  D      F 
Sbjct: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNS--DET----FNLFVGDLNVDVDDATLAGTFK 205

Query: 238 KYGNVLSSS-LEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKK 294
           ++ + + +  +   + G+ +G+GFV F + + A  A+E   G E   + L ++ A K+
Sbjct: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 91/191 (47%), Gaps = 17/191 (8%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277
           +YV N+     D+   + F   G++ S  +   ++ +   + FV++ +  DA  A + LN
Sbjct: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158

Query: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKE 337
           G E + + L ++ A             +++ ++     +   NLFV +L+  +DD  L  
Sbjct: 159 GKEVEGKVLKINWA-------------FQSQQVNSDETF---NLFVGDLNVDVDDATLAG 202

Query: 338 EFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396
            F  + +     VM    +G+S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262

Query: 397 KDVRRSQLAQQ 407
           ++ ++SQ  Q+
Sbjct: 263 REPQQSQQGQR 273

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L+VG+L+  V +A L   F    S     V  D  +  S GY +V+F + +  + A+E 
Sbjct: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244

Query: 96  LNYTPIKGRLCRIMW-SQRDPALRKKG 121
                + GR  RI W S+R+P   ++G
Sbjct: 245 KQGFELNGRALRINWASKREPQQSQQG 271

>AEL217W [2289] [Homologous to ScYGR250C - SH]
           complement(225217..227721) [2505 bp, 834 aa]
          Length = 834

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 101/216 (46%), Gaps = 47/216 (21%)

Query: 123 GNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAID 181
           GN++I+ +  D+    L   FS FG +LS KI  D  T +S G+GF+ +   S A   I 
Sbjct: 217 GNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIK 276

Query: 182 ALNGMLLNGQEIYVAPHLTRKERDS-QLEETK-----AHFTNVYVKNINLETTDEEF--- 232
            LNG L+NG  +++  H+ RKER+   L+  K       F  V+V N+  E  D      
Sbjct: 277 ELNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDERFRGVFVGNLPTEYEDGTLITP 336

Query: 233 NELFAKYGNVL---------------SSSLE----------------------KTEDGKL 255
            ++F K+ ++L               ++++E                      + ED  L
Sbjct: 337 EQVFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCDSQNEDSPL 396

Query: 256 KGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRA 291
           KG+GF+ F  H+ A KA+++LN   +   +L V++A
Sbjct: 397 KGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVVNKA 432

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 51/98 (52%), Gaps = 17/98 (17%)

Query: 317 QGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDN----------------GKSKG 360
           Q  NL+VK++  S  DE L + ++ YG I S +++                    G S+G
Sbjct: 597 QESNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRG 656

Query: 361 FGFVCFSTPEEATKAITEKNQ-QIVAGKPLYVAIAQRK 397
           +GFVCF  P +A++A+   ++ Q+     LYV+ AQ++
Sbjct: 657 YGFVCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR 694

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 91/233 (39%), Gaps = 57/233 (24%)

Query: 206 SQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLK---GFGFVD 262
           SQ      H  N+Y++ I  + + ++   +F+K+G VLS  L+   DG  +   G+GF+ 
Sbjct: 207 SQNPHALTHPGNLYIRGIPKDLSVDDLIPIFSKFGTVLS--LKIIIDGNTRESLGYGFIS 264

Query: 263 FEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYER----MQELKKQYEASRLEKMAKYQG 318
           +     AA+ ++ELNG       LF++   ++ ER    +  LK+  +  R      ++G
Sbjct: 265 YPLGSQAARCIKELNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDER------FRG 318

Query: 319 VNLFVKNLDDSIDD----------EKLKEEFAPYGTITSVRVMRTDN------------- 355
           V  FV NL    +D           K      P   ++     R  N             
Sbjct: 319 V--FVGNLPTEYEDGTLITPEQVFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSP 376

Query: 356 -----------------GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
                               KG+GF+ FST + A KAI + N     G  L V
Sbjct: 377 TSSSKENAETCDSQNEDSPLKGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVV 429

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 52/96 (54%), Gaps = 17/96 (17%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSS----------------SLEKTEDGKLKGFG 259
           +N+YVK+I L   DE+ N+ +++YG ++S+                +LE    G  +G+G
Sbjct: 599 SNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRGYG 658

Query: 260 FVDFEKHEDAAKAVEELNGTEF-KDQTLFVSRAQKK 294
           FV F+   DA++A+   +  +   +  L+VS AQK+
Sbjct: 659 FVCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR 694

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 48/87 (55%), Gaps = 2/87 (2%)

Query: 320 NLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGK-SKGFGFVCFSTPEEATKAITE 378
           NL+++ +   +  + L   F+ +GT+ S++++   N + S G+GF+ +    +A + I E
Sbjct: 218 NLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKE 277

Query: 379 KNQQIVAGKPLYVAI-AQRKDVRRSQL 404
            N  ++ G PL++    +RK+  R  L
Sbjct: 278 LNGNLMNGSPLFINYHVERKERERIHL 304

 Score = 32.7 bits (73), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 16/83 (19%)

Query: 118 RKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT-----DETGKSK--------- 163
           R +   N+++K++     ++ L + +S +G I+S+KI T     +E G+SK         
Sbjct: 594 RDQQESNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGT 653

Query: 164 --GFGFVHFEHESSAKEAIDALN 184
             G+GFV F++   A  A+ A +
Sbjct: 654 SRGYGFVCFKNPLDASRAMMATD 676

>Scas_637.2
          Length = 377

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 135/309 (43%), Gaps = 31/309 (10%)

Query: 116 ALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESS 175
            + K     IFI NL  D   + L + FS  G ++++++ +   G+SKG G V F + + 
Sbjct: 71  GVEKHHENGIFIGNLSFDATEEDLRDFFSQVGEVVNAEVMS-YRGRSKGMGTVEFTNPAD 129

Query: 176 AKEAIDALNGMLLNGQEIYV----APHLTRKERDSQLEETKAHFTNVYVKNINLETTDEE 231
           A+EAI   NG+   G++I+V     P  +R+E  S  E T+  +   +V N+    T + 
Sbjct: 130 AEEAIRQYNGVPFMGRDIFVKQDQPPPGSRQEFKSS-EPTQQGY-EAFVVNLPYSITWQN 187

Query: 232 FNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRA 291
             ++F + G+V+ + +E   +G  +GFG V +   ED  KA++  NG E + + L V   
Sbjct: 188 LKDIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEVREG 247

Query: 292 QKKY----------------------ERMQELKKQYEASRLEKMAKYQGVN--LFVKNLD 327
           +  +                      E    L   +  S  E ++     N  ++  NL 
Sbjct: 248 KFNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSFTEGVSGDGERNNTVYCNNLP 307

Query: 328 DSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK 387
            S     L + F   G I    ++  + G S G   V +++ + A   I + N     G+
Sbjct: 308 LSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCINKLNGYNYGGR 367

Query: 388 PLYVAIAQR 396
            L++  A R
Sbjct: 368 DLHITYASR 376

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 119/301 (39%), Gaps = 48/301 (15%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           +++G L    +E  L D FS +G V +  V   +    S G   V F +    ++AI Q 
Sbjct: 80  IFIGNLSFDATEEDLRDFFSQVGEVVNAEVM--SYRGRSKGMGTVEFTNPADAEEAIRQY 137

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGN--------IFIKNLHPDIDNKALFETFSVFGN 148
           N  P  GR   +   Q  P  R++   +         F+ NL   I  + L + F   G+
Sbjct: 138 NGVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQQGYEAFVVNLPYSITWQNLKDIFRECGD 197

Query: 149 ILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV------------- 195
           ++ + +  D  G S+GFG V + +E    +AID+ NG  L G+ + V             
Sbjct: 198 VIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEVREGKFNHPRDTFD 257

Query: 196 ---------APHLTRKERDSQLEETKAH---FT-----------NVYVKNINLETTDEEF 232
                          KE +  L    AH   FT            VY  N+ L TT  + 
Sbjct: 258 DRRDFDDRRDFDDVPKEEEPVL--PPAHNPSFTEGVSGDGERNNTVYCNNLPLSTTVPDL 315

Query: 233 NELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQ 292
            +LF   G +  + L   E G   G   V++   + A   + +LNG  +  + L ++ A 
Sbjct: 316 YDLFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCINKLNGYNYGGRDLHITYAS 375

Query: 293 K 293
           +
Sbjct: 376 R 376

>YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein
           involved in mRNA export, binds poly(A)+ RNA and
           single-stranded G-strand telomere sequence, has three
           RNA recognition (RRM) domains [1284 bp, 427 aa]
          Length = 427

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 96/194 (49%), Gaps = 7/194 (3%)

Query: 199 LTRKERDSQLEETKAHFTN-VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKG 257
           +  ++ + Q + TK +F N ++V+N+  + T E+  ELF   G V+ + +  T  G  +G
Sbjct: 104 IVERDLERQFDATKRNFENSIFVRNLTFDCTPEDLKELFGTVGEVVEADI-ITSKGHHRG 162

Query: 258 FGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQ 317
            G V+F K+E    A+ + +G  F D+ L V +     E  +E  K+     ++      
Sbjct: 163 MGTVEFTKNESVQDAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEID-----N 217

Query: 318 GVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAIT 377
           G  +F+ NL  S++ + LK+ F   G +    V    NG S+GFG V + T +E  +AI 
Sbjct: 218 GFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAID 277

Query: 378 EKNQQIVAGKPLYV 391
             N   V G+ L V
Sbjct: 278 TFNGMEVEGRVLEV 291

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 136/321 (42%), Gaps = 49/321 (15%)

Query: 116 ALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESS 175
           A ++    +IF++NL  D   + L E F   G ++ + I T + G  +G G V F    S
Sbjct: 115 ATKRNFENSIFVRNLTFDCTPEDLKELFGTVGEVVEADIITSK-GHHRGMGTVEFTKNES 173

Query: 176 AKEAIDALNGMLLNGQEIYV-------------APHLTRKERDSQLEETKAHFTNVYVKN 222
            ++AI   +G L   +++ V             +   TR+E D+  E        V++ N
Sbjct: 174 VQDAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFE--------VFIIN 225

Query: 223 INLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFK 282
           +      +   ++F + G+VL + +E   +G  +GFG V +   ++  +A++  NG E +
Sbjct: 226 LPYSMNWQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVE 285

Query: 283 DQTLFVSRAQ----KKYERMQELKKQYEASR--------------LEKMAKY-QGVN--- 320
            + L V   +    K  +R  + ++  E +R               E  AK+ +GVN   
Sbjct: 286 GRVLEVREGRFNKRKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGG 345

Query: 321 -----LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKA 375
                ++  NL  S     L + F P G I +  +   +NG+  G   V +    +A   
Sbjct: 346 DRNCFIYCSNLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFC 405

Query: 376 ITEKNQQIVAGKPLYVAIAQR 396
           I + N     G  L ++ A+R
Sbjct: 406 IQKLNNYNYGGCSLQISYARR 426

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 126/310 (40%), Gaps = 58/310 (18%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTS--LGYAYVNFNDHEAGKKAI 93
           S++V  L    +   L ++F  +G V    V  D +T      G   V F  +E+ + AI
Sbjct: 123 SIFVRNLTFDCTPEDLKELFGTVGEV----VEADIITSKGHHRGMGTVEFTKNESVQDAI 178

Query: 94  EQLNYTPIKGRLCRIMWSQRDP------ALRKKGSGN-------IFIKNLHPDIDNKALF 140
            + +      R  ++M  Q +P         KK +         +FI NL   ++ ++L 
Sbjct: 179 SKFDGALFMDR--KLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLK 236

Query: 141 ETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQ--EIYVAPH 198
           + F   G++L + +  D  G S+GFG V +  E     AID  NGM + G+  E+     
Sbjct: 237 DMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRF 296

Query: 199 LTRKERDS------------------------QLEETKAHFTN-----------VYVKNI 223
             RK  D                          ++ET A FT            +Y  N+
Sbjct: 297 NKRKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNL 356

Query: 224 NLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKD 283
              T   +  +LF   G + ++ L+  E+G+  G   V++E   DA   +++LN   +  
Sbjct: 357 PFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGG 416

Query: 284 QTLFVSRAQK 293
            +L +S A++
Sbjct: 417 CSLQISYARR 426

>Kwal_27.11447
          Length = 439

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 90/160 (56%), Gaps = 2/160 (1%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           LYVG LD  V+E +L   F   G+++++++  D   K +  YA+V F+       A + L
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEA-NYAFVEFHQPHDASVAFQTL 122

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           +   I+  + +I ++ +   +  + + N+F+ +L+ D+D++ L  TF      + + +  
Sbjct: 123 DGKQIENHVIKINYAFQSQQVSSEDTFNLFVGDLNVDVDDETLANTFKHVPTFIQAHVMW 182

Query: 157 D-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
           D +TG+S+G+GFV F  +  A++A++   G ++NG+ I +
Sbjct: 183 DMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRI 222

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 88/182 (48%), Gaps = 17/182 (9%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277
           +YV N++L  T++   + F   G + +  +   ++ K   + FV+F +  DA+ A + L+
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEANYAFVEFHQPHDASVAFQTLD 123

Query: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKE 337
           G + ++  + ++ A +                 ++++     NLFV +L+  +DDE L  
Sbjct: 124 GKQIENHVIKINYAFQS----------------QQVSSEDTFNLFVGDLNVDVDDETLAN 167

Query: 338 EFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396
            F    T     VM     G+S+G+GFV F    +A KA+ EK   +V G+ + +  A +
Sbjct: 168 TFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRINWASK 227

Query: 397 KD 398
           ++
Sbjct: 228 RE 229

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L+VG+L+  V +  L + F  + +     V  D  T  S GY +V+F +    +KA+E+
Sbjct: 150 NLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEE 209

Query: 96  LNYTPIKGRLCRIMWSQR 113
              T + GR  RI W+ +
Sbjct: 210 KQGTVVNGRAIRINWASK 227

>Kwal_55.20154
          Length = 522

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/317 (24%), Positives = 140/317 (44%), Gaps = 58/317 (18%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVS-SIRVCRDAVTK-TSLGYAYVNFNDHEAGKKAI 93
           SLY+G+LDP   EA +  +++ +G  +  I++ R + +   + GY +V F  H     A+
Sbjct: 46  SLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHNSGYCFVEFPSHTNASNAL 105

Query: 94  EQLNYT-PIKG-RLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETF-SVFGNIL 150
            +     P  G R+ ++ W+    A       ++F+ ++ P++    LFE F S + + L
Sbjct: 106 LKNGLVIPNTGNRILKLNWASF--ATTPGNEYSVFVGDVAPNVTEAQLFELFISRYASTL 163

Query: 151 SSKIATDE-TGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV-------------- 195
           ++KI  D+ TG SKG+GFV F  ES  + ++  + G+ LNG+ I V              
Sbjct: 164 NAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRAIRVSTTSKNRPKFQQVQ 223

Query: 196 ------------------APHLTRKERDSQL-----------EETKAHFTNVYVKNINLE 226
                             AP     +  SQ            + T  + T V++  ++  
Sbjct: 224 PPLQQQQHQQHAFAKHSHAPQFNAVQPQSQFIYPVQQQPTLTQYTDPNNTTVFIGGLSSL 283

Query: 227 TTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTL 286
            T++E    F  +G+++     K   G  KG GFV +     A  A+ ++ G    +  +
Sbjct: 284 VTEDELRAFFQPFGSIV---YVKIPVG--KGCGFVQYVDRLSAETAIAKMQGFPIGNSRI 338

Query: 287 FVS--RAQKKYERMQEL 301
            +S  R+ K+   MQ++
Sbjct: 339 RLSWGRSAKQAAVMQKV 355

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 66/332 (19%), Positives = 140/332 (42%), Gaps = 57/332 (17%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFG--NILSSKI-ATDETGKSKGFGFVHFEHESSAKE 178
           S ++++ +L P+ D  A+   ++  G  N+    I ++   G + G+ FV F   ++A  
Sbjct: 44  SNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHNSGYCFVEFPSHTNAS- 102

Query: 179 AIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELF-A 237
                N +L NG  I    +   K   +    T  +  +V+V ++    T+ +  ELF +
Sbjct: 103 -----NALLKNGLVIPNTGNRILKLNWASFATTPGNEYSVFVGDVAPNVTEAQLFELFIS 157

Query: 238 KYGNVLSSSLEKTE-DGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYE 296
           +Y + L++ +   +  G  KG+GFV F +  +  +++ E+ G     + + VS   K   
Sbjct: 158 RYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRAIRVSTTSKNRP 217

Query: 297 RMQELKKQ------------------------------YEASRLEKMAKYQGVN---LFV 323
           + Q+++                                Y   +   + +Y   N   +F+
Sbjct: 218 KFQQVQPPLQQQQHQQHAFAKHSHAPQFNAVQPQSQFIYPVQQQPTLTQYTDPNNTTVFI 277

Query: 324 KNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQI 383
             L   + +++L+  F P+G+I  V++        KG GFV +     A  AI +     
Sbjct: 278 GGLSSLVTEDELRAFFQPFGSIVYVKI-----PVGKGCGFVQYVDRLSAETAIAK----- 327

Query: 384 VAGKPL---YVAIAQRKDVRRSQLAQQIQART 412
           + G P+    + ++  +  +++ + Q++ A T
Sbjct: 328 MQGFPIGNSRIRLSWGRSAKQAAVMQKVYAST 359

>Scas_635.7
          Length = 581

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 94/175 (53%), Gaps = 13/175 (7%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDAL 183
           +FI  L+ +     L   FS +GN++  KI  D  TG+S+GFGF+ FE+ SS  E +   
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 184 NGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVL 243
           +  +L+G+ I     + R+E+D   +        ++V  I  +   +EF + FA+YG ++
Sbjct: 258 H--ILDGKVIDPKRSIPREEQDKTGK--------IFVGGIGTDVRPKEFEDFFAQYGTII 307

Query: 244 SSSLEKTED-GKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYER 297
            + L   +D G+ +GFGFV ++   DA   V +    EFK + + + RA+ ++ +
Sbjct: 308 DAQLMLDKDTGRSRGFGFVTYDSG-DAVDRVCQNKYIEFKGKQIEIKRAEPRHNQ 361

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 93/193 (48%), Gaps = 23/193 (11%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKT-EDGKLKGFGFVDFEKHEDAAKAVEEL 276
           +++  +N ETT++     F+KYGNV+   + K    G+ +GFGF+ FE       +V+E+
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFEN----PSSVDEV 253

Query: 277 NGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLK 336
                K Q +   +       + + K+       +K  K     +FV  +   +  ++ +
Sbjct: 254 ----VKTQHILDGK-------VIDPKRSIPREEQDKTGK-----IFVGGIGTDVRPKEFE 297

Query: 337 EEFAPYGTITSVRVM-RTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 395
           + FA YGTI   ++M   D G+S+GFGFV + + +   +    K  +   GK + +  A+
Sbjct: 298 DFFAQYGTIIDAQLMLDKDTGRSRGFGFVTYDSGDAVDRVCQNKYIEF-KGKQIEIKRAE 356

Query: 396 RKDVRRSQLAQQI 408
            +  +R+  +Q +
Sbjct: 357 PRHNQRAAASQPM 369

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 80/148 (54%), Gaps = 9/148 (6%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           +++G L+   +E  L + FS  G+V  +++ +D  T  S G+ ++ F +  +  + ++  
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           +   + G++  I   +  P   +  +G IF+  +  D+  K   + F+ +G I+ +++  
Sbjct: 258 HI--LDGKV--IDPKRSIPREEQDKTGKIFVGGIGTDVRPKEFEDFFAQYGTIIDAQLML 313

Query: 157 D-ETGKSKGFGFVHFEHESSAKEAIDAL 183
           D +TG+S+GFGFV ++    + +A+D +
Sbjct: 314 DKDTGRSRGFGFVTYD----SGDAVDRV 337

>Kwal_56.24709
          Length = 828

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 101/246 (41%), Gaps = 51/246 (20%)

Query: 92  AIEQLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILS 151
           A+  L  +PI  +     WS    A      GN++++ +  D+    L   FS FG +LS
Sbjct: 215 AVAALRASPIVSK-----WSVSVNAHALTHPGNLYVRGIPKDLTIDDLVPVFSKFGPVLS 269

Query: 152 SKIATD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDS---- 206
            KI  D  +G S G+GF+ +   S A   I  LNG L+NG  +++  H+ RKER+     
Sbjct: 270 LKIICDSHSGDSLGYGFLSYPLGSQASRCIKELNGNLMNGSALFINYHVERKERERIHWD 329

Query: 207 --QLEETKAHFTNVYVKNINLETTDEEF---NELFAKYGNVLSS---------------- 245
             + +     F  V++ N+     D        + AK+ + L S                
Sbjct: 330 HFKEDNDDDRFKGVFIGNLPTNHPDGSLVTPEHVIAKFQDQLRSKGEQPVHIVSYYLPKR 389

Query: 246 --------------------SLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQT 285
                                + K E+  LKG+GF+ F  H+ A  A++  N  E+    
Sbjct: 390 NSESDIEYRDDDDKTDDIETCISKHEESPLKGYGFIKFVSHDQALTAIDLFNNFEWLGNK 449

Query: 286 LFVSRA 291
           L V++A
Sbjct: 450 LVVNKA 455

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 22/102 (21%)

Query: 317 QGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDN-------------------GK 357
           Q  NL+VK+L  S  DE   + +  +G I S +++                       G 
Sbjct: 608 QESNLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGS 667

Query: 358 SKGFGFVCFSTPEEATKA--ITEKNQQIVAGKPLYVAIAQRK 397
           SKG+GFVCF  P +A++A  IT++  Q+     LYV+ AQ++
Sbjct: 668 SKGYGFVCFKNPLDASRAMMITDR-YQVDENHTLYVSFAQKR 708

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 62/123 (50%), Gaps = 5/123 (4%)

Query: 214 HFTNVYVKNINLETTDEEFNELFAKYGNVLS-SSLEKTEDGKLKGFGFVDFEKHEDAAKA 272
           H  N+YV+ I  + T ++   +F+K+G VLS   +  +  G   G+GF+ +     A++ 
Sbjct: 239 HPGNLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRC 298

Query: 273 VEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDD 332
           ++ELNG       LF++   ++ ER +     ++    +   +++GV  F+ NL  +  D
Sbjct: 299 IKELNGNLMNGSALFINYHVERKERERIHWDHFKEDNDDD--RFKGV--FIGNLPTNHPD 354

Query: 333 EKL 335
             L
Sbjct: 355 GSL 357

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 52/99 (52%), Gaps = 20/99 (20%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKT---------EDGKL----------K 256
           +N+YVK++ +   DE+F + +  +G ++S+ +            EDG            K
Sbjct: 610 SNLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGSSK 669

Query: 257 GFGFVDFEKHEDAAKAVEELNGTEF-KDQTLFVSRAQKK 294
           G+GFV F+   DA++A+   +  +  ++ TL+VS AQK+
Sbjct: 670 GYGFVCFKNPLDASRAMMITDRYQVDENHTLYVSFAQKR 708

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 78/216 (36%), Gaps = 57/216 (26%)

Query: 34  PASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
           P +LYV  +   ++   L  +FS  G V S+++  D+ +  SLGY ++++       + I
Sbjct: 240 PGNLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCI 299

Query: 94  EQLNYTPIKGRLC------------RIMWS---QRDPALRKKGSGNIFIKNL---HPDID 135
           ++LN   + G               RI W    + +   R KG   +FI NL   HPD  
Sbjct: 300 KELNGNLMNGSALFINYHVERKERERIHWDHFKEDNDDDRFKG---VFIGNLPTNHPDGS 356

Query: 136 NKALFETFSVFGNILSSK------------------------------------IATDET 159
                   + F + L SK                                    I+  E 
Sbjct: 357 LVTPEHVIAKFQDQLRSKGEQPVHIVSYYLPKRNSESDIEYRDDDDKTDDIETCISKHEE 416

Query: 160 GKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
              KG+GF+ F     A  AID  N     G ++ V
Sbjct: 417 SPLKGYGFIKFVSHDQALTAIDLFNNFEWLGNKLVV 452

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 25/84 (29%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIAT-------------------DETGKSKG 164
           N+++K+L     ++  F+ +  FG I+S+KI T                      G SKG
Sbjct: 611 NLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGSSKG 670

Query: 165 FGFVHFEHESSAKEAIDALNGMLL 188
           +GFV F      K  +DA   M++
Sbjct: 671 YGFVCF------KNPLDASRAMMI 688

>Scas_645.14
          Length = 717

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 95/221 (42%), Gaps = 35/221 (15%)

Query: 106 CRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSK-- 163
           C   WS           GNIFI  ++  ID   +   F  FG+ILS K+  D    S   
Sbjct: 164 CIEKWSISINKHALTHPGNIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTN 223

Query: 164 --------GFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERD----SQLEET 211
                   G+GF+ F   S A E I+  NG ++ G ++++  H+ RKER+    S ++E 
Sbjct: 224 NSTSSNPIGYGFISFVLGSQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKEN 283

Query: 212 K--AHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTE------------------ 251
                F  +++ N+    TD   + +  K    LS  L   +                  
Sbjct: 284 NDDEKFKCIFIGNLPTTLTDLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINN 343

Query: 252 -DGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRA 291
               LKG+GFV+   HE A K ++ L+G E+K   L V++A
Sbjct: 344 KSSPLKGYGFVNLGSHEQALKVIQTLDGLEWKGNRLVVNKA 384

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 51/242 (21%), Positives = 104/242 (42%), Gaps = 46/242 (19%)

Query: 170 FEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTD 229
           F +E+  ++  D+++   L+ +E    P+   K   S  +    H  N+++  IN +  +
Sbjct: 136 FHNEAKLEKCRDSID-TFLHSKEDPSFPNCIEKWSISINKHALTHPGNIFIGGINHKIDE 194

Query: 230 EEFNELFAKYGNVLSSSL----------EKTEDGKLKGFGFVDFEKHEDAAKAVEELNGT 279
            +   LF K+G++LS  L            +      G+GF+ F     A++ + E NG 
Sbjct: 195 SKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLGSQASECINEFNGK 254

Query: 280 EFKDQTLFVSRA--QKKYERMQ--ELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDD--- 332
             +   LF++    +K+ ER+Q   +K+  +  + +         +F+ NL  ++ D   
Sbjct: 255 IIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFKC--------IFIGNLPTTLTDLTI 306

Query: 333 ----EKLKEEFAPYGTITSVRVMR--------------TDNGKSKGFGFVCFSTPEEATK 374
               +K+K E +    + S++++                 +   KG+GFV   + E+A K
Sbjct: 307 DLILDKIKTELS--EVLPSLQILSYYFPQSKNVNNNINNKSSPLKGYGFVNLGSHEQALK 364

Query: 375 AI 376
            I
Sbjct: 365 VI 366

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 66/153 (43%), Gaps = 52/153 (33%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSL----------EKTEDGKL---------- 255
           +N+YVK+I L   D+E N+ F+++G+++SS +           + E+ K           
Sbjct: 524 SNLYVKHIPLSWRDDELNDFFSQFGDIISSKVITVGGSKKLDNQNENDKENQEEQEQEHN 583

Query: 256 -----------------------------KGFGFVDFEKHEDAAKAVEELNGTEFK-DQT 285
                                        +G+GFV FE   DA++A+   +G     +  
Sbjct: 584 DKNDQEVEEGGEEEEEEEDEDENLPVGFSRGYGFVCFENPLDASRAIMATDGVIISPNNI 643

Query: 286 LFVSRAQKKYERMQELKK--QYEASRLEKMAKY 316
           L VS AQK+Y+++ + K   +Y  + L+   K+
Sbjct: 644 LNVSFAQKRYKKLAKDKNTSEYNGNSLQFNKKF 676

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 54/131 (41%), Gaps = 50/131 (38%)

Query: 317 QGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVM------RTDN--------------- 355
           Q  NL+VK++  S  D++L + F+ +G I S +V+      + DN               
Sbjct: 522 QESNLYVKHIPLSWRDDELNDFFSQFGDIISSKVITVGGSKKLDNQNENDKENQEEQEQE 581

Query: 356 ----------------------------GKSKGFGFVCFSTPEEATKAITEKNQQIVA-G 386
                                       G S+G+GFVCF  P +A++AI   +  I++  
Sbjct: 582 HNDKNDQEVEEGGEEEEEEEDEDENLPVGFSRGYGFVCFENPLDASRAIMATDGVIISPN 641

Query: 387 KPLYVAIAQRK 397
             L V+ AQ++
Sbjct: 642 NILNVSFAQKR 652

 Score = 36.2 bits (82), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 38/202 (18%), Positives = 76/202 (37%), Gaps = 40/202 (19%)

Query: 34  PASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTS---------LGYAYVNFN 84
           P ++++G ++  + E+ +  +F   GS+ SI++  D +  ++         +GY +++F 
Sbjct: 180 PGNIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFV 239

Query: 85  DHEAGKKAIEQLNYTPIKGRLC------------RIMWSQRDPALRKKGSGNIFIKNLHP 132
                 + I + N   I+G               RI WS        +    IFI NL  
Sbjct: 240 LGSQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFKCIFIGNLPT 299

Query: 133 DIDNKALFETFSVFGNILSSKIAT-------------------DETGKSKGFGFVHFEHE 173
            + +  +          LS  + +                   +++   KG+GFV+    
Sbjct: 300 TLTDLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINNKSSPLKGYGFVNLGSH 359

Query: 174 SSAKEAIDALNGMLLNGQEIYV 195
             A + I  L+G+   G  + V
Sbjct: 360 EQALKVIQTLDGLEWKGNRLVV 381

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 159 TGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEI 193
            G S+G+GFV FE+   A  AI A +G++++   I
Sbjct: 609 VGFSRGYGFVCFENPLDASRAIMATDGVIISPNNI 643

>YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylated
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           [1605 bp, 534 aa]
          Length = 534

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 95/186 (51%), Gaps = 13/186 (6%)

Query: 112 QRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHF 170
           +R  A   K S  +FI  L+ D     L E F  +G +   KI  D  TG+S+GFGF+ F
Sbjct: 148 ERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSF 207

Query: 171 EHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDE 230
           E  SS  E +   +  +L+G+ I     + R E+D   +        ++V  I  +   +
Sbjct: 208 EKPSSVDEVVKTQH--ILDGKVIDPKRAIPRDEQDKTGK--------IFVGGIGPDVRPK 257

Query: 231 EFNELFAKYGNVLSSSLEKTED-GKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVS 289
           EF E F+++G ++ + L   +D G+ +GFGFV ++   DA   V +    +FKD+ + + 
Sbjct: 258 EFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDS-ADAVDRVCQNKFIDFKDRKIEIK 316

Query: 290 RAQKKY 295
           RA+ ++
Sbjct: 317 RAEPRH 322

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 81/150 (54%), Gaps = 9/150 (6%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
             +++G L+   +E  L + F   G+V+ +++ +D  T  S G+ +++F    +  + ++
Sbjct: 159 CKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVK 218

Query: 95  QLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKI 154
             +   + G++  I   +  P   +  +G IF+  + PD+  K   E FS +G I+ +++
Sbjct: 219 TQHI--LDGKV--IDPKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQL 274

Query: 155 ATD-ETGKSKGFGFVHFEHESSAKEAIDAL 183
             D +TG+S+GFGFV ++    + +A+D +
Sbjct: 275 MLDKDTGQSRGFGFVTYD----SADAVDRV 300

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 78/164 (47%), Gaps = 22/164 (13%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKT-EDGKLKGFGFVDFEKHEDAAKAVEEL 276
           +++  +N +TT++   E F KYG V    + K    G+ +GFGF+ FEK      +V+E+
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEK----PSSVDEV 216

Query: 277 NGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLK 336
                K Q +          ++ + K+       +K  K     +FV  +   +  ++ +
Sbjct: 217 ----VKTQHILDG-------KVIDPKRAIPRDEQDKTGK-----IFVGGIGPDVRPKEFE 260

Query: 337 EEFAPYGTITSVRVM-RTDNGKSKGFGFVCFSTPEEATKAITEK 379
           E F+ +GTI   ++M   D G+S+GFGFV + + +   +    K
Sbjct: 261 EFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNK 304

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 317 QGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTD-NGKSKGFGFVCFSTPEEATKA 375
           +   +F+  L+    ++ L+E F  YGT+T +++M+    G+S+GFGF+ F  P    + 
Sbjct: 157 ESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEV 216

Query: 376 ITEKNQQIVAGK 387
           +  K Q I+ GK
Sbjct: 217 V--KTQHILDGK 226

>ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH]
           complement(1238223..1239923) [1701 bp, 566 aa]
          Length = 566

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 94/174 (54%), Gaps = 9/174 (5%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVS-SIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           LY+G+LDP+ +E  +  I++ +G  +  +++ +++    + GY +V F  + A   A+ +
Sbjct: 54  LYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNLAATNALLK 113

Query: 96  LNYTPI---KGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETF-SVFGNILS 151
               PI     R  ++ W+    A       +IF+ +L P++    LFE F S + + L+
Sbjct: 114 TGL-PIPVDASRTLKLNWASF--ATTPGSEFSIFVGDLAPNVTESQLFELFISRYSSTLN 170

Query: 152 SKIATDE-TGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKER 204
           +KI  D+ TG SKG+GFV F +E+  + ++  + G+ LNG+ I V+     K R
Sbjct: 171 AKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKNKSR 224

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/297 (20%), Positives = 113/297 (38%), Gaps = 51/297 (17%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFG--NILSSKIATDETGKSKGFGFVHFEHESSAKEA 179
           S  +++ +L P      + + ++  G  N+    I     G + G+ FV F         
Sbjct: 51  STQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSN------ 104

Query: 180 IDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELF-AK 238
           + A N +L  G  I V    T K   +    T     +++V ++    T+ +  ELF ++
Sbjct: 105 LAATNALLKTGLPIPVDASRTLKLNWASFATTPGSEFSIFVGDLAPNVTESQLFELFISR 164

Query: 239 YGNVLSSSLEKTE-DGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYER 297
           Y + L++ +   +  G  KG+GFV F    +  +++ E+ G     + + VS   K   R
Sbjct: 165 YSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKNKSR 224

Query: 298 -----------------------------MQELKKQY-------EASRLEKMAKYQGVNL 321
                                        +Q L +Q        +   L + A      +
Sbjct: 225 FQSGNPASAAPASPASTAVNSPGLAQGSNVQTLLQQSQFIYPVQQQPALSQFADPNNTTV 284

Query: 322 FVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITE 378
           F+  L   + +++L+  F P+G I  V++        KG GFV +     A  AI +
Sbjct: 285 FIGGLSSLVTEDELRAYFQPFGQIVYVKIP-----VGKGCGFVQYVDRSSAENAIAK 336

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 84/221 (38%), Gaps = 58/221 (26%)

Query: 36  SLYVGELDPTVSEALLYDIF-SPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           S++VG+L P V+E+ L+++F S   S  + ++  D  T  S GY +V F +    ++++ 
Sbjct: 142 SIFVGDLAPNVTESQLFELFISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLL 201

Query: 95  QLNYTPIKGRLCRIMWS------------------------------------------- 111
           ++    + GR  R+  +                                           
Sbjct: 202 EMQGVFLNGRAIRVSTTSKNKSRFQSGNPASAAPASPASTAVNSPGLAQGSNVQTLLQQS 261

Query: 112 ------QRDPALRKKGSGN---IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKS 162
                 Q+ PAL +    N   +FI  L   +    L   F  FG I+  KI        
Sbjct: 262 QFIYPVQQQPALSQFADPNNTTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPV-----G 316

Query: 163 KGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKE 203
           KG GFV +   SSA+ AI  + G  +    + ++   + K+
Sbjct: 317 KGCGFVQYVDRSSAENAIAKMQGFPIGNSRVRLSWGRSAKQ 357

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 80/189 (42%), Gaps = 20/189 (10%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYG--NVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAV 273
           T +Y+ +++   T+ +  +++A  G  NV    ++ +  G   G+ FV+F  +  A  A 
Sbjct: 52  TQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNLAATNA- 110

Query: 274 EELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDE 333
                       L  +      +  + LK  + +      +++   ++FV +L  ++ + 
Sbjct: 111 ------------LLKTGLPIPVDASRTLKLNWASFATTPGSEF---SIFVGDLAPNVTES 155

Query: 334 KLKEEFAP--YGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           +L E F      T+ +  V     G SKG+GFV F    E  +++ E     + G+ + V
Sbjct: 156 QLFELFISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRV 215

Query: 392 AIAQRKDVR 400
           +   +   R
Sbjct: 216 STTSKNKSR 224

>ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH]
           complement(408687..410267) [1581 bp, 526 aa]
          Length = 526

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 80/136 (58%), Gaps = 5/136 (3%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           +++G L+   +E  L + FS  G+V+ +++ RD  T  S G+ +++F D  +  + ++  
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 224

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           +   + G++  I   + DP  R + +G IF+  + PD+  K   E FS +G+I+ +++  
Sbjct: 225 HI--LDGKV--IDPKESDPTGRARKAGKIFVAGIGPDVRPKEFEEFFSQWGSIIDAQLML 280

Query: 157 D-ETGKSKGFGFVHFE 171
           D +TG+S+GFGF+ ++
Sbjct: 281 DKDTGRSRGFGFITYD 296

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 80/164 (48%), Gaps = 22/164 (13%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKT-EDGKLKGFGFVDFEKHEDAAKAVEEL 276
           +++  +N ETT++   E F+KYGNV    + +    G+ +GFGF+ F      A +V+E+
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFAD----ASSVDEV 220

Query: 277 NGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLK 336
                K Q +          ++ + K+     R  K  K     +FV  +   +  ++ +
Sbjct: 221 ----VKTQHILDG-------KVIDPKESDPTGRARKAGK-----IFVAGIGPDVRPKEFE 264

Query: 337 EEFAPYGTITSVRVM-RTDNGKSKGFGFVCFSTPEEATKAITEK 379
           E F+ +G+I   ++M   D G+S+GFGF+ + +P+   +    K
Sbjct: 265 EFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDSPDAVDRVCQNK 308

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 40/68 (58%), Gaps = 3/68 (4%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRT-DNGKSKGFGFVCFSTPEEATKAITEK 379
           +F+  L+    ++ L+E F+ YG +T V++MR    G+S+GFGF+ F+      + +  K
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVV--K 222

Query: 380 NQQIVAGK 387
            Q I+ GK
Sbjct: 223 TQHILDGK 230

>AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C
           (GBP2) - SH] complement(309542..310555) [1014 bp, 337
           aa]
          Length = 337

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 90/189 (47%), Gaps = 3/189 (1%)

Query: 211 TKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAA 270
           ++ +  +V++ N+  +TT E+  +LF + G+V+ + +  T  G  +G G V++   +D  
Sbjct: 2   SRNYSNSVFIGNLTYDTTPEDLRQLFGEVGHVVRADI-ITSRGHHRGMGTVEYTNAQDVD 60

Query: 271 KAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSI 330
           +A+   NG +F  + LFV R       + E +++     L +     G  +FV NL  SI
Sbjct: 61  EAIRRFNGMDFMHRELFVRRDNPP--PVGERRERRGPGPLPRRTHPGGFEIFVANLPYSI 118

Query: 331 DDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 390
             + LK+ F     +    V    +G S+GFG V  +T E    AI   N   + G+ L 
Sbjct: 119 SWQTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEGRILE 178

Query: 391 VAIAQRKDV 399
           V   +  DV
Sbjct: 179 VREGKGTDV 187

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 68/334 (20%), Positives = 118/334 (35%), Gaps = 85/334 (25%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTS--LGYAYVNFNDHEAGKKAI 93
           S+++G L    +   L  +F  +G V    V  D +T      G   V + + +   +AI
Sbjct: 8   SVFIGNLTYDTTPEDLRQLFGEVGHV----VRADIITSRGHHRGMGTVEYTNAQDVDEAI 63

Query: 94  EQLNYTPIKGRLCRIMWSQRD-----------------PALRKKGSGNIFIKNLHPDIDN 136
            + N       + R ++ +RD                 P     G   IF+ NL   I  
Sbjct: 64  RRFNGMDF---MHRELFVRRDNPPPVGERRERRGPGPLPRRTHPGGFEIFVANLPYSISW 120

Query: 137 KALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAID-----ALNGMLLNGQ 191
           + L + F     ++ + ++ D  G S+GFG V+     +   AI+      L G +L  +
Sbjct: 121 QTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEGRILEVR 180

Query: 192 E-------------IYVAPHLTRKERDSQLEETKAH------------------------ 214
           E              YV   +   + D +   T+                          
Sbjct: 181 EGKGTDVGSAGRGDSYVPKQIPSYDYDGEYRGTEVRAELPHSENASVSVSGKASPEYEQY 240

Query: 215 ------FTN-----------VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKG 257
                 FT+           +Y +N+ L T + +  +LF   G VL ++L+   +G   G
Sbjct: 241 TPSDVEFTSKAAPGGAKNRIIYCENMPLATAESDLYDLFETAGKVLRANLQYDSEGNPTG 300

Query: 258 FGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRA 291
               +FE   DA + +E LN   +    L +S A
Sbjct: 301 SSVCEFETVADAQECIERLNNYHYGGCDLKMSYA 334

>Kwal_23.3985
          Length = 876

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 98/200 (49%), Gaps = 11/200 (5%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGK------SKGFGFVHFEHESSAK 177
           +IF+KNL+     K L E F  FG  + +++ T    K      S GFGF  F+    A 
Sbjct: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709

Query: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFA 237
             IDA++G +L+G  I +     +  + S   ++K     + VKN+  E   ++  ELF+
Sbjct: 710 AVIDAMDGAVLDGHRIQLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFELFS 769

Query: 238 KYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYER 297
            +G + S  L K  D   +GF FV+F   ++A  A+E+L G     + L +  A+++ + 
Sbjct: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQD 829

Query: 298 MQELKKQYEASRLEKMAKYQ 317
            +E     + +R+ K  + Q
Sbjct: 830 AEE-----QIARMTKKVRSQ 844

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 88/186 (47%), Gaps = 16/186 (8%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGK------LKGFGFVDFEKHEDA 269
            +++VKN+N  TT +E  E F  +G  + + ++   D K        GFGF +F+  E A
Sbjct: 649 VSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQA 708

Query: 270 AKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDS 329
              ++ ++G       L   R Q K        +Q   S     +K     + VKNL   
Sbjct: 709 LAVIDAMDGA-----VLDGHRIQLKLSH-----RQGGQSSSSGKSKKGTGKIIVKNLPFE 758

Query: 330 IDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
           ++ +++ E F+ +G + SVR+ +  +  ++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 759 VERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRL 818

Query: 390 YVAIAQ 395
            +  A+
Sbjct: 819 VMQHAE 824

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPEEATKAITEK 379
           LF++N+  +  ++  ++ FAP+G +  V V + T  GKSKGF +V F  P +A  A  E 
Sbjct: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394

Query: 380 NQQIVAGKPLYVAIAQRKDVRR 401
           ++QI  G+ L++   ++K   R
Sbjct: 395 DKQIFQGRLLHILPGEQKKSHR 416

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 83/183 (45%), Gaps = 12/183 (6%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGS--VSSIRVCRDA--VTKT-SLGYAYVNFNDHEAGK 90
           S++V  L+ + +   L + F   G   V+ ++   D     KT S+G+ +  F   E   
Sbjct: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709

Query: 91  KAIEQLNYTPIKGRLCRIMWSQRDPALRKKGSGN------IFIKNLHPDIDNKALFETFS 144
             I+ ++   + G   ++  S R          +      I +KNL  +++ K +FE FS
Sbjct: 710 AVIDAMDGAVLDGHRIQLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFELFS 769

Query: 145 VFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKER 204
            FG + S ++       ++GF FV F     A+ A++ L G+ L G+ + V  H   + +
Sbjct: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRL-VMQHAEEEPQ 828

Query: 205 DSQ 207
           D++
Sbjct: 829 DAE 831

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 98/423 (23%), Positives = 159/423 (37%), Gaps = 88/423 (20%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L++  +  T +E     +F+P G +  + V  D  T  S G+AYV F +      A  +L
Sbjct: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGS--GNIFIKNL----HPDIDNKA-----LFETFSV 145
           +    +GRL  I+     P  +KK        +KNL       +  KA      F   S+
Sbjct: 395 DKQIFQGRLLHIL-----PGEQKKSHRLDEFDLKNLPLKKQRSLKRKANASHDTFSWNSL 449

Query: 146 FGN---ILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN------------GMLLNG 190
           + N   +L S  A  + G  K       +  ++ K+A+   +            GM L  
Sbjct: 450 YMNQDAVLGSVAA--KLGVQKSDLIDATDASAAVKQALAEAHVIGDVRKYFESKGMDLTK 507

Query: 191 QEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKT 250
            E + +P     +RD          T + VKN    TT  E  +LF  +G +    L   
Sbjct: 508 FEQFKSP----SDRDD---------TVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPA 554

Query: 251 EDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFV--------SRAQKKYERM---- 298
           +         V +     A  A  +L+   FKD  L++        SR  +  E M    
Sbjct: 555 Q-----TIAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGPKNCFSREPEGDETMVDEI 609

Query: 299 --------------QELKKQYEASRLEKMAKYQ-----GVNLFVKNLDDSIDDEKLKEEF 339
                          E+ +   AS+ E            V++FVKNL+ S   ++L E+F
Sbjct: 610 VAQSTNVKEARTTGDEIMQTATASKPEDDGTDDVVDGPTVSIFVKNLNFSTTGKELTEKF 669

Query: 340 APYGTITSVRVMRTDNGK------SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 393
             +G     +V    + K      S GFGF  F T E+A   I   +  ++ G  + + +
Sbjct: 670 KTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKL 729

Query: 394 AQR 396
           + R
Sbjct: 730 SHR 732

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 120 KGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKE 178
           + +G +F++N+          + F+ FG +    +A D  TGKSKGF +V F++   A  
Sbjct: 330 EATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAAN 389

Query: 179 AIDALNGMLLNGQEIYVAP 197
           A   L+  +  G+ +++ P
Sbjct: 390 AYVELDKQIFQGRLLHILP 408

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 43/86 (50%), Gaps = 11/86 (12%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPY-----------GTITSVRVMRTDNGKSKGFGFVCFSTP 369
           + VK +   + ++KLK+ F               ++T V++++   G+S+ F FV F + 
Sbjct: 4   VIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGFKSE 63

Query: 370 EEATKAITEKNQQIVAGKPLYVAIAQ 395
           E+A  A+   +Q  +    + V++A+
Sbjct: 64  EDAFDAVNYFDQSFIDTSKIEVSMAK 89

>Scas_558.1
          Length = 435

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 100/212 (47%), Gaps = 18/212 (8%)

Query: 196 APHLTRKERDSQLEE--TKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDG 253
            P L R E DS  EE   + +  +++V N+  + T E+  + F+  G V+ + +  T  G
Sbjct: 84  GPVLAR-ELDSTYEEKVNRNYANSIFVGNLTYDCTPEDLRDYFSGIGEVVRADI-ITSKG 141

Query: 254 KLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQ-----KKYERMQELKKQYEAS 308
             +G G V+F    D  +A+ + + + F D+ +FV +        + ER    +    +S
Sbjct: 142 HHRGMGTVEFTNSRDVEEAIRQYDSSYFMDRQIFVRQDNPPPDNGRNERTPSRRTTAPSS 201

Query: 309 RLEKMAK---------YQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSK 359
           R + ++           QG  +FV NL  SI+ + LK+ F   G +    V     G+S+
Sbjct: 202 RQQDISSGAYSMQSNMKQGYEIFVANLPYSINWQALKDMFKECGDVMRADVELDRAGRSR 261

Query: 360 GFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           GFG V F T ++  +AI   N+  V G+ L V
Sbjct: 262 GFGTVIFRTRDDMERAIDRYNRFEVDGRTLDV 293

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 79/377 (20%), Positives = 146/377 (38%), Gaps = 63/377 (16%)

Query: 78  YAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNK 137
           Y     +D   G     + +Y P+   L R + S  +  + +  + +IF+ NL  D   +
Sbjct: 63  YRSRGVDDRRRGPSRYAKGDYGPV---LARELDSTYEEKVNRNYANSIFVGNLTYDCTPE 119

Query: 138 ALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVA- 196
            L + FS  G ++ + I T + G  +G G V F +    +EAI   +      ++I+V  
Sbjct: 120 DLRDYFSGIGEVVRADIITSK-GHHRGMGTVEFTNSRDVEEAIRQYDSSYFMDRQIFVRQ 178

Query: 197 ----PHLTRKER----------DSQLEETKAHFT---------NVYVKNINLETTDEEFN 233
               P   R ER            Q + +   ++          ++V N+      +   
Sbjct: 179 DNPPPDNGRNERTPSRRTTAPSSRQQDISSGAYSMQSNMKQGYEIFVANLPYSINWQALK 238

Query: 234 ELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQK 293
           ++F + G+V+ + +E    G+ +GFG V F   +D  +A++  N  E   +TL V R   
Sbjct: 239 DMFKECGDVMRADVELDRAGRSRGFGTVIFRTRDDMERAIDRYNRFEVDGRTLDV-REGH 297

Query: 294 KYERMQELKKQY------------EASRLEKMAKYQ--------------GVN------- 320
              R  ++  Q+            +A+  E+    Q              GV        
Sbjct: 298 SNNRNDDMNIQHQTQNAMTNDATSDATSNERSLPTQPSEPASNRTSTFTEGVVEGGERNT 357

Query: 321 -LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEK 379
            ++  NL  S     L + F   G + +  +    NG++ G   V F + ++A   I   
Sbjct: 358 LIYCSNLPPSTARSDLYDLFESIGKVRNAELKYDRNGETTGVAIVEFISQDDADVCIERL 417

Query: 380 NQQIVAGKPLYVAIAQR 396
           N+    G  L ++ A+R
Sbjct: 418 NKYNYGGCDLEISYAKR 434

>Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement
          Length = 464

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 128/318 (40%), Gaps = 30/318 (9%)

Query: 104 RLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSK 163
           RL R + S  +  + +  S +IF+ NL  D   + L E FS  G ++ + I T   G  +
Sbjct: 143 RLARELDSTYEEKMNRNYSNSIFVGNLTYDCQPEDLKEYFSQIGEVVRADIIT-SRGHHR 201

Query: 164 GFGFVHFEHESSAKEAIDALNGMLLNGQEIYV-----APHLTRKERDSQLEETKAHF--T 216
           G G V F +     EAI   +G  L  +EI+V      P   R     +    +A     
Sbjct: 202 GMGTVEFTNADDVDEAIRRFDGSTLLDREIFVRQDNPPPESMRAPPRERRPRIQASAPGY 261

Query: 217 NVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEEL 276
            V++ N+      +   ++F + G+VL + ++   DG  +G+G V ++  E+   A+E  
Sbjct: 262 EVFIANLPYSVNWQALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVAIERY 321

Query: 277 NGTEFKDQTLFVSRAQ----------------KKYERMQELKKQYEAS---RLEKMAK-- 315
           NG E + + L V   +                +  E + +   Q   S      +MA   
Sbjct: 322 NGYELEGRVLDVHEGKLGPASEHQQQQEQFQPQDDEPVLDFAPQIHESLNTEFTEMATGG 381

Query: 316 -YQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATK 374
             Q   +FV NL  S     L + F   G +    +    NGK  G   V +  P +A  
Sbjct: 382 GDQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEV 441

Query: 375 AITEKNQQIVAGKPLYVA 392
            I+  N     G+ L ++
Sbjct: 442 CISRLNSYNYGGRDLDIS 459

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 93/198 (46%), Gaps = 7/198 (3%)

Query: 196 APHLTRKERDSQLEE--TKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDG 253
            P L R E DS  EE   + +  +++V N+  +   E+  E F++ G V+ + +  T  G
Sbjct: 141 GPRLAR-ELDSTYEEKMNRNYSNSIFVGNLTYDCQPEDLKEYFSQIGEVVRADI-ITSRG 198

Query: 254 KLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKM 313
             +G G V+F   +D  +A+   +G+   D+ +FV +     E M+   +     R    
Sbjct: 199 HHRGMGTVEFTNADDVDEAIRRFDGSTLLDREIFVRQDNPPPESMRAPPR---ERRPRIQ 255

Query: 314 AKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEAT 373
           A   G  +F+ NL  S++ + LK+ F   G +    V    +G S+G+G V + T EE  
Sbjct: 256 ASAPGYEVFIANLPYSVNWQALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQ 315

Query: 374 KAITEKNQQIVAGKPLYV 391
            AI   N   + G+ L V
Sbjct: 316 VAIERYNGYELEGRVLDV 333

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/304 (21%), Positives = 120/304 (39%), Gaps = 57/304 (18%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTS--LGYAYVNFNDHEAGKKAI 93
           S++VG L        L + FS IG V    V  D +T      G   V F + +   +AI
Sbjct: 163 SIFVGNLTYDCQPEDLKEYFSQIGEV----VRADIITSRGHHRGMGTVEFTNADDVDEAI 218

Query: 94  EQLNYTPIKGRLCRIMWSQRDP--------------ALRKKGSG-NIFIKNLHPDIDNKA 138
            + + + +  R   I   Q +P               ++    G  +FI NL   ++ +A
Sbjct: 219 RRFDGSTLLDR--EIFVRQDNPPPESMRAPPRERRPRIQASAPGYEVFIANLPYSVNWQA 276

Query: 139 LFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV--- 195
           L + F   G++L + +  D  G S+G+G V+++ +   + AI+  NG  L G+ + V   
Sbjct: 277 LKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVAIERYNGYELEGRVLDVHEG 336

Query: 196 --------------------------APHLTRKERDSQLEETKA----HFTNVYVKNINL 225
                                     AP +  +  +++  E         + ++V N+  
Sbjct: 337 KLGPASEHQQQQEQFQPQDDEPVLDFAPQI-HESLNTEFTEMATGGGDQSSTIFVDNLPW 395

Query: 226 ETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQT 285
            T   +  +LF   G V  + L+   +GK  G   V+++   DA   +  LN   +  + 
Sbjct: 396 STAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEVCISRLNSYNYGGRD 455

Query: 286 LFVS 289
           L +S
Sbjct: 456 LDIS 459

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 297 RMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNG 356
           R   L ++ +++  EKM +    ++FV NL      E LKE F+  G +    ++ T  G
Sbjct: 140 RGPRLARELDSTYEEKMNRNYSNSIFVGNLTYDCQPEDLKEYFSQIGEVVRADII-TSRG 198

Query: 357 KSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
             +G G V F+  ++  +AI   +   +  + ++V
Sbjct: 199 HHRGMGTVEFTNADDVDEAIRRFDGSTLLDREIFV 233

>KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1 CF Ib (RNA3
           Cleavage factor Ib), hypothetical start
          Length = 570

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 102/193 (52%), Gaps = 18/193 (9%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAIDAL 183
           +FI  L+ +   + L + FS +G +   KI  D  TG+S+GFGF+ FE+ SS  E +   
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 184 NGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVL 243
           +  +L+G+ I     + R+E+D   +        ++V  I  +   +EF E F+++G+++
Sbjct: 248 H--ILDGKVIDPKRAIPREEQDKTGK--------IFVGGIGPDVRPKEFEEFFSQWGSII 297

Query: 244 SSSLEKTED-GKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELK 302
            + L   +D G+ +GFGF+ ++   DA   V +    EFK + + + RA+ +     +L+
Sbjct: 298 DAQLMLDKDTGRSRGFGFITYDT-PDAVDRVCQNKFIEFKGKQIEIKRAEPR-----QLQ 351

Query: 303 KQYEASRLEKMAK 315
           KQ +    + M +
Sbjct: 352 KQKQPQMTQPMGQ 364

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 77/136 (56%), Gaps = 5/136 (3%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           +++G L+   +E  L D FS  G+V+ +++ +D  T  S G+ ++ F +  +  + ++  
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           +   + G++  I   +  P   +  +G IF+  + PD+  K   E FS +G+I+ +++  
Sbjct: 248 HI--LDGKV--IDPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLML 303

Query: 157 D-ETGKSKGFGFVHFE 171
           D +TG+S+GFGF+ ++
Sbjct: 304 DKDTGRSRGFGFITYD 319

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 108/246 (43%), Gaps = 38/246 (15%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEK-TEDGKLKGFGFVDFEKHEDAAKAVEEL 276
           +++  +N ETT+E   + F+KYG V    + K T  G+ +GFGF+ FE     A +V+E+
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFEN----ASSVDEV 243

Query: 277 NGTE--FKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEK 334
             T+     + +   RA  + E+             +K  K     +FV  +   +  ++
Sbjct: 244 VKTQHILDGKVIDPKRAIPREEQ-------------DKTGK-----IFVGGIGPDVRPKE 285

Query: 335 LKEEFAPYGTITSVRVM-RTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 393
            +E F+ +G+I   ++M   D G+S+GFGF+ + TP+   +    K  +   GK + +  
Sbjct: 286 FEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRVCQNKFIEF-KGKQIEIKR 344

Query: 394 AQRKDVRRSQLAQQIQARTQMRYQQXXXXXXXXXXGIPGQFMPPMFYGVMPPRGVPFNGP 453
           A+ + +++ +  Q  Q   Q                + G F P M  G            
Sbjct: 345 AEPRQLQKQKQPQMTQPMGQNMSNPMQQYQMFQNPMMAGGFNPMMATGF----------- 393

Query: 454 NPQQMN 459
           NPQ MN
Sbjct: 394 NPQSMN 399

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 50/97 (51%), Gaps = 3/97 (3%)

Query: 292 QKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVM 351
           Q+   ++Q+   Q+E   ++         +F+  L+    +E L++ F+ YG +  V++M
Sbjct: 159 QQTMSQLQQTASQHEPKAIKADLSRDINKMFIGGLNWETTEEGLRDYFSKYGAVAEVKIM 218

Query: 352 R-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK 387
           + T  G+S+GFGF+ F       + +  K Q I+ GK
Sbjct: 219 KDTATGRSRGFGFLTFENASSVDEVV--KTQHILDGK 253

>Kwal_55.21960
          Length = 597

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 90/173 (52%), Gaps = 13/173 (7%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAIDAL 183
           +FI  L+ +     L + FS +G +   KI  D  TG+S+GFGF+ F   SS  E +   
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 184 NGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVL 243
           +  +L+G+ I     + R+E+D   +        ++V  I  +   +EF E F+++G ++
Sbjct: 271 H--ILDGKVIDPKRAIPREEQDKTGK--------IFVGGIGPDVRPKEFEEFFSQWGTII 320

Query: 244 SSSLEKTED-GKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKY 295
            + L   +D G+ +GFGF+ ++   DA   V E    EFK + + + RA+ ++
Sbjct: 321 DAQLMLDKDTGRSRGFGFITYDT-PDAVDRVCENKFIEFKGKRIEIKRAEPRH 372

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 75/136 (55%), Gaps = 5/136 (3%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           +++G L+   +E  L D FS  G V+ +++ RD  T  S G+ ++ F +  +  + ++  
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           +   + G++  I   +  P   +  +G IF+  + PD+  K   E FS +G I+ +++  
Sbjct: 271 HI--LDGKV--IDPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLML 326

Query: 157 D-ETGKSKGFGFVHFE 171
           D +TG+S+GFGF+ ++
Sbjct: 327 DKDTGRSRGFGFITYD 342

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 80/164 (48%), Gaps = 22/164 (13%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEK-TEDGKLKGFGFVDFEKHEDAAKAVEEL 276
           +++  +N ETT++   + F+KYG V    + +    G+ +GFGF+ F +    A +V+E+
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAE----ASSVDEV 266

Query: 277 NGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLK 336
                K Q +   +       + + K+       +K  K     +FV  +   +  ++ +
Sbjct: 267 ----VKTQHILDGK-------VIDPKRAIPREEQDKTGK-----IFVGGIGPDVRPKEFE 310

Query: 337 EEFAPYGTITSVRVM-RTDNGKSKGFGFVCFSTPEEATKAITEK 379
           E F+ +GTI   ++M   D G+S+GFGF+ + TP+   +    K
Sbjct: 311 EFFSQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRVCENK 354

>CAGL0B04169g complement(404713..407298) highly similar to tr|Q06106
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 861

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 84/164 (51%), Gaps = 7/164 (4%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSK------GFGFVHFEHESSAK 177
           +IFIKNL+    ++ L + F VF   + +++ T    K K      GFGFV F  +  A 
Sbjct: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700

Query: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFA 237
             I A++G +++G +I +     +    SQ E+ KA    + VKN+  E T ++  ELF 
Sbjct: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQ-EKKKAKNGKIIVKNLPFEATRKDVFELFN 759

Query: 238 KYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEF 281
            +G + S  + K  D   +GF FV+F   ++A  A+++L G   
Sbjct: 760 SFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHL 803

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 96/221 (43%), Gaps = 24/221 (10%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGS--VSSIRVCRDAVTKT---SLGYAYVNFNDHEAGK 90
           S+++  L+   +   L D F       V+ ++   D   K    S+G+ +V F   E   
Sbjct: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700

Query: 91  KAIEQLNYTPIKGRLCRIMWSQR-----DPALRKKGSGNIFIKNLHPDIDNKALFETFSV 145
             I  ++ T I G   ++  S R         +K  +G I +KNL  +   K +FE F+ 
Sbjct: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQEKKKAKNGKIIVKNLPFEATRKDVFELFNS 760

Query: 146 FGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAP-------- 197
           FG + S ++       ++GF FV F     A+ A+D L G+ L G+ + + P        
Sbjct: 761 FGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQPAEQEAANA 820

Query: 198 -----HLTRKER-DSQLEETKAHFTNVYVKNINLETTDEEF 232
                 +T+K R  + + E  A   N   + +++E  +EEF
Sbjct: 821 EEELERMTKKVRKQAAVSEIAAMTRNAGKRKLDMEDEEEEF 861

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 96/215 (44%), Gaps = 22/215 (10%)

Query: 168 VHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLET 227
           +  + E SAKEA  +   +L +     V+   T  + D   +       ++++KN+N +T
Sbjct: 597 MEHDEEKSAKEAGPSSADLLES-----VSSKKTEDKEDEDEQVVDGPTVSIFIKNLNFKT 651

Query: 228 TDEEFNELFAKYGNVLSSSLEKTEDGKLK------GFGFVDFEKHEDAAKAVEELNGTEF 281
           T ++  + F  +   + + ++   D K K      GFGFV+F   E A   +  ++GT  
Sbjct: 652 TSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATAVISAMDGTVI 711

Query: 282 KDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAP 341
               +          +++   +Q  A   EK     G  + VKNL      + + E F  
Sbjct: 712 DGHKI----------QLKLSHRQGNAGSQEKKKAKNG-KIIVKNLPFEATRKDVFELFNS 760

Query: 342 YGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAI 376
           +G + SVRV +  +  ++GF FV F  P+EA  A+
Sbjct: 761 FGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAM 795

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 55/91 (60%), Gaps = 3/91 (3%)

Query: 313 MAKYQGV-NLFVKNLDDSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPE 370
           +AK Q    LF++N+  S  ++  K+ F+PYG +  V V + T  G SKGF +V F+ PE
Sbjct: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377

Query: 371 EATKAITEKNQQIVAGKPLYVAIA-QRKDVR 400
           EA +A  E ++QI  G+ L++  A + KD R
Sbjct: 378 EAVQAYIELDKQIFQGRLLHILAADEMKDHR 408

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%)

Query: 54  IFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIM 109
           +FSP G +  + V  D  T  S G+AYV F   E   +A  +L+    +GRL  I+
Sbjct: 344 LFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHIL 399

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAI 180
           +G +F++N+          + FS +G +    +A D  TG SKGF +V F     A +A 
Sbjct: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383

Query: 181 DALNGMLLNGQEIYV 195
             L+  +  G+ +++
Sbjct: 384 IELDKQIFQGRLLHI 398

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 21/34 (61%)

Query: 343 GTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAI 376
           G IT +R+++   GKS+ F F+ +   ++A  A+
Sbjct: 37  GLITDLRILKNREGKSRRFAFIGYKNEQDALDAV 70

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 136 NKALFETFS---VFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQE 192
           NK L  T +   V G I   +I  +  GKS+ F F+ +++E  A +A++  +G  +   +
Sbjct: 23  NKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSK 82

Query: 193 IYV 195
           I V
Sbjct: 83  IEV 85

>CAGL0M03795g complement(428607..430148) highly similar to sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 513

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 114/234 (48%), Gaps = 37/234 (15%)

Query: 189 NGQEIYVAPHLTRKERDSQLEET---------KAHFTN----VYVKNINLETTDEEFNEL 235
           NG  +   P ++ + ++S+  E+         KA  +     +++  +N ETT++   E 
Sbjct: 90  NGSNVSSEPQVSNQTQNSEQRESIEEANRRQVKADLSRENCKMFIGGLNWETTEDGLREY 149

Query: 236 FAKYGNVLSSSLEKTED-GKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKK 294
           F+KYGNV+   + K  + G+ +GFGF+ F    DA  +V+E+     K Q +        
Sbjct: 150 FSKYGNVVELKIMKDPNTGRSRGFGFLSF----DAPSSVDEV----VKTQHILDG----- 196

Query: 295 YERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVM-RT 353
             ++ + K+       +K  K     +FV  L   +  ++ +E F+ +GTI   ++M   
Sbjct: 197 --KVIDPKRAIPREEQDKTGK-----IFVGGLGTDVRPKEFEEYFSQWGTIIDAQLMLDK 249

Query: 354 DNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQ 407
           D G+S+GFGFV + +P+ A K + E   +   GK + +  A+ +  ++ Q  QQ
Sbjct: 250 DTGRSRGFGFVTYDSPDAAEK-VCESRYREFKGKQIEIKRAEPRHQQK-QAGQQ 301

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 81/147 (55%), Gaps = 5/147 (3%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           +++G L+   +E  L + FS  G+V  +++ +D  T  S G+ +++F+   +  + ++  
Sbjct: 132 MFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFDAPSSVDEVVKTQ 191

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           +   + G++  I   +  P   +  +G IF+  L  D+  K   E FS +G I+ +++  
Sbjct: 192 HI--LDGKV--IDPKRAIPREEQDKTGKIFVGGLGTDVRPKEFEEYFSQWGTIIDAQLML 247

Query: 157 D-ETGKSKGFGFVHFEHESSAKEAIDA 182
           D +TG+S+GFGFV ++   +A++  ++
Sbjct: 248 DKDTGRSRGFGFVTYDSPDAAEKVCES 274

>CAGL0E01947g 193225..194583 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 452

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 92/178 (51%), Gaps = 13/178 (7%)

Query: 120 KGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKE 178
           K S  +FI  L+ +     L + FS +G +   KI  D  TG+S+GFGF+ FE  SS  E
Sbjct: 119 KDSCKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDE 178

Query: 179 AIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAK 238
            +   +  +L+G+ I     + R+E+D   +        ++V  I  +   +EF E FA+
Sbjct: 179 VVKTQH--ILDGKVIDPKRAIPREEQDKTGK--------IFVGGIGPDVRPKEFEEFFAQ 228

Query: 239 YGNVLSSSLEKTED-GKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKY 295
           +G ++ + L   +D G+ +GFGF+ ++   DA   V +    +FK + + + RA  ++
Sbjct: 229 WGTIIDAQLMLDKDTGRSRGFGFITYDT-PDAVDKVCQNKFIDFKGRKIEIKRAAPRH 285

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 73/136 (53%), Gaps = 5/136 (3%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           +++G L+   +E  L D FS  G V  +++ +D  T  S G+ ++ F    +  + ++  
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVVKTQ 183

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           +   + G++  I   +  P   +  +G IF+  + PD+  K   E F+ +G I+ +++  
Sbjct: 184 HI--LDGKV--IDPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLML 239

Query: 157 D-ETGKSKGFGFVHFE 171
           D +TG+S+GFGF+ ++
Sbjct: 240 DKDTGRSRGFGFITYD 255

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 81/164 (49%), Gaps = 22/164 (13%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKT-EDGKLKGFGFVDFEKHEDAAKAVEEL 276
           +++  +N ETT++   + F+KYG V    + K    G+ +GFGF+ FE    +A +V+E+
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFE----SASSVDEV 179

Query: 277 NGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLK 336
                K Q +   +       + + K+       +K  K     +FV  +   +  ++ +
Sbjct: 180 ----VKTQHILDGK-------VIDPKRAIPREEQDKTGK-----IFVGGIGPDVRPKEFE 223

Query: 337 EEFAPYGTITSVRVM-RTDNGKSKGFGFVCFSTPEEATKAITEK 379
           E FA +GTI   ++M   D G+S+GFGF+ + TP+   K    K
Sbjct: 224 EFFAQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDKVCQNK 267

>AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH]
           complement(232080..234269) [2190 bp, 729 aa]
          Length = 729

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 94/204 (46%), Gaps = 25/204 (12%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +F++N+  D  +  L + FS F  I  + I  D  G S+GFGFV F  ES  + A+D   
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDKGR 77

Query: 185 GMLLNGQEIYVAPHLTRKERDSQLEETKAHFT----------------------NVYVKN 222
                G+ + V     R+ER  + +E +A  +                       + ++N
Sbjct: 78  KTQFKGRLLRV-DVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLIIRN 136

Query: 223 INLETTD-EEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEF 281
           +     D  +  ++F ++G V  +S+ +  DGKL GF FV  +K  +  KA+EE  G + 
Sbjct: 137 MPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKGLKI 196

Query: 282 KDQTLFVSRAQKKYERMQELKKQY 305
             + + V  A +K  + ++ KK +
Sbjct: 197 DGREVAVDFAVQK-SKWEDYKKTH 219

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 90/195 (46%), Gaps = 12/195 (6%)

Query: 215 FTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVE 274
              ++V+NI  + TD E  + F+++  +  + + K   G  +GFGFV F    D   A++
Sbjct: 15  LKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALD 74

Query: 275 ELNGTEFKDQTLFVSRAQK--KYERMQELKKQYEASRLEK--------MAKYQGV-NLFV 323
           +   T+FK + L V  A++  + ++  E + Q  A   EK         A  +G   L +
Sbjct: 75  KGRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLII 134

Query: 324 KNLDDSIDD-EKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQ 382
           +N+  S  D  KLK+ F  +G +    + R  +GK  GF FV         KAI E    
Sbjct: 135 RNMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKGL 194

Query: 383 IVAGKPLYVAIAQRK 397
            + G+ + V  A +K
Sbjct: 195 KIDGREVAVDFAVQK 209

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 81/189 (42%), Gaps = 31/189 (16%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L+V  +    ++A L D FS    +    + +D    +S G+ +V+F      + A+++
Sbjct: 17  TLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAG-SSRGFGFVSFAVESDTQAALDK 75

Query: 96  LNYTPIKGRLCRIMWSQR----------------------------DPALRKKGSGNIFI 127
              T  KGRL R+  ++R                            D AL  +G   + I
Sbjct: 76  GRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEAL-MRGKPKLII 134

Query: 128 KNLHPDI-DNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGM 186
           +N+     D   L + F  FG +  + I     GK  GF FV  +  S+ ++AI+   G+
Sbjct: 135 RNMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKGL 194

Query: 187 LLNGQEIYV 195
            ++G+E+ V
Sbjct: 195 KIDGREVAV 203

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 51/92 (55%), Gaps = 2/92 (2%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKN 380
           LFV+N+     D +L + F+ +  I    +++ + G S+GFGFV F+   +   A+ +  
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDKGR 77

Query: 381 QQIVAGKPLYVAIAQRKDVRRSQLAQQIQART 412
           +    G+ L V +A+R++  RS+   + +A+T
Sbjct: 78  KTQFKGRLLRVDVAKRRE--RSKKGDEAEAQT 107

>Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement
          Length = 697

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 95/188 (50%), Gaps = 8/188 (4%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277
           ++V++I  +  DEEF + F+++  +  S + K  + + +GFGFV F   +D  +A+ +  
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEALAQAR 87

Query: 278 GTEFKDQTLFVS------RAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSID 331
             +FK++ L +       R+++   R +   K Y+ S  E++ K +   L ++N+  S  
Sbjct: 88  KAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKP-KLIIRNMPWSCR 146

Query: 332 DEK-LKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 390
           D   LK+ F+ +GT+   ++ +   GK  GF FV         +AI E     + G+ + 
Sbjct: 147 DAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKIDGRQVA 206

Query: 391 VAIAQRKD 398
           +  A +K+
Sbjct: 207 IDFAIQKN 214

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 75/167 (44%), Gaps = 16/167 (9%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +F++++  D +++   + FS F  I  S I  D   +S+GFGFV F  E   KEA+    
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEALAQAR 87

Query: 185 GMLLNGQ--EIYVAPHLTRKER-------------DSQLEETKAHFTNVYVKNINLETTD 229
                 +   I +A    R +R             +S  EE       + ++N+     D
Sbjct: 88  KAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKPKLIIRNMPWSCRD 147

Query: 230 EE-FNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEE 275
                +LF+++G V+ + + K   GKL GF FV  +K     +A+EE
Sbjct: 148 AAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEE 194

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 119 KKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAK 177
           K+ S +IF++N+  D   ++L   F  FG +  +    D ETG +KG  FV F+ E +  
Sbjct: 294 KQESFSIFVRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAFKTEEAFS 353

Query: 178 EAID 181
           E +D
Sbjct: 354 ECVD 357

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 311 EKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTIT-SVRVMRTDNGKSKGFGFVCFSTP 369
           +K  K +  ++FV+N+      E L+  F  +G +  ++ V+  + G +KG  FV F T 
Sbjct: 290 QKKNKQESFSIFVRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAFKTE 349

Query: 370 EEATKAI 376
           E  ++ +
Sbjct: 350 EAFSECV 356

>YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein with
           similarity to Pab1p, Pub1p, Nsr1p, Nop4p and other
           RNA-binding proteins, contains multiple RNA-binding
           domains, is required for 35S rRNA processing [2664 bp,
           887 aa]
          Length = 887

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 84/165 (50%), Gaps = 7/165 (4%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATD----ETGK--SKGFGFVHFEHESSAK 177
           +IFIKNL+    N+ L + F VF   + +++ T       GK  S GFGFV F  +  A 
Sbjct: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723

Query: 178 EAIDALNGMLLNGQEIYVA-PHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELF 236
             I A++G +++G +I +   H    +  +   ++      + VKN+  E T ++  ELF
Sbjct: 724 AVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKTKSNKKSGKIIVKNLPFEATRKDVFELF 783

Query: 237 AKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEF 281
             +G + S  + K  D   +GF FV+F   ++A  A+++L+G   
Sbjct: 784 NSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHL 828

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 61/128 (47%), Gaps = 7/128 (5%)

Query: 75  SLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPALR-------KKGSGNIFI 127
           S+G+ +V F   E     I  ++ T I G   ++  S R  +          K SG I +
Sbjct: 708 SMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKTKSNKKSGKIIV 767

Query: 128 KNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGML 187
           KNL  +   K +FE F+ FG + S ++       ++GF FV F     A+ A+D L+G+ 
Sbjct: 768 KNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVH 827

Query: 188 LNGQEIYV 195
           L G+ + +
Sbjct: 828 LLGRRLVM 835

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 101/416 (24%), Positives = 158/416 (37%), Gaps = 70/416 (16%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L++  +  T  E     +FSP G +  + V  D  T  S G+AYV F D +    A  +L
Sbjct: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGS--GNIFIKNL----HPDIDNKA-----LFETFSV 145
           +    +GRL  I+     P   KK        +KN+      ++  KA      F   S+
Sbjct: 407 DKQIFQGRLLHIL-----PGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSL 461

Query: 146 FGN---ILSSKIATDETGKSKGFGFVHFEHESSA-KEAIDALNGMLLNGQEIYVAPHLTR 201
           + N   +L S  A     KS+    +  E+ SSA K+A+      ++     Y       
Sbjct: 462 YMNQDAVLGSVAAKLGLEKSQ---LIDAENSSSAVKQAL--AEAHVIGDVRKYFESKGVD 516

Query: 202 KERDSQLEETKAHFTNV-YVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGF 260
             + SQL+ T      V  VKN    TT EE  E+F  YG      LE+           
Sbjct: 517 LTKFSQLKSTNQRDDKVILVKNFPFGTTREELGEMFLPYG-----KLERLLMPPAGTIAI 571

Query: 261 VDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKY------------------------- 295
           V F     A  A  +L+   FKD  +++ R  K                           
Sbjct: 572 VQFRDTTSARAAFTKLSYKRFKDGIIYLERGPKDCFTKPAEADDLINNTSAKEEENPVEV 631

Query: 296 -----ERMQELKKQYEAS---RLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITS 347
                + M+  K   E S     E +     V++F+KNL+ S  ++ L + F  +     
Sbjct: 632 KPSSNDLMEANKDVTEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVV 691

Query: 348 VRVMRTDNGK------SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397
            +V    + K      S GFGFV F T E+A   I   +  ++ G  + + ++ R+
Sbjct: 692 AQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQ 747

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 84/182 (46%), Gaps = 15/182 (8%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKG------FGFVDFEKHEDA 269
            ++++KN+N  TT++   + F  +   + + ++   D K +G      FGFV+F   E A
Sbjct: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722

Query: 270 AKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDS 329
              +  ++GT      + +  + ++  +    K         K  K  G  + VKNL   
Sbjct: 723 NAVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKT--------KSNKKSG-KIIVKNLPFE 773

Query: 330 IDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
              + + E F  +G + SVRV +  +  ++GF FV F  P+EA  A+ + +   + G+ L
Sbjct: 774 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833

Query: 390 YV 391
            +
Sbjct: 834 VM 835

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPEEATKAITEK 379
           LF++N+  +  +E  ++ F+P+G +  V V + T  G+SKGF +V F   + A  A  E 
Sbjct: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406

Query: 380 NQQIVAGKPLYVAIAQRKDVRR 401
           ++QI  G+ L++   + K   R
Sbjct: 407 DKQIFQGRLLHILPGEEKKSHR 428

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 149 ILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVA 196
           I   KI  D  G+S+ FGF+ + +E  A +A++  NG  +N  +I V+
Sbjct: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVS 90

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 15/90 (16%)

Query: 321 LFVKNLDDSIDDEKLKEEF-----------APYGT----ITSVRVMRTDNGKSKGFGFVC 365
           + VK L   + D+ L+E F           A  G+    IT V+++R  NG+S+ FGF+ 
Sbjct: 4   IIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFGFIG 63

Query: 366 FSTPEEATKAITEKNQQIVAGKPLYVAIAQ 395
           +   E+A  A+   N   +    + V++A+
Sbjct: 64  YRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 51  LYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMW 110
           ++++F+  G + S+RV +    K++ G+A+V F   +  + A++QL+   + GR   + +
Sbjct: 779 VFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837

>ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH]
           (768392..770908) [2517 bp, 838 aa]
          Length = 838

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 97/206 (47%), Gaps = 23/206 (11%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGK------SKGFGFVHFEHESSAK 177
           +IF+KNL+    +  L E F  F   + +++ T    K      S GFGF+ F  +  A 
Sbjct: 613 SIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAG 672

Query: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVY-----VKNINLETTDEEF 232
             I A++G +++G +I     L    + S L +T             VKN+  E T ++ 
Sbjct: 673 AVIAAMDGAVIDGHKI----QLKISHKQSSLPKTSKGSKKKISGKIIVKNLPFEATRKDV 728

Query: 233 NELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQ 292
            ELF+ +G + S  + K  D   +GF FV+F    +A  A+++L G     + L +  A+
Sbjct: 729 FELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRLVMQYAE 788

Query: 293 KKYERMQE--------LKKQYEASRL 310
           ++ + ++E        +KKQ   S++
Sbjct: 789 QESDDVEEQISKMTMKMKKQAAVSKM 814

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 105/407 (25%), Positives = 165/407 (40%), Gaps = 77/407 (18%)

Query: 50  LLYD--------IFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPI 101
           +LYD        +FSP G +  + V  D  T  S G+AYV F D E    A  +L+    
Sbjct: 308 ILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIELDKQIF 367

Query: 102 KGRLCRIMWSQRDPALRKKGS--GNIFIKNL----HPDIDNKA-----LFETFSVFGN-- 148
           +GRL  I+     PA  KK        +KNL      ++  KA      F   S+F N  
Sbjct: 368 QGRLLHIL-----PADAKKTHRLDEFDLKNLPLKKQRELKRKATAAQQTFSWNSLFMNQD 422

Query: 149 -ILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAP--HLTRKERD 205
            +LSS  A     KS+    +  E+  SA +   A   ++ + ++ + A    LT+ E+ 
Sbjct: 423 AVLSSVAAKLGMEKSQ---LIDPENSGSAVKQALAEAHVIGDVRKYFEARGVDLTQFEKF 479

Query: 206 SQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEK 265
            ++ E       + VKN    TT EE  ELF  +G        K E   +   G +   +
Sbjct: 480 KKVTERDDRI--ILVKNFPHGTTREELAELFLPFG--------KIERMLMPPSGTIAIIQ 529

Query: 266 HED---AAKAVEELNGTEFKDQTLFVSRAQKKY-----------------ERMQELKKQY 305
           + D   A  A  +L+   FK   L++ +  K                   E ++E+KK  
Sbjct: 530 YRDVPAARGAFTKLSYKRFKAPILYLEKGPKDCFSREPRGDELLEGDAAPEDVKEIKKSV 589

Query: 306 E---------ASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRV------ 350
           E          S          V++FVKNL+ S    +L E+F P+      +V      
Sbjct: 590 EDVMDADSKTPSSEATAIDGPTVSIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDP 649

Query: 351 MRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397
             +D   S GFGF+ F T E+A   I   +  ++ G  + + I+ ++
Sbjct: 650 KNSDKKLSMGFGFIEFRTKEQAGAVIAAMDGAVIDGHKIQLKISHKQ 696

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 82/172 (47%), Gaps = 12/172 (6%)

Query: 36  SLYVGELDPTVSEALLYDIFSP-----IGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGK 90
           S++V  L+ + + A L + F P     +  V +    +++  K S+G+ ++ F   E   
Sbjct: 613 SIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAG 672

Query: 91  KAIEQLNYTPIKGRLCRIMWSQRDPALRK-------KGSGNIFIKNLHPDIDNKALFETF 143
             I  ++   I G   ++  S +  +L K       K SG I +KNL  +   K +FE F
Sbjct: 673 AVIAAMDGAVIDGHKIQLKISHKQSSLPKTSKGSKKKISGKIIVKNLPFEATRKDVFELF 732

Query: 144 SVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
           S FG + S ++       ++GF FV F   S A+ A+D L G+ L G+ + +
Sbjct: 733 SSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRLVM 784

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPEEATKAITEK 379
           LF++N+     +E  K+ F+PYG +  V V + T  G+SKGF +V F  PE A  A  E 
Sbjct: 303 LFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIEL 362

Query: 380 NQQIVAGKPLYVAIAQRKDVRR 401
           ++QI  G+ L++  A  K   R
Sbjct: 363 DKQIFQGRLLHILPADAKKTHR 384

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 87/192 (45%), Gaps = 23/192 (11%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLE-----KTEDGKLK-GFGFVDFEKHEDA 269
            +++VKN+N  TT  +  E F  +   + + ++     K  D KL  GFGF++F   E A
Sbjct: 612 VSIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQA 671

Query: 270 AKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLF----VKN 325
              +  ++G       +             +LK  ++ S L K +K     +     VKN
Sbjct: 672 GAVIAAMDGAVIDGHKI-------------QLKISHKQSSLPKTSKGSKKKISGKIIVKN 718

Query: 326 LDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVA 385
           L      + + E F+ +G + SVRV +  +  ++GF FV F  P EA  A+ +     + 
Sbjct: 719 LPFEATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLL 778

Query: 386 GKPLYVAIAQRK 397
           G+ L +  A+++
Sbjct: 779 GRRLVMQYAEQE 790

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 54/101 (53%), Gaps = 9/101 (8%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLE-KTEDGKLKGFGFVDFEKHEDAAKAVEEL 276
           ++++NI  + T+E+F +LF+ YG +    +   T  G+ KGF +V F+  E AA A  EL
Sbjct: 303 LFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIEL 362

Query: 277 NGTEFKDQTLFVSRAQ-KKYERMQE-------LKKQYEASR 309
           +   F+ + L +  A  KK  R+ E       LKKQ E  R
Sbjct: 363 DKQIFQGRLLHILPADAKKTHRLDEFDLKNLPLKKQRELKR 403

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 149 ILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVA 196
           I   KI  D++G S+ F F+ +  E  A +AI+  NG  ++   I VA
Sbjct: 37  ITDVKIVKDKSGNSRRFAFIGYRSEQDAFDAIEYFNGSFIDTARIEVA 84

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 51  LYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMW 110
           ++++FS  G + S+RV +    K++ G+A+V F      + A++QL    + GR   + +
Sbjct: 728 VFELFSSFGQLKSVRVPK-KFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRLVMQY 786

Query: 111 SQRD 114
           ++++
Sbjct: 787 AEQE 790

>CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 380

 Score = 67.4 bits (163), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 105/217 (48%), Gaps = 30/217 (13%)

Query: 202 KERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTE---------- 251
           KE +S +++++ +   V++ N++ +TT E+        G    + +E TE          
Sbjct: 101 KESESSVKDSRKN--GVWIGNLSFDTTKEDITRFIV--GKTKGTDVEITEEDLVRVNMPL 156

Query: 252 ---DGKL---KGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQY 305
              DGK    KGF +VDF+  E    A++ L+ ++   + L +  + K YE       + 
Sbjct: 157 AKNDGKQIKNKGFCYVDFKTQEQVEAAIK-LSESQLNGRNLLIKNS-KSYE------GRP 208

Query: 306 EASRLEKMAKYQGVN-LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMR-TDNGKSKGFGF 363
           + + L  M+K      LFV NL     DE L++ F   G I  +R+    D+GK KGF F
Sbjct: 209 DKTDLVSMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAF 268

Query: 364 VCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVR 400
           V F   E AT A+ +K+ + +AG+PL +   + +  R
Sbjct: 269 VDFKNEEGATNALKDKSCRKIAGRPLRMEFGEDRSKR 305

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 57/115 (49%), Gaps = 12/115 (10%)

Query: 77  GYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQR-----DPALRKKGSGN-----IF 126
           G+ YV+F   E  + AI +L+ + + GR   I  S+      D       S N     +F
Sbjct: 168 GFCYVDFKTQEQVEAAI-KLSESQLNGRNLLIKNSKSYEGRPDKTDLVSMSKNPPSRILF 226

Query: 127 IKNLHPDIDNKALFETFSVFGNILSSKIAT-DETGKSKGFGFVHFEHESSAKEAI 180
           + NL  D  ++ L + F   G I+  ++AT  ++GK KGF FV F++E  A  A+
Sbjct: 227 VGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNAL 281

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L+VG L    ++ LL   F   G +  IR+     +    G+A+V+F + E    A++  
Sbjct: 225 LFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALKDK 284

Query: 97  NYTPIKGRLCRIMWSQ 112
           +   I GR  R+ + +
Sbjct: 285 SCRKIAGRPLRMEFGE 300

>YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein and
           pre-mRNA splicing factor with similarity to human SAP49,
           has 2 RNA recognition (RRM) domains [642 bp, 213 aa]
          Length = 213

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 81/172 (47%), Gaps = 13/172 (7%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           ++YVG +DP +++  LY++F  I  V  I+  +D V +   GYA++ F +    + AI+ 
Sbjct: 10  TVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKI 69

Query: 96  LNYTP-IKGRLCRIMWSQRDPALRKKGS----------GNIFIKNLHPDIDNKALFETFS 144
           +N T  +  RL ++             S            +FIKNL   ID+  L + F+
Sbjct: 70  MNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVKIFN 129

Query: 145 VFGNILSS-KIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
            FG ++   +I     GK K   +V+FE    A  AI +LN  L+    I V
Sbjct: 130 KFGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRITV 180

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 79/179 (44%), Gaps = 8/179 (4%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGK-LKGFGFVDFEKHEDAAKAVEEL 276
           VYV NI+   T E+  ELF +   VL     K +  +  +G+ F++F    DA  A++ +
Sbjct: 11  VYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIM 70

Query: 277 NGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLK 336
           N T      L   R          L        +  +AK     LF+KNL DSID ++L 
Sbjct: 71  NNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAK-----LFIKNLADSIDSDQLV 125

Query: 337 EEFAPYG-TITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIA 394
           + F  +G  I    +    NGK K   +V F   E+A  AI   N Q+VA   + V  A
Sbjct: 126 KIFNKFGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRITVDYA 183

>KLLA0D14949g complement(1259860..1262496) similar to sgd|S0006316
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 878

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 105/208 (50%), Gaps = 20/208 (9%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATD----ETGK--SKGFGFVHFEHESSAK 177
           +IFIKNL+    ++ L E F  F   + +++ T     + GK  S GFGF  F+ +  A 
Sbjct: 652 SIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQAN 711

Query: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFT----NVYVKNINLETTDEEFN 233
             I A+ G +L+G ++ +   L+ ++  S    +          + VKN+  E T ++  
Sbjct: 712 AVISAMEGTILDGHKLQL--KLSHRQGTSTTNASSKKKKKNQGKIIVKNLPFEATRKDVF 769

Query: 234 ELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTL---FVSR 290
           ELF+ +G + S  + K  D   +GF FV+F   ++A  A+++L G     + L   FV +
Sbjct: 770 ELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMEFVEQ 829

Query: 291 ----AQKKYERM-QELKKQYEASRLEKM 313
                +++ E+M +++KKQ   +++  M
Sbjct: 830 DPEDVEQQIEKMTRKVKKQVNTTKIANM 857

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 103/426 (24%), Positives = 166/426 (38%), Gaps = 87/426 (20%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L++  +  T +E     +FSP G +  + +  D  T  S G+AYV F + +    A  +L
Sbjct: 332 LFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYVLFKNADNAATAFVEL 391

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGS--GNIFIKNL----HPDIDNKA-----LFETFSV 145
           +    +GRL  I+     PA  KK        +KNL      ++  KA      F   S+
Sbjct: 392 DKQIFQGRLLHIL-----PADAKKSHKLDEFDLKNLPLKKQRELKRKANSAQQTFSWNSL 446

Query: 146 FGN---ILSSKIATDETGKSKGFGFVHFEHESSA-KEAI-------DALNGMLLNGQEIY 194
           + N   +LSS    D+ G  K    +  E+ SSA K+A+       D        G ++ 
Sbjct: 447 YMNQDAVLSS--VADKLGMKKS-ELIDAENSSSAVKQALAEASVIGDVRKFFETRGVDLT 503

Query: 195 VAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGK 254
               L   ERD ++         + VKN    TT EE  ELF  +G +    L  +  G 
Sbjct: 504 KFAQLKNSERDDRV---------ILVKNFPYGTTREEIAELFLPFGKLQRLLLPPS--GT 552

Query: 255 LKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKK-YERMQELKKQYEASR---- 309
           +    F D      A  A  +++   FKD  +++ +     + R  +  +  E+      
Sbjct: 553 IAILQFRDVPA---ARAAFSKISYKRFKDGIIYLEKGPSDCFTRDAQGDELVESETDIQK 609

Query: 310 -LEKMAKYQG-------------------------------VNLFVKNLDDSIDDEKLKE 337
              K AK  G                               V++F+KNL+ S   ++L E
Sbjct: 610 ATAKEAKISGADLLEAQSLPAADKDDHDDDDDDDDVQAGPTVSIFIKNLNFSTTSQQLTE 669

Query: 338 EFAPYGTITSVRVMRTDNGK------SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           +F P+      +V    + K      S GFGF  F T E+A   I+     I+ G  L +
Sbjct: 670 KFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQANAVISAMEGTILDGHKLQL 729

Query: 392 AIAQRK 397
            ++ R+
Sbjct: 730 KLSHRQ 735

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 96/222 (43%), Gaps = 28/222 (12%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGS--VSSIRVCRDAVT--KT-SLGYAYVNFNDHEAGK 90
           S+++  L+ + +   L + F P     V+ ++   D     KT S+G+ +  F   E   
Sbjct: 652 SIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQAN 711

Query: 91  KAIEQLNYTPIKGRLCRIMWSQRD--------PALRKKGSGNIFIKNLHPDIDNKALFET 142
             I  +  T + G   ++  S R            +KK  G I +KNL  +   K +FE 
Sbjct: 712 AVISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKNQGKIIVKNLPFEATRKDVFEL 771

Query: 143 FSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV------- 195
           FS FG + S ++       ++GF FV F     A+ A+D L G+ L G+ + +       
Sbjct: 772 FSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMEFVEQDP 831

Query: 196 ------APHLTRKERDSQLEETK-AHFTNVYVKNINLETTDE 230
                    +TRK +  Q+  TK A+  N   + I+L+  DE
Sbjct: 832 EDVEQQIEKMTRKVK-KQVNTTKIANMRNSGKRKIDLDEDDE 872

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 94/206 (45%), Gaps = 21/206 (10%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGK------LKGFGFVDFEKHEDA 269
            ++++KN+N  TT ++  E F  +   + + ++   D K        GFGF +F+  E A
Sbjct: 651 VSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQA 710

Query: 270 AKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDS 329
              +  + GT      L +  + ++             +  +K  K QG  + VKNL   
Sbjct: 711 NAVISAMEGTILDGHKLQLKLSHRQGTSTTN-------ASSKKKKKNQG-KIIVKNLPFE 762

Query: 330 IDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
              + + E F+ +G + SVRV +  +  ++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 763 ATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 822

Query: 390 YVAIAQR--KDVRRSQLAQQIQARTQ 413
            +   ++  +DV      QQI+  T+
Sbjct: 823 VMEFVEQDPEDVE-----QQIEKMTR 843

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 22/46 (47%)

Query: 247 LEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQ 292
           L K  DG+ + F F+ F   EDA   V   NGT      + VS A+
Sbjct: 44  LMKNRDGESRRFAFIGFRDEEDAFDCVNYFNGTFVDTSKIEVSMAK 89

>ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH]
           complement(287620..288234) [615 bp, 204 aa]
          Length = 204

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 83/168 (49%), Gaps = 11/168 (6%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
            ++YVG LDP VS+ LLY++F  +  VS IR  +D V +   G+A+V          AI+
Sbjct: 7   CTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCDFAIK 66

Query: 95  QLNYT-PIKGRLCRIMWSQRD-----PALRKKGSGNIFIKNLHPDIDNKALFETFSVFGN 148
            LN T  + G++ ++  +  +     P   +     +F+KNL   ID   L + F  FG 
Sbjct: 67  SLNNTVSLFGKVLKVRRTLENAKNSAPVFAR---AKLFVKNLDSTIDAVQLQKLFGKFGP 123

Query: 149 ILS-SKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
           +    ++ T + G  +   +V+F     + EA++ LN  ++  Q I +
Sbjct: 124 LAKPPQLFTLKDGALRC-AYVYFTTFRHSDEALEKLNNQIVANQIISI 170

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 85/183 (46%), Gaps = 20/183 (10%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLK----GFGFVDFEKHEDAAK 271
             VYV N++ + + E   ELF +   V  S +   +D K+K    GF FV+     D   
Sbjct: 7   CTVYVGNLDPQVSKELLYELFVQVAPV--SRIRYPKD-KVKQEHQGFAFVELFSEADCDF 63

Query: 272 AVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSID 331
           A++ LN T        VS   K  +  + L+    ++ +   AK     LFVKNLD +ID
Sbjct: 64  AIKSLNNT--------VSLFGKVLKVRRTLENAKNSAPVFARAK-----LFVKNLDSTID 110

Query: 332 DEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
             +L++ F  +G +     + T    +    +V F+T   + +A+ + N QIVA + + +
Sbjct: 111 AVQLQKLFGKFGPLAKPPQLFTLKDGALRCAYVYFTTFRHSDEALEKLNNQIVANQIISI 170

Query: 392 AIA 394
             A
Sbjct: 171 DYA 173

>KLLA0A05346g 485886..488510 some similarities with sp|P53316
           Saccharomyces cerevisiae YGR250c singleton, hypothetical
           start
          Length = 874

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 135/314 (42%), Gaps = 34/314 (10%)

Query: 110 WSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFV 168
           WS  +        GN++++ +  ++  + L   F+ FG IL  KI  D  T +S GFGFV
Sbjct: 178 WSISENPHALNHPGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFV 237

Query: 169 HFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKER----------DSQLEETKAHFTNV 218
            +   S A   I  LNG L+NG  ++V  H+ RKER          + Q E TK  F  V
Sbjct: 238 SYALGSQASNCIKELNGNLMNGSPLFVNYHVERKERERIHFDQWKQNEQEESTK--FKGV 295

Query: 219 YVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGF--------VDFEKHEDAA 270
           +V N+ + TT+   N+L      VL    +   D ++  + F        V++ + ++ +
Sbjct: 296 FVGNLPIFTTE---NKLLTP-SIVLEKFKKALPDCEMVSYFFPKTNSQTNVEYSETDEDS 351

Query: 271 KAVE--ELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDD 328
           K+     LN   F  ++   S    K  R  E  +  +   +EK       ++ +KN   
Sbjct: 352 KSESPLHLNAESFPVKSKHNSDETNK--RNNEKIEDPQLKTIEKHHDNGDEDIVMKNDAT 409

Query: 329 SIDDEKLKEEFAPYGTITSVRVMRTDNGKS-----KGFGFVCFSTPEEATKAITEKNQQI 383
           +  D ++ +  +     T      T + ++     KG+GF  F+T E A K I   N   
Sbjct: 410 TSSDTEVPKSSSSSDDETEATNEETCSSQNEESPLKGYGFFRFATHEMALKCIETFNDSQ 469

Query: 384 VAGKPLYVAIAQRK 397
             G  L V  A +K
Sbjct: 470 WYGHQLVVNKAIQK 483

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 61/104 (58%), Gaps = 17/104 (16%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSS-------SLEKTED---------GKLKGFG 259
           +N+YVK++ L+  DE+  + F K+G ++S+       S+++ +D         GK KG+G
Sbjct: 730 SNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYG 789

Query: 260 FVDFEKHEDAAKAVEELNGTEF-KDQTLFVSRAQKKYERMQELK 302
           FV F+   DA++A+   +G +   D TLFVS AQ++ + +  +K
Sbjct: 790 FVCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRRSKSIDSIK 833

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 75/316 (23%), Positives = 129/316 (40%), Gaps = 65/316 (20%)

Query: 34  PASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
           P +LYV  +   +++  L  IF+  G +  +++  D+ T  S+G+ +V++         I
Sbjct: 190 PGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFVSYALGSQASNCI 249

Query: 94  EQLNYTPIKG---------------RLCRIMWSQRDPALRKKGSGNIFIKNLHP--DIDN 136
           ++LN   + G               R+    W Q +     K  G +F+ NL P    +N
Sbjct: 250 KELNGNLMNGSPLFVNYHVERKERERIHFDQWKQNEQEESTKFKG-VFVGNL-PIFTTEN 307

Query: 137 KAL---------------FETFSVFGNILSSKI-----ATDETGKSKGFGFVHFEHES-- 174
           K L                E  S F    +S+       TDE  KS+    +H   ES  
Sbjct: 308 KLLTPSIVLEKFKKALPDCEMVSYFFPKTNSQTNVEYSETDEDSKSESP--LHLNAESFP 365

Query: 175 -SAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTN----VYVKNINLETTD 229
             +K   D  N    N ++I           D QL+  + H  N    + +KN    ++D
Sbjct: 366 VKSKHNSDETNKR--NNEKI----------EDPQLKTIEKHHDNGDEDIVMKNDATTSSD 413

Query: 230 EEFNELFAKYGNVLSSSLEKT-----EDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQ 284
            E  +  +   +   ++ E+T     E+  LKG+GF  F  HE A K +E  N +++   
Sbjct: 414 TEVPKSSSSSDDETEATNEETCSSQNEESPLKGYGFFRFATHEMALKCIETFNDSQWYGH 473

Query: 285 TLFVSRAQKKYERMQE 300
            L V++A +K+ + Q 
Sbjct: 474 QLVVNKAIQKFHQHQH 489

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 50/98 (51%), Gaps = 17/98 (17%)

Query: 317 QGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDN----------------GKSKG 360
           Q  NL+VK+L     DE L + F  +G I S +++                    GKSKG
Sbjct: 728 QESNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKG 787

Query: 361 FGFVCFSTPEEATKAITEKN-QQIVAGKPLYVAIAQRK 397
           +GFVCF  P +A++A+   +  ++ +   L+V+ AQR+
Sbjct: 788 YGFVCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRR 825

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 48/98 (48%), Gaps = 16/98 (16%)

Query: 123 GNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT---------------DET-GKSKGFG 166
            N+++K+L  D  ++ L++ F  FG I+S+KI T               DE  GKSKG+G
Sbjct: 730 SNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYG 789

Query: 167 FVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKER 204
           FV F++   A  A+   +G+ LN           R+ +
Sbjct: 790 FVCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRRSK 827

>Sklu_2085.2 YOR319W, Contig c2085 3158-3787
          Length = 209

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 59/119 (49%), Gaps = 6/119 (5%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
            +LY+G +DP V++ LLY++F  +  +S IR  RD +  T  GYA++ F   E     ++
Sbjct: 10  TTLYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVK 69

Query: 95  QLNYT------PIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFG 147
            +N T       +K R      +   P+   +    +F+KNL   +D  AL + F  FG
Sbjct: 70  VMNNTVQLYNRTLKVRRANSNTAASQPSKHVEIGAKLFVKNLDDLVDVAALAKIFGKFG 128

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 84/183 (45%), Gaps = 17/183 (9%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKL---KGFGFVDFEKHEDAAKA 272
           T +Y+ NI+   T +   ELF +   +  S +    D  L   +G+ F++F   EDA   
Sbjct: 10  TTLYIGNIDPNVTKDLLYELFIQVSPI--SKIRYPRDKILDTHQGYAFIEFFTKEDADYV 67

Query: 273 VEELNGT-EFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSID 331
           V+ +N T +  ++TL V RA               AS+  K  +  G  LFVKNLDD +D
Sbjct: 68  VKVMNNTVQLYNRTLKVRRANS----------NTAASQPSKHVEI-GAKLFVKNLDDLVD 116

Query: 332 DEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
              L + F  +G  +    +           ++ ++T +++ +A+ + N QIV  + + V
Sbjct: 117 VAALAKIFGKFGPFSKQPEIFHVKQADYKCAYIYYTTFDDSDQALAKLNNQIVFNRSISV 176

Query: 392 AIA 394
             A
Sbjct: 177 DYA 179

>Scas_157.1
          Length = 232

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 83/168 (49%), Gaps = 8/168 (4%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIG-SVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
           + LY+G+LDP   E ++  I+  +G S   +++  ++    + GY +V F   E G  A+
Sbjct: 47  SQLYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGYCFVEFPSMEHGNNAL 106

Query: 94  EQLNYTPIKG---RLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETF-SVFGNI 149
            + N   I G   R  ++ W+         G  ++F+ +L P++    LFE F   + + 
Sbjct: 107 LK-NGIVIPGFPQRRLKLNWASAGANGNNSGF-SVFVGDLSPNVTEAQLFELFIGRYPST 164

Query: 150 LSSKIATDE-TGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVA 196
             +K+  D+ TG SK +GFV F   +  +  +  + G+ LNG+ I V 
Sbjct: 165 CHAKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKVG 212

>Scas_665.4
          Length = 219

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 84/177 (47%), Gaps = 17/177 (9%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
            ++YVG +DP V++  LY++F  +  +S +R  +D + +   GYA++ F   +  +  I+
Sbjct: 10  TTVYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQ 69

Query: 95  QLNYT-PIKGRLCRIMWSQRDPALRKKGS--------------GNIFIKNLHPDIDNKAL 139
            +N T  +  R  ++  S ++P     G+                +F+KNL   I+N  L
Sbjct: 70  VMNNTVALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNLDESIENPQL 129

Query: 140 FETFSVFGNILSS-KIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
            + F  FG +    +I     GK +   +++F+   ++  AI  LN  L+  + I V
Sbjct: 130 IKLFQKFGPLFKDPEIFFLSNGKLRC-AYIYFKFYENSDMAIAKLNNELIVNKRINV 185

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 89/187 (47%), Gaps = 16/187 (8%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLK---GFGFVDFEKHEDAAKA 272
           T VYV NI+ + T E+  ELF +   +  S L   +D  L+   G+ F++F   +D    
Sbjct: 10  TTVYVGNIDPKVTKEQLYELFIQVSPI--SKLRYPKDKILQMHQGYAFIEFYTAKDVQYV 67

Query: 273 VEELNGT-EFKDQTLFVSRA-QKKYERM--QELKKQYEASRLEKMAKYQGVNLFVKNLDD 328
           ++ +N T    D+ L V ++ Q     M      +    S +  +AK     LFVKNLD+
Sbjct: 68  IQVMNNTVALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAK-----LFVKNLDE 122

Query: 329 SIDDEKLKEEFAPYGTI-TSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK 387
           SI++ +L + F  +G +     +    NGK +   ++ F   E +  AI + N +++  K
Sbjct: 123 SIENPQLIKLFQKFGPLFKDPEIFFLSNGKLRC-AYIYFKFYENSDMAIAKLNNELIVNK 181

Query: 388 PLYVAIA 394
            + V  A
Sbjct: 182 RINVDYA 188

>KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces
           cerevisiae YPL043w NOP4 nucleolar protein, start by
           similarity
          Length = 685

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 93/201 (46%), Gaps = 18/201 (8%)

Query: 215 FTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVE 274
              ++V+ +  E+TDEEF   F+++  +  + + K  +G  +GFGFV F   +D   A+ 
Sbjct: 14  LKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTALN 73

Query: 275 ELNGTEFKDQTLFVSRAQKKYERMQELKKQYEAS--------RLEKMAKYQGVN------ 320
           +   T+F  + L +  A K+ ER +  K   E S        + E+ +K +  N      
Sbjct: 74  QARKTKFMGRLLRIDIA-KRRERSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKGK 132

Query: 321 --LFVKNLDDSIDD-EKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAIT 377
             L ++N+  S  D  KLK+ F  YGT+    + R  +G+  GF FV  +       AI 
Sbjct: 133 PKLIIRNMPWSCRDPTKLKKIFGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAIE 192

Query: 378 EKNQQIVAGKPLYVAIAQRKD 398
                 + G+ + V  A +K+
Sbjct: 193 GTKDLKIDGRKVAVDFAIQKN 213

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 68/158 (43%), Gaps = 26/158 (16%)

Query: 143 FSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN-----GMLL--------- 188
           FS F  I  + I  D  G S+GFGFV F  E   K A++        G LL         
Sbjct: 35  FSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTALNQARKTKFMGRLLRIDIAKRRE 94

Query: 189 ------NGQEIYVAPHL--TRKERDSQLEETKAHFT---NVYVKNINLETTD-EEFNELF 236
                 +  E+  AP +   + E +S+ E+          + ++N+     D  +  ++F
Sbjct: 95  RSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKGKPKLIIRNMPWSCRDPTKLKKIF 154

Query: 237 AKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVE 274
             YG V+ +++ +  DG+L GF FV   +  +   A+E
Sbjct: 155 GLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAIE 192

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 67/173 (38%), Gaps = 36/173 (20%)

Query: 55  FSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRD 114
           FSPI     ++    A    S G+ +V+F   +  K A+ Q   T   GRL RI  ++R 
Sbjct: 38  FSPIKHAVIVKDGEGA----SRGFGFVSFAVEDDTKTALNQARKTKFMGRLLRIDIAKRR 93

Query: 115 PALR-------------------------------KKGSGNIFIKNLHPDI-DNKALFET 142
              R                                KG   + I+N+     D   L + 
Sbjct: 94  ERSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKGKPKLIIRNMPWSCRDPTKLKKI 153

Query: 143 FSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
           F ++G ++ + I     G+  GF FV     S+ K AI+    + ++G+++ V
Sbjct: 154 FGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAIEGTKDLKIDGRKVAV 206

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 51/96 (53%), Gaps = 3/96 (3%)

Query: 311 EKMAKYQGVNL---FVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFS 367
           +K+ K +G++L   FV+ +     DE+    F+ +  I    +++   G S+GFGFV F+
Sbjct: 4   KKVIKDEGLDLKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFA 63

Query: 368 TPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQ 403
             ++   A+ +  +    G+ L + IA+R++  R +
Sbjct: 64  VEDDTKTALNQARKTKFMGRLLRIDIAKRRERSRGK 99

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDA 182
           +IF++N+  D   ++L   F VFG +  +    D ETG +KG  FV F  E       DA
Sbjct: 297 SIFVRNVPYDATQESLERHFGVFGPVKYALPVIDKETGLAKGTAFVAFRSE-------DA 349

Query: 183 LNGMLLNG 190
            N  L N 
Sbjct: 350 YNDCLNNA 357

>CAGL0H02123g complement(188454..190121) similar to sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 555

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 77/332 (23%), Positives = 142/332 (42%), Gaps = 77/332 (23%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVS-SIRVCR--DA-VTKTSLGYAYVNFNDHEAGKKA 92
           LY+G+LDP+  EA++  I++ +G  +  +R+    DA   + +LGY +V F        A
Sbjct: 86  LYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFPSPAHASNA 145

Query: 93  IEQLNYTPIKG---RLCRIMWSQRDPALRKKGSG---------------NIFIKNLHPDI 134
           + + N   I G   +  ++ WS +       GSG               +IF+ +L P +
Sbjct: 146 LMK-NGMEIPGFVHKKLKLNWSAQS---VNNGSGASVANGAVANQQTNNSIFVGDLAPSV 201

Query: 135 DNKALFETF-SVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQE 192
               LF+ F + + + + +K+  D+ TG SKG+GFV F+     + A+  + G  LNG+ 
Sbjct: 202 TEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCFLNGRA 261

Query: 193 I-------------------------YVAPHLTRKER--DSQL----------EETKAHF 215
           I                          ++  L ++ R  + QL          +    HF
Sbjct: 262 IKIGIAGGNNNNNSNSNYNNQRMANDNISNGLGQQSRSLNGQLPQQFVNATPQQPVLNHF 321

Query: 216 TN-----VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAA 270
           T+     V+V  ++   T++E    F  +G ++   +        KG GFV + +   A 
Sbjct: 322 TDPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAG-----KGCGFVQYVERSSAE 376

Query: 271 KAVEELNGTEFKDQTLFVS--RAQKKYERMQE 300
            A+ ++ G    +  + +S  R+ KK   +Q+
Sbjct: 377 TAITKMQGFPIANSRVRLSWGRSAKKTALIQK 408

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 63/142 (44%), Gaps = 8/142 (5%)

Query: 257 GFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKY 316
           G+ FV+F     A+ A+ + NG E      FV +  K     Q +     AS        
Sbjct: 130 GYCFVEFPSPAHASNALMK-NGMEIPG---FVHKKLKLNWSAQSVNNGSGASVANGAVAN 185

Query: 317 QGVN--LFVKNLDDSIDDEKLKEEFA-PYGTITSVRVMRTD-NGKSKGFGFVCFSTPEEA 372
           Q  N  +FV +L  S+ + +L + F   Y +    +VM     G SKG+GFV F +  + 
Sbjct: 186 QQTNNSIFVGDLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQ 245

Query: 373 TKAITEKNQQIVAGKPLYVAIA 394
            +A+ E     + G+ + + IA
Sbjct: 246 QRALVEMQGCFLNGRAIKIGIA 267

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 69/340 (20%), Positives = 129/340 (37%), Gaps = 62/340 (18%)

Query: 125 IFIKNLHPDIDNKALFETFSVFG--NI-LSSKIATDETGKSKGFGFVHFEHESSAKEAID 181
           +++ +L P  D   +   ++  G  NI +      D     K  G+   E  S A     
Sbjct: 86  LYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFPSPAH---- 141

Query: 182 ALNGMLLNGQEI--YVAPHLTRKERDSQLEE-TKAHFTN-----------VYVKNINLET 227
           A N ++ NG EI  +V   L        +   + A   N           ++V ++    
Sbjct: 142 ASNALMKNGMEIPGFVHKKLKLNWSAQSVNNGSGASVANGAVANQQTNNSIFVGDLAPSV 201

Query: 228 TDEEFNELFA-KYGNVLSSSLEKTE-DGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQT 285
           T+ +  +LF  KY + + + +   +  G  KG+GFV F+   D  +A+ E+ G     + 
Sbjct: 202 TEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCFLNGRA 261

Query: 286 LFVSRA----------QKKYERMQ-----------------ELKKQY-----EASRLEKM 313
           + +  A              +RM                  +L +Q+     +   L   
Sbjct: 262 IKIGIAGGNNNNNSNSNYNNQRMANDNISNGLGQQSRSLNGQLPQQFVNATPQQPVLNHF 321

Query: 314 AKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEAT 373
                  +FV  L   + +++L+  F P+GTI  V++        KG GFV +     A 
Sbjct: 322 TDPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIP-----AGKGCGFVQYVERSSAE 376

Query: 374 KAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQ 413
            AIT+     +A     V ++  +  +++ L Q+   R++
Sbjct: 377 TAITKMQGFPIANS--RVRLSWGRSAKKTALIQKALLRSR 414

 Score = 35.8 bits (81), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 41/87 (47%), Gaps = 8/87 (9%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +++VG L P V+E  L   F P G++  +++          G  +V + +  + + AI +
Sbjct: 328 TVFVGGLSPLVTEDELRSYFEPFGTIIYVKI------PAGKGCGFVQYVERSSAETAITK 381

Query: 96  LNYTPIKGRLCRIMW--SQRDPALRKK 120
           +   PI     R+ W  S +  AL +K
Sbjct: 382 MQGFPIANSRVRLSWGRSAKKTALIQK 408

>YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with
           similarity to Rlf6p, contains three RNA recognition
           motif (RRM) domains [1290 bp, 429 aa]
          Length = 429

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 126/322 (39%), Gaps = 28/322 (8%)

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           +Y P+   L R + S  +  + +  S +IF+ NL  D   + L E FS  G ++ + I T
Sbjct: 113 DYGPL---LARELDSTYEEKVNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIIT 169

Query: 157 DETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVA-----PHLTRKERDS----Q 207
              G  +G G V F +      AI   +G     ++I+V      P    KER +    +
Sbjct: 170 -SRGHHRGMGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGE 228

Query: 208 LEET-KAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKH 266
           L    K H   V VKN+      +   ++F + GNV  + +E   DG   G G V F   
Sbjct: 229 LRHNRKTH--EVIVKNLPASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDI 286

Query: 267 EDAAKAVEELNGTEFKDQTLFVSRAQKKYER---------MQELKKQYEASRLEKMAKYQ 317
           +D  +A+E+ NG   +   L V   +  +           M +     EA +  +     
Sbjct: 287 KDLHRAIEKYNGYSIEGNVLDVKSKESVHNHSDGDDVDIPMDDSPVNEEARKFTENVVGG 346

Query: 318 GVN---LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATK 374
           G     ++  NL  S     L + F   G + +  +     G   G   V +   ++A  
Sbjct: 347 GERNRLIYCSNLPFSTAKSDLYDLFETIGKVNNAELRYDSKGAPTGIAVVEYDNVDDADV 406

Query: 375 AITEKNQQIVAGKPLYVAIAQR 396
            I   N     G  L ++ A+R
Sbjct: 407 CIERLNNYNYGGCDLDISYAKR 428

>CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces
           cerevisiae YCL011c GBP2 or sp|P38922 Saccharomyces
           cerevisiae YNL004w HRB1, hypothetical start
          Length = 419

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 77/182 (42%), Gaps = 12/182 (6%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDAL 183
           +IFI NL  D   + L + F   G +L + I T   G+ +G G V F        AI   
Sbjct: 120 SIFIGNLSFDATPEDLHDFFGQAGEVLRADIITSR-GRHRGMGTVEFTSPEGVDNAIRDF 178

Query: 184 NGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTN-----------VYVKNINLETTDEEF 232
           NG+   G+ ++V       E    L   +  F +           V++ N+    T +  
Sbjct: 179 NGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYSMTWQTL 238

Query: 233 NELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQ 292
            +LF + G+V+ + +E   +G  +GFG V +   E+   A+E  NG +   + L V   +
Sbjct: 239 KDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRILQVREGK 298

Query: 293 KK 294
             
Sbjct: 299 NS 300

>YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein
           required for ribosome biogenesis, contains three
           canonical RNA recognition motif (RRM) domains and one
           degenerate RNA recognition motif (RRM) domain [2058 bp,
           685 aa]
          Length = 685

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/312 (20%), Positives = 126/312 (40%), Gaps = 71/312 (22%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +F++++  D+ ++ L + FS F  I  + +  D   +S+GFGFV F  E   KEA+    
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKAR 87

Query: 185 GMLLNGQ--EIYVAPHLTRKERDSQLEETKAHFTN------------------------- 217
               NG    + +A    R ++ S++ E     ++                         
Sbjct: 88  KTKFNGHILRVDIAKRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSMLKGKP 147

Query: 218 -VYVKNINLETTDE-EFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEE 275
            + ++N+     D  +  ++F +YG V+ +++ +  DGKL GF FV  +K  +   A+E 
Sbjct: 148 KLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALEN 207

Query: 276 LNGTEFKDQTLFVSRAQKKYERMQELKK-------------------------------- 303
               +   + + V  A +K  R ++ KK                                
Sbjct: 208 TKDLKIDGRKVAVDFAVQK-NRWEDYKKAQPEMNDKDDNESGNEDAEENHDDEEDENEEE 266

Query: 304 --------QYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTIT-SVRVMRTD 354
                   + + S+ +   K +  ++FV+N+     +E L   F+ +G++  ++ V+   
Sbjct: 267 DRQVDQASKNKESKRKAQNKREDFSVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKS 326

Query: 355 NGKSKGFGFVCF 366
            G +KG  FV F
Sbjct: 327 TGLAKGTAFVAF 338

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 89/201 (44%), Gaps = 21/201 (10%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277
           ++V++I  + TDE+  + F+ +  +  + + K  + + +GFGFV F   +D  +A+ +  
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKAR 87

Query: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVN----------------- 320
            T+F    L V  A K+ +R ++  +  E S  E   K  G N                 
Sbjct: 88  KTKFNGHILRVDIA-KRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSMLKGK 146

Query: 321 --LFVKNLDDSIDDE-KLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAIT 377
             L ++N+  S  D  KLK+ F  YGT+    + R  +GK  GF FV          A+ 
Sbjct: 147 PKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALE 206

Query: 378 EKNQQIVAGKPLYVAIAQRKD 398
                 + G+ + V  A +K+
Sbjct: 207 NTKDLKIDGRKVAVDFAVQKN 227

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 51/88 (57%), Gaps = 2/88 (2%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKN 380
           LFV+++   + DE+L + F+ +  I    V++  N +S+GFGFV F+  ++  +A+ +  
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKAR 87

Query: 381 QQIVAGKPLYVAIAQRKDVRRSQLAQQI 408
           +    G  L V IA+R+D  RS+   ++
Sbjct: 88  KTKFNGHILRVDIAKRRD--RSKKTSEV 113

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 62/315 (19%), Positives = 119/315 (37%), Gaps = 88/315 (27%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L+V  +   V++  L D FS    +    V +D   K S G+ +V+F   +  K+A+ +
Sbjct: 27  TLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKD-TNKRSRGFGFVSFAVEDDTKEALAK 85

Query: 96  LNYTPIKGRLCRIMWSQRDPALRK----------------------------------KG 121
              T   G + R+  ++R    +K                                  KG
Sbjct: 86  ARKTKFNGHILRVDIAKRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSMLKG 145

Query: 122 SGNIFIKNLHPDI-DNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAI 180
              + I+N+     D   L + F  +G ++ + I     GK  GF FV  +  S+ + A+
Sbjct: 146 KPKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIAL 205

Query: 181 DALNGMLLNGQEIYV---------------APHLTRKERD-------------------- 205
           +    + ++G+++ V                P +  K+ +                    
Sbjct: 206 ENTKDLKIDGRKVAVDFAVQKNRWEDYKKAQPEMNDKDDNESGNEDAEENHDDEEDENEE 265

Query: 206 --------SQLEETKAHFTN------VYVKNINLETTDEEFNELFAKYGNVLSS--SLEK 249
                   S+ +E+K    N      V+V+N+  + T+E     F+K+G+V  +   ++K
Sbjct: 266 EDRQVDQASKNKESKRKAQNKREDFSVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDK 325

Query: 250 TEDGKLKGFGFVDFE 264
           +  G  KG  FV F+
Sbjct: 326 ST-GLAKGTAFVAFK 339

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 48/106 (45%), Gaps = 16/106 (15%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAI-- 180
           ++F++N+  D   ++L   FS FG++  +    D+ TG +KG  FV F+ + +  E I  
Sbjct: 291 SVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKSTGLAKGTAFVAFKDQYTYNECIKN 350

Query: 181 -------------DALNGMLLNGQEIYVAPHLTRKERDSQLEETKA 213
                        D +   +  G+ + + P L R++     E+  A
Sbjct: 351 APAAGSTSLLIGDDVMPEYVYEGRVLSITPTLVREDAGRMAEKNAA 396

>CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces
           cerevisiae YOR319w essential yeast splicing factor,
           hypothetical start
          Length = 211

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 85/167 (50%), Gaps = 14/167 (8%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           A++YVG +D  V++ LLY++F+ +G V  ++  +D +++   G+A++ F         + 
Sbjct: 6   ATIYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLN 65

Query: 95  QL-NYTPIKGRLCRIMWS----QRDPALRKKG-------SGNIFIKNLHPDIDNKALFET 142
            + N   +  ++ +I  S    Q+D A +K            +F+K++   ++ + L + 
Sbjct: 66  VMNNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQL 125

Query: 143 FSVFGNILSS-KIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLL 188
           FS FG +  + ++ T   G+ +   F++F+   +A  AI  LNG  +
Sbjct: 126 FSKFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFI 171

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 87/188 (46%), Gaps = 9/188 (4%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGK-LKGFGFVDFEKHEDAAKAVEEL 276
           +YV NI+ + T E   ELF + G V      K +  +  +GF F++F    DA   +  +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 277 -NGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKL 335
            N  +   + L + R+ +  ++    KK    + L  +AK     +FVK++ D+++   L
Sbjct: 68  NNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAK-----VFVKDIADTVEVRHL 122

Query: 336 KEEFAPYGTITSV-RVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIA 394
            + F+ +G +     V    NG+ +   F+ F   + A  AI   N Q +  K   +  A
Sbjct: 123 TQLFSKFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIMNKKASLEYA 181

Query: 395 QRKDVRRS 402
            +++ R++
Sbjct: 182 FKENGRKN 189

>CAGL0F08217g complement(814508..816544) similar to sp|P53316
           Saccharomyces cerevisiae YGR250c, hypothetical start
          Length = 678

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 88/401 (21%), Positives = 150/401 (37%), Gaps = 128/401 (31%)

Query: 123 GNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDA 182
           GN+FI  +  ++    L ETF  FG I S KI  D   K+ G GF+ F   S A E I  
Sbjct: 139 GNLFIGGIPKNMSLNTLMETFDKFGTISSLKILFD--NKNVGIGFLSFMLGSEAAECIRC 196

Query: 183 LNGMLL---NGQE--IYVAPHLTRKERDSQL----------------------------- 208
           +NG  +   NG E  +++  H+ RKER+                                
Sbjct: 197 MNGTKIRSDNGDEGTLFINYHIERKERERLFLSHESSDSSASSLSVRNMRVNTHHRGKHN 256

Query: 209 -EETKAHFTN-----------VYVKNI--NLETTDEEFNELFAKYGNVLSSSLEKTEDGK 254
             E  +  TN           V++ N+  +++   E  ++L   + +V   S     D  
Sbjct: 257 SPELNSWSTNNSSDDLTINNCVFIGNLPTDIQNEGEFIDDLTEAFPSVTVISYYFPYDHS 316

Query: 255 L---KGFGFVDFEKHEDAAKAVEELNGT--EFKDQTLFVSRAQKK----------YERMQ 299
           L   KG+GF+  + ++ A + + E++    EF    +  ++A  K          Y +  
Sbjct: 317 LNQYKGYGFIKLQNNDQARRIIHEISTDCFEFCGNHIIANKASNKDNKTTSHFTLYTKTT 376

Query: 300 ELKKQYEASRLEKMAKYQG----------------------------------------- 318
           E   +   + LE+ + Y G                                         
Sbjct: 377 ETNPKTRNNYLEQTSPYAGGINTFPPSMNNYTFGYDLYPPIKRGSHNLPYIYGLPVPLEG 436

Query: 319 ---VNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVM---------RTDN--------GKS 358
               N++VK++     D+ L   + P+G I S +++         ++ N        G S
Sbjct: 437 QQESNIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGIS 496

Query: 359 KGFGFVCFSTPEEATKAITEKNQQIVAG--KPLYVAIAQRK 397
           +G+GFV F+ P +A  AI   +   + G  + L V+ AQ+K
Sbjct: 497 RGYGFVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQKK 537

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 72/138 (52%), Gaps = 22/138 (15%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIAT--------------DET---GKSKGFG 166
           NI++K++  D  +K LF  +  FGNI+S KI T              DE    G S+G+G
Sbjct: 441 NIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGYG 500

Query: 167 FVHFEHESSAKEAIDALNGMLLNG--QEIYVAPHLTRKERDSQ--LEETKAHFTNVYVKN 222
           FV+F +   A  AI + +G  L G  Q++ V+ +  +K++D Q  L+E+ ++ ++  + N
Sbjct: 501 FVYFANPLDAAYAILSTDGYYLEGAIQKLSVS-YAQKKKKDGQSLLDESLSNESSDQIDN 559

Query: 223 INLETTDEEFNELFAKYG 240
                  E+ N   AK+G
Sbjct: 560 SEKTNEKEKRNHSSAKFG 577

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 51/105 (48%), Gaps = 19/105 (18%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLS-----------------SSLEKTEDGKLKGF 258
           +N+YVK++ L+ +D++    +  +GN++S                 SS E    G  +G+
Sbjct: 440 SNIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGY 499

Query: 259 GFVDFEKHEDAAKAVEELNG--TEFKDQTLFVSRAQKKYERMQEL 301
           GFV F    DAA A+   +G   E   Q L VS AQKK +  Q L
Sbjct: 500 GFVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQKKKKDGQSL 544

 Score = 37.0 bits (84), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 67/154 (43%), Gaps = 22/154 (14%)

Query: 223 INLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFK 282
           ++L+  + E N+L A  GN  +  +E  E  ++  F F      ++  K V+ +   EF+
Sbjct: 63  LSLKNINNEQNKLVAS-GNADTEEIESYE--RVIQFQFKHMPNLKNCLKKVKAILKEEFE 119

Query: 283 DQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPY 342
              L                  Y +  L   A     NLF+  +  ++    L E F  +
Sbjct: 120 KGAL-----------------AYWSISLNTHALTHPGNLFIGGIPKNMSLNTLMETFDKF 162

Query: 343 GTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAI 376
           GTI+S++++  DN K+ G GF+ F    EA + I
Sbjct: 163 GTISSLKIL-FDN-KNVGIGFLSFMLGSEAAECI 194

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 47/246 (19%), Positives = 89/246 (36%), Gaps = 67/246 (27%)

Query: 34  PASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
           P +L++G +   +S   L + F   G++SS+++  D     ++G  +++F       + I
Sbjct: 138 PGNLFIGGIPKNMSLNTLMETFDKFGTISSLKILFD---NKNVGIGFLSFMLGSEAAECI 194

Query: 94  EQLNYTPIKG--------------------------------------RLCRIMWSQR-- 113
             +N T I+                                       R  R+    R  
Sbjct: 195 RCMNGTKIRSDNGDEGTLFINYHIERKERERLFLSHESSDSSASSLSVRNMRVNTHHRGK 254

Query: 114 --DPALRKKGSGN----------IFIKNLHPDIDNKALF-----ETFSVFGNILSSKIAT 156
              P L    + N          +FI NL  DI N+  F     E F     ++S     
Sbjct: 255 HNSPELNSWSTNNSSDDLTINNCVFIGNLPTDIQNEGEFIDDLTEAFPSV-TVISYYFPY 313

Query: 157 DET-GKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHF 215
           D +  + KG+GF+  ++   A+  I  ++         +   H+   +  ++  +T +HF
Sbjct: 314 DHSLNQYKGYGFIKLQNNDQARRIIHEISTDCFE----FCGNHIIANKASNKDNKTTSHF 369

Query: 216 TNVYVK 221
           T +Y K
Sbjct: 370 T-LYTK 374

>Sklu_905.1 YMR268C, Contig c905 196-1743
          Length = 515

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 94/198 (47%), Gaps = 19/198 (9%)

Query: 218 VYVKNINLETTDEEFNELFAKYG-NVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEEL 276
           ++V N    +T E    LF++YG +VLS  L   +    + F ++DF   ++A  A+ +L
Sbjct: 185 LWVTNFAPNSTVETLKALFSQYGGSVLSVRLPSLKFDSNRRFAYIDFASSDEANTAMSKL 244

Query: 277 NGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLD-DSIDDEKL 335
           N T      L V ++        E  K+ +A+ LEK        +F++ LD   +   KL
Sbjct: 245 NNTSHDGYILVVKKSNP-----HEKSKRTDAATLEKR------EIFIRKLDFYKVSLSKL 293

Query: 336 KEEFAPYGTITSVRVMRTD-----NGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 390
            +    YG +  V +  ++     N ++ GF FV ++  E A KA+ E N  +  G+ L 
Sbjct: 294 TKLVEKYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTNEESAQKAL-ELNMSVFEGRVLA 352

Query: 391 VAIAQRKDVRRSQLAQQI 408
           V+IA RK     Q  ++I
Sbjct: 353 VSIADRKPYLERQEVKRI 370

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 116/275 (42%), Gaps = 31/275 (11%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIG-SVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
           A+L+V    P  +   L  +FS  G SV S+R+       ++  +AY++F   +    A+
Sbjct: 183 ATLWVTNFAPNSTVETLKALFSQYGGSVLSVRLPSLKF-DSNRRFAYIDFASSDEANTAM 241

Query: 94  EQLNYTPIKGRLCRIMWSQRDPALRKKGSGN-----IFIKNLH-PDIDNKALFETFSVFG 147
            +LN T   G +  +  S      ++  +       IFI+ L    +    L +    +G
Sbjct: 242 SKLNNTSHDGYILVVKKSNPHEKSKRTDAATLEKREIFIRKLDFYKVSLSKLTKLVEKYG 301

Query: 148 -----NILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVA-----P 197
                ++ +S+ + +   ++ GF FV + +E SA++A++ LN  +  G+ + V+     P
Sbjct: 302 PVERVSMPNSEDSVNSNKQNDGFAFVTYTNEESAQKALE-LNMSVFEGRVLAVSIADRKP 360

Query: 198 HLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKG 257
           +L R+E    L   K     + +     + + ++   L  +  ++      K ED K   
Sbjct: 361 YLERQEVKRILNTKKPQNDMISMYPFTDKVSKDQLRALITEKASL------KDEDIKAIY 414

Query: 258 F------GFVDFEKHEDAAKAVEELNGTEFKDQTL 286
                    +  E    AAK    L+G EFK + L
Sbjct: 415 LVADHEGAVIQLESERIAAKVTMALHGIEFKRKVL 449

>Kwal_27.11832
          Length = 686

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 90/191 (47%), Gaps = 13/191 (6%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277
           ++V++I  + TDEE    F+    +  + + K +    +GFGFV F   +D   A+++  
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDKAR 82

Query: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGV---------NLFVKNLDD 328
            T+FK + L V  A++   R +  K Q  A+  E  +  Q            L V+N+  
Sbjct: 83  KTKFKGRLLRVDIAKR---RDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVRNMPW 139

Query: 329 SIDD-EKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGK 387
           S+ + ++LK+ F  YGT+   ++ +  +GK  GF FV          AI E     + G+
Sbjct: 140 SVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLKIGGR 199

Query: 388 PLYVAIAQRKD 398
            + V  A +K+
Sbjct: 200 QVAVDFAVQKN 210

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 75/168 (44%), Gaps = 17/168 (10%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +F++++  D  ++ L   FS    I  + I  D+   S+GFGFV F  E   K+A+D   
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDKAR 82

Query: 185 GMLLNGQ--EIYVAPHLTRKERDSQL--------------EETKAHFTNVYVKNINLETT 228
                G+   + +A    R ++D                 +E       + V+N+     
Sbjct: 83  KTKFKGRLLRVDIAKRRDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVRNMPWSVR 142

Query: 229 D-EEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEE 275
           + +E  ++F +YG V+ + + K  DGKL GF FV  +K      A+EE
Sbjct: 143 NPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEE 190

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 80/183 (43%), Gaps = 24/183 (13%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +L+V  +    ++  L + FS +  +    + +D   K S G+ +V+F   +  K A+++
Sbjct: 22  TLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDD-QKNSRGFGFVSFAVEDDTKDALDK 80

Query: 96  LNYTPIKGRLCRIMWSQRDPALRKK----------------------GSGNIFIKNLHPD 133
              T  KGRL R+  ++R    +K                       G   + ++N+   
Sbjct: 81  ARKTKFKGRLLRVDIAKRRDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVRNMPWS 140

Query: 134 IDN-KALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQE 192
           + N   L + F  +G ++ +KI     GK  GF FV  +  +S K AI+    + + G++
Sbjct: 141 VRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLKIGGRQ 200

Query: 193 IYV 195
           + V
Sbjct: 201 VAV 203

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 16/103 (15%)

Query: 115 PALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHE 173
           P   KK    +F++N+  D   ++L E F+ FG +  +    D ETG +KG  FV F+ +
Sbjct: 283 PKPNKKEQLAVFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQ 342

Query: 174 SSAKEAID-----ALNGMLL----------NGQEIYVAPHLTR 201
            +  E ++         +L+          +G+ + +AP L R
Sbjct: 343 EAFDECVNNAPASGTTSLLISDDVPYRYVYDGRILSIAPALDR 385

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNV-LSSSLEKTEDGKLKGFGFVDFEKHE 267
           V+V+N+  + T E   E F K+G V  +  ++  E G  KG  FV F+  E
Sbjct: 293 VFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQE 343

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 315 KYQGVNLFVKNLDDSIDDEKLKEEFAPYGTIT-SVRVMRTDNGKSKGFGFVCFSTPE 370
           K + + +FV+N+      E L+E F  +G +  ++ V   + G +KG  FV F T E
Sbjct: 287 KKEQLAVFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQE 343

>YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated
           protein, essential for meiotic recombination, suppressor
           of mitochondrial splicing defects, has 3 RNA recognition
           (RRM) domains [1572 bp, 523 aa]
          Length = 523

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 72/348 (20%), Positives = 138/348 (39%), Gaps = 74/348 (21%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVS-SIRVCRDAVT----------KTSLGYAYVNF-- 83
           LY+G+LDPT  +  +  I++ +G  + ++R+  +             K + GY +V+F  
Sbjct: 56  LYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPKNNQGYCFVDFPS 115

Query: 84  NDHEAGKKAIEQLNYTPIKGRLCRIMWS--------QRDPALRKKGSGNIFIKNLHPDID 135
           + H A       +       +  ++ W+             ++   + +IF+ +L P++ 
Sbjct: 116 STHAANALLKNGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFVGDLAPNVT 175

Query: 136 NKALFETF-SVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEI 193
              LFE F + + +   +KI  D+ TG SKG+GFV F +    + A+  + G+ LNG+ I
Sbjct: 176 ESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNGRAI 235

Query: 194 YVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDG 253
            V P   +++  S   +      N    ++N E  D  F              L K +  
Sbjct: 236 KVGPTSGQQQHVSGNND-----YNRSSSSLNNENVDSRF--------------LSKGQSF 276

Query: 254 KLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKM 313
              G   + F+++                  + F+   Q++               L   
Sbjct: 277 LSNGNNNMGFKRNH----------------MSQFIYPVQQQ-------------PSLNHF 307

Query: 314 AKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGF 361
                  +F+  L   + +++L+  F P+GTI  V++     GK  GF
Sbjct: 308 TDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPV---GKCCGF 352

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 35  ASLYVGELDPTVSEALLYDIF-SPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
            S++VG+L P V+E+ L+++F +   S S  ++  D VT  S GY +V F + +  + A+
Sbjct: 163 CSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLAL 222

Query: 94  EQLNYTPIKGRLCRI 108
            ++    + GR  ++
Sbjct: 223 SEMQGVFLNGRAIKV 237

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 61/140 (43%), Gaps = 10/140 (7%)

Query: 256 KGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAK 315
           +G+ FVDF     AA A+        K+  L  +   KK +          ++      K
Sbjct: 106 QGYCFVDFPSSTHAANAL-------LKNGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVK 158

Query: 316 Y-QGVNLFVKNLDDSIDDEKLKEEFAP-YGTITSVRVMRTD-NGKSKGFGFVCFSTPEEA 372
                ++FV +L  ++ + +L E F   Y + +  +++     G SKG+GFV F+  +E 
Sbjct: 159 SGNNCSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQ 218

Query: 373 TKAITEKNQQIVAGKPLYVA 392
             A++E     + G+ + V 
Sbjct: 219 QLALSEMQGVFLNGRAIKVG 238

>Scas_376.1
          Length = 404

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 97/216 (44%), Gaps = 35/216 (16%)

Query: 218 VYVKNINLETTDEEFNELFA------KYGNVLSSSLEKTE------DGKL---KGFGFVD 262
           V++ N+  +TT EE  +LF       + G V    + +        DGK    KGF ++D
Sbjct: 129 VWIGNLTFDTTKEELIKLFTAKTRENEVGKVTEEDIVRVHMPLAHNDGKKIKNKGFCYMD 188

Query: 263 FEKHEDAAKAVE----ELNGTEF--KDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKY 316
           F+ +E     ++    +LNG     KD   +  R  K    +  L K    SR+      
Sbjct: 189 FKTNEQMESIIKLSESQLNGRNMLIKDSKSYEGRPDK--NDLVSLSKN-PPSRI------ 239

Query: 317 QGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKA 375
               LFV NL     DE LK+ F   G I  +R+    D+GK KGF F+ F + E AT A
Sbjct: 240 ----LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNA 295

Query: 376 ITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR 411
           + +K  + +A +P+ +   + +  R+ +    ++ R
Sbjct: 296 LKDKTCRKIAARPIRMEYGEDRSKRQVKRRDPVEPR 331

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 12/115 (10%)

Query: 77  GYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPALRKKG----------SGNIF 126
           G+ Y++F  +E  +  I +L+ + + GR   I  S+       K           S  +F
Sbjct: 183 GFCYMDFKTNEQMESII-KLSESQLNGRNMLIKDSKSYEGRPDKNDLVSLSKNPPSRILF 241

Query: 127 IKNLHPDIDNKALFETFSVFGNILSSKIAT-DETGKSKGFGFVHFEHESSAKEAI 180
           + NL  D  ++ L + F   G I+  ++AT  ++GK KGF F+ F  E  A  A+
Sbjct: 242 VGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNAL 296

>KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor
           singleton, start by similarity
          Length = 432

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 115/282 (40%), Gaps = 42/282 (14%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           + +KNL P+ ++  +   F   G+IL   + TD T        + F   SS  +A+ A++
Sbjct: 39  VLVKNLPPNYNHHKVRRYFKTCGSILQIDV-TDSTDGDSKLARIEF---SSYDQALTAVS 94

Query: 185 GML--LNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGN- 241
             L  +   +I V           QL ++      ++V N        +   L ++Y + 
Sbjct: 95  RTLKKIGFHQITV----------EQLTDS-----TIWVTNFPPGYDASKLRNLLSQYIDS 139

Query: 242 -VLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLF--VSRAQKKYERM 298
            +LS  L        + F +VD    E A KA   LNG E  +  L   +S   ++ ER 
Sbjct: 140 PILSIRLPSLAFNSRRRFAYVDLVSPEVAKKATNRLNGIEINNYKLVAKISNVNERTERT 199

Query: 299 QELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVM---RTDN 355
                          A   G  + VKNL D I  + L + F  +G     R++    T+ 
Sbjct: 200 DN-------------AISDGREIIVKNLPDDITIDDLIKMFNEFGDTEKARIVTGDETNP 246

Query: 356 GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397
           G+   + F+ F     A  A++  N  ++ GKPL+V+   RK
Sbjct: 247 GRHSRYAFITFKNKASADNALS-LNGAVMNGKPLHVSKVMRK 287

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 69/127 (54%), Gaps = 9/127 (7%)

Query: 78  YAYVNFNDHEAGKKAIEQLNYTPIKG-RLCRIMWSQRDPALRKKGSGN----IFIKNLHP 132
           +AYV+    E  KKA  +LN   I   +L   + +  +   R   + +    I +KNL  
Sbjct: 157 FAYVDLVSPEVAKKATNRLNGIEINNYKLVAKISNVNERTERTDNAISDGREIIVKNLPD 216

Query: 133 DIDNKALFETFSVFGNILSSKIAT-DET--GKSKGFGFVHFEHESSAKEAIDALNGMLLN 189
           DI    L + F+ FG+   ++I T DET  G+   + F+ F++++SA  A+ +LNG ++N
Sbjct: 217 DITIDDLIKMFNEFGDTEKARIVTGDETNPGRHSRYAFITFKNKASADNAL-SLNGAVMN 275

Query: 190 GQEIYVA 196
           G+ ++V+
Sbjct: 276 GKPLHVS 282

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 115/261 (44%), Gaps = 34/261 (13%)

Query: 82  NFNDHEAGKK-----AIEQLNYTPIK---GRLCRIMWSQRDPAL-------RKKG----- 121
           N+N H+  +      +I Q++ T       +L RI +S  D AL       +K G     
Sbjct: 47  NYNHHKVRRYFKTCGSILQIDVTDSTDGDSKLARIEFSSYDQALTAVSRTLKKIGFHQIT 106

Query: 122 -----SGNIFIKNLHPDIDNKALFETFSVFGN--ILSSKIATDETGKSKGFGFVHFEHES 174
                   I++ N  P  D   L    S + +  ILS ++ +      + F +V      
Sbjct: 107 VEQLTDSTIWVTNFPPGYDASKLRNLLSQYIDSPILSIRLPSLAFNSRRRFAYVDLVSPE 166

Query: 175 SAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNE 234
            AK+A + LNG+ +N  ++ VA      ER  + +   +    + VKN+  + T ++  +
Sbjct: 167 VAKKATNRLNGIEINNYKL-VAKISNVNERTERTDNAISDGREIIVKNLPDDITIDDLIK 225

Query: 235 LFAKYGNVLSSSL---EKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRA 291
           +F ++G+   + +   ++T  G+   + F+ F+    A  A+  LNG     + L VS+ 
Sbjct: 226 MFNEFGDTEKARIVTGDETNPGRHSRYAFITFKNKASADNALS-LNGAVMNGKPLHVSKV 284

Query: 292 QKK-YERMQELKKQYEASRLE 311
            +K Y   QE+K+   ASR E
Sbjct: 285 MRKAYLERQEVKRLL-ASRKE 304

>KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 589

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 12/170 (7%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVS-SIRVCRDAVTKTS-----LGYAYVNFNDHEAGK 90
           LY+G+L+P  +E  +  I+S +G  +  +++ + +    S      GY +V F +  A  
Sbjct: 58  LYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQMAAS 117

Query: 91  KAIEQLNY-TPIKGRLC-RIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETF-SVFG 147
            A+ +     P+      ++ W+    A   + +  +F+ +L P++    LFE F S + 
Sbjct: 118 NALMKSGLRVPMDSNYALKLNWASFATAPGSEFT--LFVGDLAPNVTEAQLFELFISRYS 175

Query: 148 NILSSKIATDE-TGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVA 196
           + L++KI  D+ TG SKG+GFV F +E   + A+  + G  LNG+ I V 
Sbjct: 176 STLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVG 225

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 36  SLYVGELDPTVSEALLYDIF-SPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           +L+VG+L P V+EA L+++F S   S  + ++  D  T  S GY +V F +    ++A+ 
Sbjct: 151 TLFVGDLAPNVTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALV 210

Query: 95  QLNYTPIKGRLCRI 108
           ++  T + GR  R+
Sbjct: 211 EMQGTFLNGRAIRV 224

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/184 (20%), Positives = 80/184 (43%), Gaps = 15/184 (8%)

Query: 120 KGSGNIFIKNLHPDIDNKALFETFSVFG--NILSSKIATDETGKS-----KGFGFVHFEH 172
           + S  +++ +L+PD     +   +S+ G  N+    I +    KS      G+ FV F +
Sbjct: 53  QNSTQLYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPN 112

Query: 173 ESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEF 232
           + +A       N ++ +G  + +  +   K   +           ++V ++    T+ + 
Sbjct: 113 QMAAS------NALMKSGLRVPMDSNYALKLNWASFATAPGSEFTLFVGDLAPNVTEAQL 166

Query: 233 NELF-AKYGNVLSSSLEKTE-DGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSR 290
            ELF ++Y + L++ +   +  G  KG+GFV F    +  +A+ E+ GT    + + V  
Sbjct: 167 FELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVGT 226

Query: 291 AQKK 294
             K 
Sbjct: 227 TSKN 230

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 80/191 (41%), Gaps = 25/191 (13%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGN-------VLSSSLEKTEDGKLKGFGFVDFEKHED 268
           T +Y+ ++N + T+ +   +++  G        + SS+  K+      G+ FV+F     
Sbjct: 56  TQLYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQMA 115

Query: 269 AAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDD 328
           A+ A             L  S  +   +    LK  + +      +++    LFV +L  
Sbjct: 116 ASNA-------------LMKSGLRVPMDSNYALKLNWASFATAPGSEF---TLFVGDLAP 159

Query: 329 SIDDEKLKEEF-APYGTITSVRVMRTD-NGKSKGFGFVCFSTPEEATKAITEKNQQIVAG 386
           ++ + +L E F + Y +  + +++     G SKG+GFV F    E  +A+ E     + G
Sbjct: 160 NVTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNG 219

Query: 387 KPLYVAIAQRK 397
           + + V    + 
Sbjct: 220 RAIRVGTTSKN 230

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 6/76 (7%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
            ++++G L   ++E  L   F P G +  +++    V K   G  +V + D  + + AI 
Sbjct: 316 TTVFIGGLSTLITEDELRSYFQPFGQIVYVKI---PVGK---GCGFVQYVDRISAETAIS 369

Query: 95  QLNYTPIKGRLCRIMW 110
           ++   PI     R+ W
Sbjct: 370 KMQGFPIGNSRIRLSW 385

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 28/69 (40%), Gaps = 5/69 (7%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +FI  L   I    L   F  FG I+  KI        KG GFV +    SA+ AI  + 
Sbjct: 318 VFIGGLSTLITEDELRSYFQPFGQIVYVKIPVG-----KGCGFVQYVDRISAETAISKMQ 372

Query: 185 GMLLNGQEI 193
           G  +    I
Sbjct: 373 GFPIGNSRI 381

>Scas_598.1
          Length = 516

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 100/212 (47%), Gaps = 38/212 (17%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEK-TEDGKLKGFGFVDFEKHEDAAKAVEEL 276
           +++  +N ETT+++  + F+KYGNV+   + K    G+ +GFGF+ FE     + +V+E+
Sbjct: 202 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFE----LSSSVDEV 257

Query: 277 NGTE--FKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEK 334
             T+     + +   RA  + E+             +K  K     +FV  +   +  ++
Sbjct: 258 VKTQHILDGKVIDPKRAIPREEQ-------------DKTGK-----IFVGGIGPDVRPKE 299

Query: 335 LKEEFAPYGTITSVRVM----RTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 390
            +E FA +GTI   ++M      D G+S+GFGF+ + +  EA   + +       GK + 
Sbjct: 300 FEEFFAQWGTIIDAQLMLLMLDKDTGRSRGFGFITYDS-SEAVDRVCQNKYIDFKGKQIE 358

Query: 391 VAIAQRKDVRRS--------QLAQQIQARTQM 414
           +  A  + +++         Q   Q+QA  QM
Sbjct: 359 IKRAAPRHMQKGANNGRNPRQFQNQMQAPPQM 390

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 79/151 (52%), Gaps = 12/151 (7%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L++G L+   +E  L D FS  G+V  +++ +D  T  S G+ ++ F    +  + ++  
Sbjct: 202 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 261

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIA- 155
           +   + G++  I   +  P   +  +G IF+  + PD+  K   E F+ +G I+ +++  
Sbjct: 262 HI--LDGKV--IDPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLML 317

Query: 156 ---TDETGKSKGFGFVHFEHESSAKEAIDAL 183
                +TG+S+GFGF+ ++    + EA+D +
Sbjct: 318 LMLDKDTGRSRGFGFITYD----SSEAVDRV 344

>CAGL0H03861g complement(361189..362520) similar to sp|P38922
           Saccharomyces cerevisiae YNL004w HRB1, start by
           similarity
          Length = 443

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 85/203 (41%), Gaps = 19/203 (9%)

Query: 104 RLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSK 163
           RL R + S  +  + +  + +IF+ NL  D   + L + FS  G ++ + I T   G  +
Sbjct: 88  RLARELDSTYEEKVNRNYTNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADIITSR-GHHR 146

Query: 164 GFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETK--AHFTNV--- 218
           G G V F       EAI   +G  L  ++I+V       E  S         H TNV   
Sbjct: 147 GMGTVEFTSGEEVDEAIRKFDGAYLMNRQIFVRQDNPPPESSSTHSSGSNSGHTTNVTKP 206

Query: 219 -------------YVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEK 265
                         + N+    + +    +F ++G+VL +++E    G   G G V F+ 
Sbjct: 207 KKAVKPQKKGYELMILNLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIFKN 266

Query: 266 HEDAAKAVEELNGTEFKDQTLFV 288
            ED  KA E  NG E + + L V
Sbjct: 267 QEDMVKAYEHFNGFEIEGKVLEV 289

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 104/266 (39%), Gaps = 38/266 (14%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTS--LGYAYVNFNDHEAGKKAI 93
           S++VG L    +   L D FS +G V    V  D +T      G   V F   E   +AI
Sbjct: 108 SIFVGNLTYDCTPEDLKDFFSQVGKV----VRADIITSRGHHRGMGTVEFTSGEEVDEAI 163

Query: 94  EQLNYTPIKGRLCRIMWSQRDP-------------------------ALRKKGSG-NIFI 127
            + +   +  R  +I   Q +P                         A++ +  G  + I
Sbjct: 164 RKFDGAYLMNR--QIFVRQDNPPPESSSTHSSGSNSGHTTNVTKPKKAVKPQKKGYELMI 221

Query: 128 KNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGML 187
            NL   I  + L   F  FG++L + +  D TG S G G V F+++    +A +  NG  
Sbjct: 222 LNLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIFKNQEDMVKAYEHFNGFE 281

Query: 188 LNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSL 247
           + G+ + V   +    + S   +T     N   ++I ++    E  +  A   +V S   
Sbjct: 282 IEGKVLEVRGQIPDPTQISSTRKTDDLTVNQDNEDIEMDIDTAEGGDEKALKADVSSDGG 341

Query: 248 EKTEDGKLKGFGFVDFEKHEDAAKAV 273
            + ++     F   D+ K ED +K +
Sbjct: 342 ARAQN----KFSSDDYVKTEDKSKII 363

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 1/91 (1%)

Query: 301 LKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKG 360
           L ++ +++  EK+ +    ++FV NL      E LK+ F+  G +    ++ T  G  +G
Sbjct: 89  LARELDSTYEEKVNRNYTNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADII-TSRGHHRG 147

Query: 361 FGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
            G V F++ EE  +AI + +   +  + ++V
Sbjct: 148 MGTVEFTSGEEVDEAIRKFDGAYLMNRQIFV 178

>CAGL0L12672g complement(1359637..1361685) similar to sp|P37838
           Saccharomyces cerevisiae YPL043w nucleolar protein,
           start by similarity
          Length = 682

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 92/213 (43%), Gaps = 33/213 (15%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +F++++   + ++ L + FS F  I  + +  D   KS+GFGFV F  E   K A+    
Sbjct: 24  LFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKEAR 83

Query: 185 GMLLNGQEIYVAPHLTRKERDSQLEETKAHFT---------------------------- 216
              L+G ++ V     R++R  + E+  A                               
Sbjct: 84  KTKLDGAQLKVDI-ARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLKG 142

Query: 217 --NVYVKNINLETTD-EEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAV 273
              + ++N+     D  +  ++F KYG V+ +S+ +  DGKL GF FV   K  +  KA+
Sbjct: 143 KPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKAL 202

Query: 274 EELNGTEFKDQTLFVSRAQKKYERMQELKKQYE 306
           E+        + + V  A +K  + +E K +YE
Sbjct: 203 EDTKNLTIDGRKVAVDFAVQK-NKWEEYKTKYE 234

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 87/201 (43%), Gaps = 20/201 (9%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277
           ++V++I    TDE+  + F+ +  +  + + K  + K +GFGFV F   +D   A++E  
Sbjct: 24  LFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKEAR 83

Query: 278 GTEFKDQTLFV--SRAQKKYERMQELKKQYEASRLEKMAKYQGVN--------------- 320
            T+     L V  +R + +  + ++   Q E  R      Y   N               
Sbjct: 84  KTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLKGK 143

Query: 321 --LFVKNLDDSIDD-EKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAIT 377
             L ++N+  S  D  KLK+ F  YG +    + R  +GK  GF FV  +      KA+ 
Sbjct: 144 PKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKALE 203

Query: 378 EKNQQIVAGKPLYVAIAQRKD 398
           +     + G+ + V  A +K+
Sbjct: 204 DTKNLTIDGRKVAVDFAVQKN 224

 Score = 37.0 bits (84), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAID 181
           ++F++N+  D   ++LF+ FS FG +  +    D+ TG +KG  FV F+ E + K  +D
Sbjct: 291 SVFVRNVPYDATEESLFDHFSKFGPVKYALPVIDKNTGLAKGTAFVAFKDEKTYKYCVD 349

>Kwal_27.12337
          Length = 209

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 82/171 (47%), Gaps = 27/171 (15%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           ++YVG +DP V+  +LY++F  I  V+ IR  +D + +T  G+A+V F + +  + A + 
Sbjct: 11  TVYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYATKC 70

Query: 96  LNYTPIKGRLCRIMWSQRDPALRK-KGSGN-------------IFIKNLHPDIDNKALFE 141
           LN +        +    R   +RK  G+G+             +F+KN+   +D  AL  
Sbjct: 71  LNNS--------LRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATALTR 122

Query: 142 TFSVFGNILSS-KIATDETG--KSKGFGFVHFEHESSAKEAIDALNGMLLN 189
            FS FG +  + +I   + G  K     +  FEH   A   ++  N M++N
Sbjct: 123 IFSKFGPLAKAPEIFYLKQGVLKCAYVSYTTFEHSDKALAKLN--NQMVMN 171

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 81/178 (45%), Gaps = 21/178 (11%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLK---GFGFVDFEKHEDAAKAVE 274
           VYV N++ + T E   ELF +   V  + +   +D  L+   GF FV+F   +D   A +
Sbjct: 12  VYVGNVDPKVTREILYELFLQICPV--AKIRYPKDKILQTHQGFAFVEFYNAQDCEYATK 69

Query: 275 ELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRL--EKMAKYQGVNLFVKNLDDSIDD 332
            LN +             + Y+R  +++K   A      + A   G  LFVKN+D+ +D 
Sbjct: 70  CLNNS------------LRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDA 117

Query: 333 EKLKEEFAPYGTITSV-RVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
             L   F+ +G +     +     G  K   +V ++T E + KA+ + N Q+V  K +
Sbjct: 118 TALTRIFSKFGPLAKAPEIFYLKQGVLKC-AYVSYTTFEHSDKALAKLNNQMVMNKCI 174

>ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH]
           (140625..141752) [1128 bp, 375 aa]
          Length = 375

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 86/191 (45%), Gaps = 25/191 (13%)

Query: 218 VYVKNINLETTDEEFNELFA------KYGNVLSSSLEKTE------DGKL---KGFGFVD 262
           V++ N+  +TT EE            + G V  + + +        DGK    KGF +VD
Sbjct: 107 VWIGNMAFDTTQEELRRFVVSKTAGMEAGEVTDADIVRVNMPLAKNDGKQIKNKGFAYVD 166

Query: 263 FEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVN-L 321
           F        AV  L+  +   + L +  A K Y+       +   + L  M+K      L
Sbjct: 167 FATSAQM-DAVIGLSEAQLNGRNLLIKNA-KSYD------GRPAKNDLISMSKNPPSRIL 218

Query: 322 FVKNLDDSIDDEKLKEEFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKN 380
           FV NL     DE LK+ F   G I  +R+    D+GK KGF FV F     AT A+T+++
Sbjct: 219 FVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDRS 278

Query: 381 QQIVAGKPLYV 391
            + +AG+PL +
Sbjct: 279 CRAIAGRPLRM 289

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIAT-DETGKSKGFGFVHFEHESSAKEAIDAL 183
           +F+ NL  D  ++ L + F   G I+  ++AT  ++GK KGF FV F  E+ A  A+   
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDR 277

Query: 184 NGMLLNGQEIYV 195
           +   + G+ + +
Sbjct: 278 SCRAIAGRPLRM 289

 Score = 36.2 bits (82), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 34/76 (44%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L+VG L    ++ LL   F   G +  IR+     +    G+A+V+F D      A+   
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDR 277

Query: 97  NYTPIKGRLCRIMWSQ 112
           +   I GR  R+ + +
Sbjct: 278 SCRAIAGRPLRMEYGE 293

>Kwal_33.14463
          Length = 393

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 90/211 (42%), Gaps = 41/211 (19%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTE-------------DGKL---KGFGFV 261
           V++ N++ +T+ E+    F      L  S    E             DGK    KGF  +
Sbjct: 125 VWIGNLSFDTSKEDLCRFFVAKTKELDESCRIEESDIVRVNLPLAQNDGKQIKNKGFAHM 184

Query: 262 DFEKHE--DAAKAVEE--LNGTEF--KDQTLFVSRAQKKYERMQELKKQYEASRLEKMAK 315
           +F+  E  +A  A+ E  LNG     KD + F  R  K              + L  M+K
Sbjct: 185 NFKTQEQMNAVVALSESHLNGRNLLIKDSSSFDGRPDK--------------NDLISMSK 230

Query: 316 YQGVN-LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEAT 373
                 LFV NL     DE LK+ F   G I  +R+    D GK KGF FV F   E  T
Sbjct: 231 NPPSRILFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPT 290

Query: 374 KAITEKNQQIVAGKPLYVAIAQ---RKDVRR 401
            A+ +K  + +AG+PL +   +   ++ VRR
Sbjct: 291 NALKDKTCRKIAGRPLRMEFGEDRSKRQVRR 321

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L+VG L    ++ LL   F   G +  IR+     T    G+A+V+F D E    A++  
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 97  NYTPIKGRLCRIMWSQ 112
               I GR  R+ + +
Sbjct: 297 TCRKIAGRPLRMEFGE 312

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 55/120 (45%), Gaps = 22/120 (18%)

Query: 77  GYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQ---------------RDPALRKKG 121
           G+A++NF   E    A+  L+ + + GR   I  S                ++P  R   
Sbjct: 180 GFAHMNFKTQEQ-MNAVVALSESHLNGRNLLIKDSSSFDGRPDKNDLISMSKNPPSRI-- 236

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT-DETGKSKGFGFVHFEHESSAKEAI 180
              +F+ NL  D  ++ L + F   G+I+  ++AT  +TGK KGF FV F+ E     A+
Sbjct: 237 ---LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNAL 293

>Kwal_27.10364
          Length = 443

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 96/202 (47%), Gaps = 19/202 (9%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFG-NILSSKIATDETGKSKGFGFVHFEHESSAKEAI 180
           +  +++ N  P      L + FS FG  +LS +  +      + F +V       AK  +
Sbjct: 116 NSTLWVTNYPPLFGELELQKLFSQFGGTVLSIRFPSLRYDSHRRFAYVDMASSEEAKLIV 175

Query: 181 DALNGMLLNGQEIYVA---PHLTRKERDSQLEETKAHFTNVYVKNIN-LETTDEEFNELF 236
           D L+G +++  E+ +    P    K  DS + E +     VY+KN++    ++E  ++ F
Sbjct: 176 DRLHGFVVDNHELIIKLSNPLKAEKRTDSDVLERR----QVYLKNLDYFRVSEEIISKSF 231

Query: 237 AKYGNVLSSSLEKTEDGKLK--------GFGFVDFEKHEDAAKAVEELNGTEFKDQTLFV 288
           +KYG++   SL   E+  L         GFGFV F +   AA ++ +L+G+E + + + V
Sbjct: 232 SKYGHIERISLPHKEEPGLSGAEKRLNDGFGFVTFSESTSAASSL-QLDGSELEGRKISV 290

Query: 289 SRAQKK-YERMQELKKQYEASR 309
           + A +K Y   Q +K+     R
Sbjct: 291 TLADRKAYIERQAVKRLLHRKR 312

>Kwal_0.250
          Length = 216

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 58/118 (49%), Gaps = 2/118 (1%)

Query: 259 GFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQG 318
           G V+F   E  +KA+++ +G  F  + LFV   +     M+  +   +   LE+   + G
Sbjct: 2   GTVEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERF--HPG 59

Query: 319 VNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAI 376
             +F+ NL  S   + LK+ F   G  T   V    NG+SKGFG V F T +EA  A+
Sbjct: 60  YEIFIANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTAL 117

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 87/215 (40%), Gaps = 34/215 (15%)

Query: 81  VNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDP-ALRKKGSG-------------NIF 126
           V F++ E   KAI++ +     GR   +   +  P ++R + SG              IF
Sbjct: 4   VEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERFHPGYEIF 63

Query: 127 IKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDA---- 182
           I NL      ++L + F   GN   + +  D  G+SKGFG V FE    A+ A+D     
Sbjct: 64  IANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTALDKFQHF 123

Query: 183 -LNGMLLNGQEIY-------------VAPHLTRKERDSQLEETKAHFTNVYVKNINLETT 228
            L G +L  +  Y             V+  +  +  ++  E  K++   +YV N+   T 
Sbjct: 124 DLEGRILELKRGYGPWEEEPSPVSADVSTTIAPQTENASGEGHKSN--TIYVDNLPYATA 181

Query: 229 DEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDF 263
             +  +LF   G V  + L+     K  G   V +
Sbjct: 182 QSDLYDLFETIGVVERAELKYDRKVKPTGAAIVSY 216

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 62/139 (44%), Gaps = 8/139 (5%)

Query: 166 GFVHFEHESSAKEAIDALNGMLLNGQEIYV-----APHLTRKERDSQLEETKAHFT---N 217
           G V F +     +AI   +G    G+E++V      P   R E     + T   F     
Sbjct: 2   GTVEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERFHPGYE 61

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277
           +++ N+   T+ +   +LF   GN   + ++   +G+ KGFG V FE  ++A  A+++  
Sbjct: 62  IFIANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTALDKFQ 121

Query: 278 GTEFKDQTLFVSRAQKKYE 296
             + + + L + R    +E
Sbjct: 122 HFDLEGRILELKRGYGPWE 140

>YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein
           with three RNA recognition motif (RRM) domains, has
           similarity to human 64K polyadenylation factor [2346 bp,
           781 aa]
          Length = 781

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 65/130 (50%), Gaps = 14/130 (10%)

Query: 123 GNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDET-GKSKGFGFVHFEHESSAKEAID 181
           GNIF+  +   +    L   FS +G ILS K+  D+T G+  G+GF+ +   S A   I 
Sbjct: 195 GNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIK 254

Query: 182 ALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGN 241
            LNG  +NG  +++  H+ RKER+      + H+ +V   N      D+ F  LF   GN
Sbjct: 255 ELNGRTVNGSTLFINYHVERKERE------RIHWDHVKENN-----NDDNFRCLFI--GN 301

Query: 242 VLSSSLEKTE 251
           +   + EK E
Sbjct: 302 LPYHNPEKVE 311

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 93/458 (20%), Positives = 173/458 (37%), Gaps = 106/458 (23%)

Query: 34  PASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
           P +++VG +  ++S   L  +FS  G + S+++  D       GY ++++         I
Sbjct: 194 PGNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCI 253

Query: 94  EQLNYTPIKGRLC------------RIMWSQRDPALRKKGSGNIFIKNL----------- 130
           ++LN   + G               RI W              +FI NL           
Sbjct: 254 KELNGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPEKVETL 313

Query: 131 -----------------HPDIDNKALF------------ETFSVFGNILSSKIATDETGK 161
                             PD D  + +             +F+  G++ S+K + +  G 
Sbjct: 314 ITPKEVIEVIKKELSKKFPDFDIISYYFPKRSNTRSSSSVSFNEEGSVESNKSSNNTNGN 373

Query: 162 S------KGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHF 215
           +      KG+GF+   +   A  AI+  NG + +G  + V   +  K  ++      +H 
Sbjct: 374 AQDEDMLKGYGFIKLINHEQALAAIETFNGFMWHGNRLVVNKAVQHKVYNNH----NSHD 429

Query: 216 TNVYVKNIN----LETTDEEF----NELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHE 267
            +  + N N    LE  +       N  + +Y    + +    +   ++ F  V      
Sbjct: 430 RHPSISNHNDMEVLEFANNPMYDYNNYTYDRYYFNNNKNGNSNDTSNVRYFDSVR----- 484

Query: 268 DAAKAVEELNGTEFKDQTLFVSRAQK-------KYERMQELKKQYEASRLEKMAKYQGVN 320
            +    E+++    + ++    R Q+       K++  Q     Y  S    M+  Q  N
Sbjct: 485 -STPVAEKMDLFYPQRESFSEGRGQRVPRFMGNKFDMYQYPSTSY--SLPIPMSNQQESN 541

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVM----------------RTDN----GKSKG 360
           L+VK++  S  DE L + +  +G I SV+V+                 +DN    G S+G
Sbjct: 542 LYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPVGSSRG 601

Query: 361 FGFVCFSTPEEATKAITEKN-QQIVAGKPLYVAIAQRK 397
           +GFV F +P +A KAI   +  Q+   + L V+ AQ++
Sbjct: 602 YGFVSFESPLDAAKAILNTDGYQVSKDQVLSVSFAQKR 639

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 320 NLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDN-GKSKGFGFVCFSTPEEATKAITE 378
           N+FV  +  S+   +L   F+ YG I S++++     G+  G+GF+ +    +A+  I E
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKE 255

Query: 379 KNQQIVAGKPLYVAI-AQRKDVRR 401
            N + V G  L++    +RK+  R
Sbjct: 256 LNGRTVNGSTLFINYHVERKERER 279

>KLLA0D05016g complement(431592..432380) similar to sp|P25555
           Saccharomyces cerevisiae YCL011c GBP2 potential
           telomere-associated protein, start by similarity
          Length = 262

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/261 (21%), Positives = 94/261 (36%), Gaps = 30/261 (11%)

Query: 165 FGFVHFEHESSAKEAIDALNGMLLNGQEIYVAP--------HLTRKERDSQLEETKAHFT 216
            G V F + +    AI   +G  LNG+ I+V            T           +AH  
Sbjct: 1   MGTVEFNNSTDVDTAIRDCDGAFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDE 60

Query: 217 N--VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVE 274
              V+V  +      +E  ++F   G+VL + +    DGK +GFG V     E    A+ 
Sbjct: 61  GFEVFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAIR 120

Query: 275 ELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASR----------------LEKMAKYQG 318
              GTE+K + L V   +    R           R                ++ +A   G
Sbjct: 121 HWTGTEYKGRVLDVKEGKGTSTRTAATGADTYIPRQPRNEPPATLKPKPLDIDPLAITTG 180

Query: 319 VN----LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATK 374
            +    +F +N+  S  +  L + F     +   +++    G      +  F TPE+A  
Sbjct: 181 GDRNSVIFCENMPSSTTESDLYDLFGSVAPVIITKLLLNPEGHFTRNSYCQFETPEDADI 240

Query: 375 AITEKNQQIVAGKPLYVAIAQ 395
            I++ ++       L V  A+
Sbjct: 241 CISKLDKYSYGDHELKVTYAR 261

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 78/198 (39%), Gaps = 30/198 (15%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +F+  L   ++ + L + F   G++L + + TD  GKS+GFG V+   +    +AI    
Sbjct: 64  VFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAIRHWT 123

Query: 185 GMLLNGQEIYV------------------APHLTRKERDSQLEETKAHF----------- 215
           G    G+ + V                   P   R E  + L+                 
Sbjct: 124 GTEYKGRVLDVKEGKGTSTRTAATGADTYIPRQPRNEPPATLKPKPLDIDPLAITTGGDR 183

Query: 216 -TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVE 274
            + ++ +N+   TT+ +  +LF     V+ + L    +G      +  FE  EDA   + 
Sbjct: 184 NSVIFCENMPSSTTESDLYDLFGSVAPVIITKLLLNPEGHFTRNSYCQFETPEDADICIS 243

Query: 275 ELNGTEFKDQTLFVSRAQ 292
           +L+   + D  L V+ A+
Sbjct: 244 KLDKYSYGDHELKVTYAR 261

>KLLA0C05522g 494240..495862 some similarities with sp|P32831
           Saccharomyces cerevisiae YBR212w NGR1
           glucose-repressible RNA-binding protein, hypothetical
           start
          Length = 540

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 96/219 (43%), Gaps = 59/219 (26%)

Query: 34  PASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRD------AVTKTSL----------- 76
           P +L++G+LDP   E ++  I+  +G    +++ +        +  TS+           
Sbjct: 19  PRTLWMGDLDPGFDELIIASIWQSLGKSVKVKLIKSKTNALVPINSTSIPNNASSNALEI 78

Query: 77  ----------------GYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQR--DPALR 118
                           GY +V F   E  ++A+  LN TPI    C    S+R  D   R
Sbjct: 79  NGVSFIDPNKTNLHHAGYCFVEFESFEDAQQALT-LNATPIPNISCNTTASKRTNDDGKR 137

Query: 119 K------KGSG-----------NIFIKNLHP---DIDNKALFETFSVFGNILSSKIATDE 158
           K       G+            ++F+ +L P   + D  +LF+T   + ++ + ++ TD 
Sbjct: 138 KFRLNWANGATLHSTILPTPEFSLFVGDLSPFATEADLLSLFQT--KYNSVKTVRVMTDP 195

Query: 159 -TGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVA 196
            TG S+ FGFV F +E+  + A+  +NG+   G+++ VA
Sbjct: 196 ITGASRCFGFVRFANETERRNALIEMNGVQFQGRQLRVA 234

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 36  SLYVGELDPTVSEALLYDIF-SPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           SL+VG+L P  +EA L  +F +   SV ++RV  D +T  S  + +V F +    + A+ 
Sbjct: 160 SLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALI 219

Query: 95  QLNYTPIKGRLCRIMWSQ-RDPALRKKGSGNIFIKNLHPDI 134
           ++N    +GR  R+ ++  R+   ++  SGN+  + LH +I
Sbjct: 220 EMNGVQFQGRQLRVAYATPRNNVAQQHLSGNLG-QQLHSNI 259

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAID 181
           S  +F+  L+P+I+   LFE F  FG I   KI        K  GFV +     A+ AI+
Sbjct: 444 STTVFVGGLNPNINELQLFELFKPFGTITDVKIP-----PGKQCGFVKYNERLEAEAAIN 498

Query: 182 ALNGMLLNGQEIYVA 196
            L G ++ G  I ++
Sbjct: 499 GLQGFIIMGSPIRLS 513

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 314 AKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEAT 373
           A      +FV  L+ +I++ +L E F P+GTIT V++        K  GFV ++   EA 
Sbjct: 440 AGVSSTTVFVGGLNPNINELQLFELFKPFGTITDVKI-----PPGKQCGFVKYNERLEAE 494

Query: 374 KAITEKNQQIVAGKPLYVA 392
            AI      I+ G P+ ++
Sbjct: 495 AAINGLQGFIIMGSPIRLS 513

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
            +++VG L+P ++E  L+++F P G+++ +++             +V +N+    + AI 
Sbjct: 445 TTVFVGGLNPNINELQLFELFKPFGTITDVKI------PPGKQCGFVKYNERLEAEAAIN 498

Query: 95  QLNYTPIKGRLCRIMWSQ 112
            L    I G   R+ W +
Sbjct: 499 GLQGFIIMGSPIRLSWGR 516

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 64/151 (42%), Gaps = 14/151 (9%)

Query: 164 GFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLT-----RKERDSQLEETKAHFT-- 216
           G+ FV FE    A++A+      + N      A   T     RK R +       H T  
Sbjct: 95  GYCFVEFESFEDAQQALTLNATPIPNISCNTTASKRTNDDGKRKFRLNWANGATLHSTIL 154

Query: 217 -----NVYVKNINLETTDEEFNELF-AKYGNVLSSS-LEKTEDGKLKGFGFVDFEKHEDA 269
                +++V +++   T+ +   LF  KY +V +   +     G  + FGFV F    + 
Sbjct: 155 PTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETER 214

Query: 270 AKAVEELNGTEFKDQTLFVSRAQKKYERMQE 300
             A+ E+NG +F+ + L V+ A  +    Q+
Sbjct: 215 RNALIEMNGVQFQGRQLRVAYATPRNNVAQQ 245

>YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA
           splicing factor, responsible for reannealing U4 and U6
           snRNAs to recycle snRNPs for subsequent splicing
           reactions, has 3 RNA recognition (RRM) domains [1335 bp,
           444 aa]
          Length = 444

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/299 (20%), Positives = 125/299 (41%), Gaps = 34/299 (11%)

Query: 118 RKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAK 177
           R +    + +KNL    +   +++ F   G I+   +A D   K+  F  + F     A 
Sbjct: 36  RNRELTTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVA-DSLKKNFRFARIEFARYDGAL 94

Query: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFA 237
            AI   + ++  GQ   +  HLT                 +++ N     T     +L  
Sbjct: 95  AAITKTHKVV--GQNEIIVSHLTE--------------CTLWMTNFPPSYTQRNIRDLLQ 138

Query: 238 KYGNV-LSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYE 296
               V LS  L        + F ++D    EDA   VE+LNG + +  TL          
Sbjct: 139 DINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTL---------- 188

Query: 297 RMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEK-LKEEFAPYGTITSVRV--MRT 353
            + ++    E S+    A  +G  + ++NL   + DE  L+E F  +G+I  + +   + 
Sbjct: 189 -VTKVSNPLEKSKRTDSATLEGREIMIRNLSTELLDENLLRESFEGFGSIEKINIPAGQK 247

Query: 354 DNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD-VRRSQLAQQIQAR 411
           ++  +    F+ F   + A +A+ + N+ ++  + + V++A +K  + R+++ + + +R
Sbjct: 248 EHSFNNCCAFMVFENKDSAERAL-QMNRSLLGNREISVSLADKKPFLERNEVKRLLASR 305

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 87/187 (46%), Gaps = 24/187 (12%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVS-SIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
            +L++    P+ ++  + D+   I  V+ SIR+       TS  +AY++    E  +  +
Sbjct: 117 CTLWMTNFPPSYTQRNIRDLLQDINVVALSIRL-PSLRFNTSRRFAYIDVTSKEDARYCV 175

Query: 94  EQLNYTPIKGRLCRIMWSQRDPALRKKGSGN-------IFIKNLHPD-IDNKALFETFSV 145
           E+LN   I+G    ++    +P  + K + +       I I+NL  + +D   L E+F  
Sbjct: 176 EKLNGLKIEGYT--LVTKVSNPLEKSKRTDSATLEGREIMIRNLSTELLDENLLRESFEG 233

Query: 146 FGNILSSKIATDETGKSKGF----GFVHFEHESSAKEAIDALNGMLLNGQEIYVA----- 196
           FG+I   KI      K   F     F+ FE++ SA+ A+  +N  LL  +EI V+     
Sbjct: 234 FGSI--EKINIPAGQKEHSFNNCCAFMVFENKDSAERALQ-MNRSLLGNREISVSLADKK 290

Query: 197 PHLTRKE 203
           P L R E
Sbjct: 291 PFLERNE 297

>Scas_705.22
          Length = 869

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 80/168 (47%), Gaps = 12/168 (7%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGK------SKGFGFVHFEHESSAK 177
           +IFIKNL+    +  L + F  F   + +++ T    K      S GFGF  F  +  A 
Sbjct: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701

Query: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEET----KAHFTNVYVKNINLETTDEEFN 233
             I AL+G +++G  I +   L+ ++  S    +    K     + VKN+  E T ++  
Sbjct: 702 AVISALDGTVIDGHRIQL--KLSHRQGSSNTTSSAKGKKIKSGKIIVKNLPFEATRKDVF 759

Query: 234 ELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEF 281
           ELF  +G + S  + K  D   +GF FV+F   ++A  A+++L G   
Sbjct: 760 ELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 3/93 (3%)

Query: 310 LEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFST 368
           +EK++K     LF++N+  +  ++  ++ F P+G +  V V + T  GKSKGF ++ F  
Sbjct: 320 MEKISKTG--RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377

Query: 369 PEEATKAITEKNQQIVAGKPLYVAIAQRKDVRR 401
           P+EA +A  E ++QI  G+ L++  A  K   R
Sbjct: 378 PKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 91/412 (22%), Positives = 159/412 (38%), Gaps = 66/412 (16%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L++  +  T +E     +F P G +  + V  D  T  S G+AY+ F D +   +A  +L
Sbjct: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGS--GNIFIKNL---------HPDIDNKALFETFSV 145
           +    +GRL  I+     PA  KK        +KN+           D  ++  F   S+
Sbjct: 389 DKQIFQGRLLHIL-----PADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSL 443

Query: 146 FGN---ILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAP--HLT 200
           + N   +L S  A     KS     +  E  +SA +   A   ++ + ++ + +    LT
Sbjct: 444 YMNQDAVLGSVAAKLGLKKS---DLIDPESSNSAVKQALAEAHIIGDVRKYFESKGVDLT 500

Query: 201 RKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGF 260
           +  +    E+  A    + VKN    TT EE  ELF  +G +    L     G +     
Sbjct: 501 KFAQTKSPEQRDAKV--ILVKNFPYGTTREEIGELFLPFGKL--KRLLMPPSGTI---AI 553

Query: 261 VDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKY-----------------ERMQELKK 303
           V++        A  +L    FKD  +++ +  K                   E + E+K 
Sbjct: 554 VEYRDTTSGRSAFTKLAFKRFKDGIIYLEKGPKDCFTRDAEPADLIEADAPEENVVEVKD 613

Query: 304 QY------------EASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRV- 350
                         E    E +A    V++F+KNL+ +    +L + F  +      +V 
Sbjct: 614 TVKEIMDSTDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVK 673

Query: 351 -----MRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397
                   D   S GFGF  F T E+A   I+  +  ++ G  + + ++ R+
Sbjct: 674 TKPDPKHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQ 725

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 70/174 (40%), Gaps = 13/174 (7%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGS--VSSIRVCRD---AVTKTSLGYAYVNFNDHEAG 89
            S+++  L+ T +   L   F       V+ ++   D   A    S+G+ +  F   E  
Sbjct: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700

Query: 90  KKAIEQLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIK--------NLHPDIDNKALFE 141
              I  L+ T I G   ++  S R  +     S              NL  +   K +FE
Sbjct: 701 NAVISALDGTVIDGHRIQLKLSHRQGSSNTTSSAKGKKIKSGKIIVKNLPFEATRKDVFE 760

Query: 142 TFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
            F+ FG + S ++       ++GF FV F     A+ A+D L G+ L G+ + +
Sbjct: 761 LFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 814

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 83/182 (45%), Gaps = 14/182 (7%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLK------GFGFVDFEKHEDA 269
            ++++KN+N  TT  E ++ F  +   + + ++   D K        GFGF +F   E A
Sbjct: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700

Query: 270 AKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDS 329
              +  L+GT      +   R Q K    Q       +++ +K+   + +   VKNL   
Sbjct: 701 NAVISALDGT-----VIDGHRIQLKLSHRQGSSNTTSSAKGKKIKSGKII---VKNLPFE 752

Query: 330 IDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389
              + + E F  +G + SVRV +  +  ++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 753 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812

Query: 390 YV 391
            +
Sbjct: 813 VM 814

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAI 180
           +G +F++N+          + F  FG +    +A D  TGKSKGF ++ F+    A +A 
Sbjct: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385

Query: 181 DALNGMLLNGQEIYVAPHLTRK 202
             L+  +  G+ +++ P   +K
Sbjct: 386 IELDKQIFQGRLLHILPADAKK 407

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 11/86 (12%)

Query: 321 LFVKNLDDSIDDEKLKEEFA----------PYGT-ITSVRVMRTDNGKSKGFGFVCFSTP 369
           + VK L   + D+ LK+ F           P  + IT V+++R   G+S+ F F+ +   
Sbjct: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63

Query: 370 EEATKAITEKNQQIVAGKPLYVAIAQ 395
           E+A  A+   N   +    L V++A+
Sbjct: 64  EDAFDAVNYFNGSYINTAKLEVSMAK 89

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 149 ILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVA 196
           I   KI  +  G+S+ F F+ + +E  A +A++  NG  +N  ++ V+
Sbjct: 39  ITDVKILRNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVS 86

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 51  LYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMW 110
           ++++F+  G + S+RV +    K++ G+A+V F   +  + A++QL    + GR   + +
Sbjct: 758 VFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQY 816

>Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement
          Length = 396

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 85/164 (51%), Gaps = 16/164 (9%)

Query: 252 DGKL---KGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEAS 308
           DGK    KGF ++DF K+++   AV  L+ ++   + + +  +   YE       + + +
Sbjct: 166 DGKKIRNKGFAYMDF-KNKEQMNAVIGLSESQLNGRNMLIKNSSS-YE------GRPDKN 217

Query: 309 RLEKMAKYQGVN-LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMR-TDNGKSKGFGFVCF 366
            L  M+K      LFV NL     DE L++ F   G I  VR+    D+GK KGF F+ F
Sbjct: 218 DLIAMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDF 277

Query: 367 STPEEATKAITEKNQQIVAGKPLYVAIAQ---RKDVRRSQLAQQ 407
              +  T+A+T+K+ + +AG+PL +   +   ++ V+R + + Q
Sbjct: 278 KDEKGPTEALTDKSCRKIAGRPLRMEFGEDRSKRQVKRRENSSQ 321

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 70/152 (46%), Gaps = 12/152 (7%)

Query: 77  GYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQR---DP------ALRKKGSGNI-F 126
           G+AY++F + E    A+  L+ + + GR   I  S      P      A+ K     I F
Sbjct: 174 GFAYMDFKNKEQ-MNAVIGLSESQLNGRNMLIKNSSSYEGRPDKNDLIAMSKNPPSRILF 232

Query: 127 IKNLHPDIDNKALFETFSVFGNILSSKIAT-DETGKSKGFGFVHFEHESSAKEAIDALNG 185
           + NL  D  ++ L + F   G I+  ++AT  ++GK KGF F+ F+ E    EA+   + 
Sbjct: 233 VGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALTDKSC 292

Query: 186 MLLNGQEIYVAPHLTRKERDSQLEETKAHFTN 217
             + G+ + +     R +R  +  E  + + N
Sbjct: 293 RKIAGRPLRMEFGEDRSKRQVKRRENSSQYDN 324

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 36/76 (47%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L+VG L    ++ LL   F   G +  +R+     +    G+A+++F D +   +A+   
Sbjct: 231 LFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALTDK 290

Query: 97  NYTPIKGRLCRIMWSQ 112
           +   I GR  R+ + +
Sbjct: 291 SCRKIAGRPLRMEFGE 306

>Kwal_55.20972
          Length = 135

 Score = 52.0 bits (123), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 120 KGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKE 178
           K    IF+  LH D+    +   FS +G  +  K+  D E+G+SKGF ++ +E + S   
Sbjct: 31  KDQAYIFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVL 90

Query: 179 AIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKA 213
           A+D LNG+ + G+ I V  H     RD   +  +A
Sbjct: 91  AVDNLNGVKIAGRSIRV-DHTMFTPRDDDYDYARA 124

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 3/83 (3%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           A ++VG L   ++E  +  IFS  G    +++ RD  +  S G+AY+ + D  +   A++
Sbjct: 34  AYIFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVD 93

Query: 95  QLNYTPIKGRLCRI---MWSQRD 114
            LN   I GR  R+   M++ RD
Sbjct: 94  NLNGVKIAGRSIRVDHTMFTPRD 116

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKT-EDGKLKGFGFVDFEKHEDAAKAVEEL 276
           ++V  ++ + T+ +   +F++YG  +   L +  E G+ KGF ++ +E       AV+ L
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 277 NGTEFK------DQTLFVSRAQK-KYERM--QELKKQYEA 307
           NG +        D T+F  R     Y R   +ELKK ++ 
Sbjct: 96  NGVKIAGRSIRVDHTMFTPRDDDYDYARAVEKELKKDFDC 135

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRT-DNGKSKGFGFVCFSTPEEATKAITEK 379
           +FV  L   + +  +   F+ YG    ++++R  ++G+SKGF ++ +        A+   
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 380 NQQIVAGKPLYV 391
           N   +AG+ + V
Sbjct: 96  NGVKIAGRSIRV 107

>KLLA0C14388g complement(1251548..1252159) similar to sp|Q99181
           Saccharomyces cerevisiae YOR319w HSH49 essential yeast
           splicing factor, start by similarity
          Length = 203

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 71/164 (43%), Gaps = 4/164 (2%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCR---DAVTKTSLGYAYVNFNDHEAGKKA 92
           ++YVG LD  V+++LLY++F   G +S I+  +   D        YA++ F + +     
Sbjct: 4   TVYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVNDDVDYVC 63

Query: 93  IEQLNYTPIKGRLCRIMWSQRDPALRKKGSG-NIFIKNLHPDIDNKALFETFSVFGNILS 151
               N   + G+  ++  S + P       G  +F+KNL   ID   L   F +FG +L 
Sbjct: 64  KLFDNRVSLYGKPLKVRRSNKQPETTDFDVGAKLFVKNLDESIDVPQLSNIFKIFGKLLR 123

Query: 152 SKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
                     +    +V F     + EA+  LN   L  + IY+
Sbjct: 124 KPEVFYLQNGTLRCAYVWFTTFKHSDEALQQLNETNLANKLIYI 167

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 48/86 (55%), Gaps = 2/86 (2%)

Query: 318 GVNLFVKNLDDSIDDEKLKEEFAPYGTITSV-RVMRTDNGKSKGFGFVCFSTPEEATKAI 376
           G  LFVKNLD+SID  +L   F  +G +     V    NG  +   +V F+T + + +A+
Sbjct: 94  GAKLFVKNLDESIDVPQLSNIFKIFGKLLRKPEVFYLQNGTLRC-AYVWFTTFKHSDEAL 152

Query: 377 TEKNQQIVAGKPLYVAIAQRKDVRRS 402
            + N+  +A K +Y+  A + D++++
Sbjct: 153 QQLNETNLANKLIYIDYAYKDDMQKT 178

>AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH]
           complement(617434..618879) [1446 bp, 481 aa]
          Length = 481

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 89/218 (40%), Gaps = 56/218 (25%)

Query: 34  PASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCR-------DAVTKTSL---------- 76
           P +L++G+LDP+  EA +  ++  +G    +++ R          T ++L          
Sbjct: 21  PRTLWMGDLDPSFDEATIQHVWLTVGHQVQVKLIRAKKNLLIPCSTSSTLSASHVDEERI 80

Query: 77  ------------------GYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPALR 118
                             GY +V F + +  +  + QLN TP+   +     +  +P  +
Sbjct: 81  QINGVSFIDPNTTQLHHAGYCFVQFANLQEAQAGL-QLNATPLPNVVSPTTRNPTNPTGK 139

Query: 119 KK-----GSG-------------NIFIKNLHPDIDNKALFETFSV-FGNILSSKIATDE- 158
           +       SG             ++F+ +L P      L   F   F ++ + ++ TD  
Sbjct: 140 RNFRLNWASGATLQSDIPATPEFSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPI 199

Query: 159 TGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVA 196
           TG S+ FGFV F  E   + A+  +NG+   G+++ VA
Sbjct: 200 TGASRCFGFVRFADEKERRRALAEMNGVWCQGRQLRVA 237

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 36  SLYVGELDPTVSEALLYDIF-SPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           SL+VG+L PT +EA L  +F +   SV ++RV  D +T  S  + +V F D +  ++A+ 
Sbjct: 163 SLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALA 222

Query: 95  QLNYTPIKGRLCRIMWS 111
           ++N    +GR  R+ ++
Sbjct: 223 EMNGVWCQGRQLRVAYA 239

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDAL 183
            +FI  L   I    L   F  FGNILS K+        +G GFV FE+   A+ AI  +
Sbjct: 327 TVFIGGLSNMISEGQLHALFMPFGNILSVKVP-----PGRGCGFVRFENRMDAEAAIQGM 381

Query: 184 NGMLLNGQEIYVA 196
            G ++ G  I ++
Sbjct: 382 QGFIVGGNAIRLS 394

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEE 275
           T V++  ++   ++ + + LF  +GN+LS    K   G+  G GFV FE   DA  A++ 
Sbjct: 326 TTVFIGGLSNMISEGQLHALFMPFGNILSV---KVPPGR--GCGFVRFENRMDAEAAIQG 380

Query: 276 LNG 278
           + G
Sbjct: 381 MQG 383

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           ++++G L   +SE  L+ +F P G++ S++V          G  +V F +    + AI+ 
Sbjct: 327 TVFIGGLSNMISEGQLHALFMPFGNILSVKV------PPGRGCGFVRFENRMDAEAAIQG 380

Query: 96  LNYTPIKGRLCRIMWSQ 112
           +    + G   R+ W +
Sbjct: 381 MQGFIVGGNAIRLSWGR 397

>KLLA0F18216g 1677731..1679857 some similarities with sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation
           singleton, hypothetical start
          Length = 708

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 133/316 (42%), Gaps = 39/316 (12%)

Query: 111 SQRDPALRKKGSGNIFIKNLHPDID----NKALFETFSVFGNILSSKIATDETGKSKGFG 166
           S  DP+  +  S  IF+ +L   +     N ++ + F+ +G I+S K+  D   +   + 
Sbjct: 109 SSDDPSFSRPSSC-IFVASLAATLSDSELNASVTKEFAKYGKIVSVKVLRDPANRP--YA 165

Query: 167 FVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLE 226
           FV +  +  A  A+    G  LN + I       R ER +++  T    ++ +   +  +
Sbjct: 166 FVQYASDDEALNALSQAQGTTLNNRNI-------RCER-AKVNRT-VFISSSFANPLEGK 216

Query: 227 TTDEEFNELFAKYGNVLSSSLEKTE-------DGKLKGFGFVDFEKHEDAAKAVEELNGT 279
            T E+  +L +K+G +      + +         ++    F+ +   +DA +A  ++   
Sbjct: 217 LTVEKVVDLMSKFGELEQVVPSRDQMYKKNYYPSEVANSWFIQYAYRDDAIRAYLQMK-- 274

Query: 280 EFKDQTLFVSRAQK-----KYERMQELKKQYEASRLEK--MAK----YQGVNLFVKNLDD 328
              +    V  AQ      ++  +    K  E  RLE+    K        ++F+  L+ 
Sbjct: 275 --LNYEYMVEWAQNVDVPPRFNLLLSKAKICEKERLERERFGKQPIFIDNKSIFIGQLNF 332

Query: 329 SIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 388
            +    L E F+ YG I +  ++     + K F F+ + TP  A KA+  +N  I   K 
Sbjct: 333 KVTKPLLLERFSKYGEIDNCNLIHKQE-QLKCFAFIKYKTPASAAKALERENHSIFVEKI 391

Query: 389 LYVAIAQRKDVRRSQL 404
           L+V I +  + RRS +
Sbjct: 392 LHVQIREVSNSRRSSI 407

>Kwal_47.18572
          Length = 363

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 9/85 (10%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEE 275
           T ++V+    +  D E NE+F  +G +    +       L GF FV+FE+ + AA+A+EE
Sbjct: 82  TRLFVRPFPFDVQDSELNEIFGPFGPMKEVKI-------LNGFAFVEFEEADSAARAIEE 134

Query: 276 LNGTEFKDQTLFV--SRAQKKYERM 298
           +NG  F +Q L V  S+ Q    RM
Sbjct: 135 VNGKTFANQPLEVVYSKVQPPRYRM 159

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 66/166 (39%), Gaps = 20/166 (12%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +F++    D+ +  L E F  FG +   KI         GF FV FE   SA  AI+ +N
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKILN-------GFAFVEFEEADSAARAIEEVN 136

Query: 185 GMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLS 244
           G     Q + V     +  R             + ++N+      +E  +L  +  N L 
Sbjct: 137 GKTFANQPLEVVYSKVQPPR-----------YRMILRNLPDGVAWQELKDLARE--NNLE 183

Query: 245 SSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSR 290
           ++       +  G G ++F   E    A+++LN  EF+   +   R
Sbjct: 184 TTFSSVNTREFDGTGALEFPSEEILEDALQKLNNIEFRGSVITAER 229

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 7/80 (8%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKN 380
           LFV+     + D +L E F P+G +  V+++        GF FV F   + A +AI E N
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKIL-------NGFAFVEFEEADSAARAIEEVN 136

Query: 381 QQIVAGKPLYVAIAQRKDVR 400
            +  A +PL V  ++ +  R
Sbjct: 137 GKTFANQPLEVVYSKVQPPR 156

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 70/157 (44%), Gaps = 15/157 (9%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L+V      V ++ L +IF P G +  +++          G+A+V F + ++  +AIE++
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKILN--------GFAFVEFEEADSAARAIEEV 135

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           N      +   +++S+  P   +     + ++NL   +  + L +      N L +  ++
Sbjct: 136 NGKTFANQPLEVVYSKVQPPRYR-----MILRNLPDGVAWQELKDL--ARENNLETTFSS 188

Query: 157 DETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEI 193
             T +  G G + F  E   ++A+  LN +   G  I
Sbjct: 189 VNTREFDGTGALEFPSEEILEDALQKLNNIEFRGSVI 225

>YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved in
           18S and 25S rRNA processing, export of RNA from the
           nucleus, import of proteins into the nucleus, associated
           with U1 snRNP, has 2 RNA recognition (RRM) domains [1245
           bp, 414 aa]
          Length = 414

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 42/73 (57%), Gaps = 7/73 (9%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEE 275
           T ++V+   L+  + E NE+F  +G +    +       L GF FV+FE+ E AAKA+EE
Sbjct: 125 TRLFVRPFPLDVQESELNEIFGPFGPMKEVKI-------LNGFAFVEFEEAESAAKAIEE 177

Query: 276 LNGTEFKDQTLFV 288
           ++G  F +Q L V
Sbjct: 178 VHGKSFANQPLEV 190

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 67/166 (40%), Gaps = 20/166 (12%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +F++    D+    L E F  FG +   KI         GF FV FE   SA +AI+ ++
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKILN-------GFAFVEFEEAESAAKAIEEVH 179

Query: 185 GMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLS 244
           G     Q + V              +  A    + +KN+    + ++  +L  +  N L 
Sbjct: 180 GKSFANQPLEVV-----------YSKLPAKRYRITMKNLPEGCSWQDLKDLARE--NSLE 226

Query: 245 SSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSR 290
           ++          G G ++F   E   +A+E LN  EF+   + V R
Sbjct: 227 TTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITVER 272

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 71/159 (44%), Gaps = 15/159 (9%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L+V      V E+ L +IF P G +  +++          G+A+V F + E+  KAIE++
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKILN--------GFAFVEFEEAESAAKAIEEV 178

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           +      +   +++S+  PA R +    I +KNL      + L +      N L +  ++
Sbjct: 179 HGKSFANQPLEVVYSKL-PAKRYR----ITMKNLPEGCSWQDLKDL--ARENSLETTFSS 231

Query: 157 DETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
             T    G G + F  E    EA++ LN +   G  I V
Sbjct: 232 VNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITV 270

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKN 380
           LFV+     + + +L E F P+G +  V+++        GF FV F   E A KAI E +
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKIL-------NGFAFVEFEEAESAAKAIEEVH 179

Query: 381 QQIVAGKPLYVAIAQ 395
            +  A +PL V  ++
Sbjct: 180 GKSFANQPLEVVYSK 194

>KLLA0C08019g complement(704199..705104) some similarities with
           sp|Q00916 Saccharomyces cerevisiae YIL061c SNP1 U1 small
           nuclear ribonucleoprotein singleton, hypothetical start
          Length = 301

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 39/58 (67%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITE 378
           LFV  L  ++D+ +L++ F  YG I S R++R  +GKS+G+GFV F++ E++ +   E
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFRE 174

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 215 FTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVE 274
           +  ++V  ++    + E  + F KYG++ S  + + +DGK +G+GFV F  +ED+ +   
Sbjct: 114 YRTLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFR 173

Query: 275 EL---NGTEFKDQTLFV 288
           EL    G E   +T  V
Sbjct: 174 ELGVRKGIEIMGRTSIV 190

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDAL 183
           +F+  LH  +D   L ++F  +G+I S +I  D+ GKS+G+GFV F     +K+    L
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFREL 175

>Kwal_55.20414
          Length = 284

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 100/235 (42%), Gaps = 33/235 (14%)

Query: 203 ERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVL----SSSLEKTEDGKLK-- 256
           E  +Q+ E  +    +YV N++  TT+EE +E   +Y  V     S ++    +  ++  
Sbjct: 4   EDTTQVSEASSQIKRIYVSNLDFSTTEEELSEFLKEYNVVSVLIPSQTIRGFRNSTVRPL 63

Query: 257 GFGFVDFEKHEDAAKAVEELNGTEFKDQTLFV------------SRAQKKYERMQELKKQ 304
           G G+ DF+  +DA  A + LNG + KD+ L +            SR +++    QE +  
Sbjct: 64  GIGYADFQSAQDAQNAAQNLNGKQLKDRKLKIKIYVPYSPKPSGSRKKEQSSNTQETQPP 123

Query: 305 YEASRLEKMAKYQGVN-------LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGK 357
              ++  +  +    N       ++   L   + D +L++ FA Y     + V R++  +
Sbjct: 124 ISEAQAPESQQPAHPNEPVSTDTVYCAYLPSKVTDVELRDFFAEYQP-QDIYVYRSNGSR 182

Query: 358 SKGF-------GFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLA 405
            + +         V  + P++  +AI     Q   GK + +  A+   ++  Q A
Sbjct: 183 HRIYLHRRFTAALVTLAAPDKLNEAIETLGSQKFMGKKITLKPARLSKIQEVQSA 237

>CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces
           cerevisiae YBR212w Negative growth regulatory protein,
           hypothetical start
          Length = 802

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 36  SLYVGELDPTVSEALLYDIF-SPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           SL+VG+L PT +EA L  +F +   SV ++RV  D +T  S  + +V F + E  ++A+ 
Sbjct: 235 SLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALI 294

Query: 95  QLNYTPIKGRLCRIMWS 111
           ++N    +GR  R+ ++
Sbjct: 295 EMNGVHFQGRTLRVAYA 311

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 34/64 (53%), Gaps = 5/64 (7%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +F+  L P +  + L + F  FGNILS KI        K  GFV FEH+  A+ AI  L 
Sbjct: 469 VFVGGLGPTVQEQQLRKIFQPFGNILSIKIP-----PGKNCGFVKFEHKIDAEAAIQGLQ 523

Query: 185 GMLL 188
           G +L
Sbjct: 524 GFVL 527

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 69/166 (41%), Gaps = 21/166 (12%)

Query: 77  GYAYVNFNDHEAGKKAIEQLNYTPIKG---------------RLCRIMWSQ---RDPALR 118
           GY +V F   +  ++ +  LN TP+                 R  R+ W+       ++ 
Sbjct: 171 GYCFVEFESQKDAQEGLA-LNSTPLPNFVSTTTGQDINPTGQRTFRLNWASGATLQSSIP 229

Query: 119 KKGSGNIFIKNLHPDIDNKALFETFSV-FGNILSSKIATDE-TGKSKGFGFVHFEHESSA 176
                ++F+ +L P      L   F   F ++ + ++ TD  TG S+ FGFV F +E   
Sbjct: 230 TTPEYSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEER 289

Query: 177 KEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKN 222
           + A+  +NG+   G+ + VA    R       +    H  +V V+N
Sbjct: 290 RRALIEMNGVHFQGRTLRVAYATPRSTTVMHTQGNNPHDHHVDVRN 335

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 66/147 (44%), Gaps = 19/147 (12%)

Query: 164 GFGFVHFEHESSAKEAIDALNGMLL--------------NGQEIYVAPHLTRKERDSQLE 209
           G+ FV FE +  A+E + ALN   L               GQ  +     +     S + 
Sbjct: 171 GYCFVEFESQKDAQEGL-ALNSTPLPNFVSTTTGQDINPTGQRTFRLNWASGATLQSSIP 229

Query: 210 ETKAHFTNVYVKNINLETTDEEFNELF-AKYGNVLSSS-LEKTEDGKLKGFGFVDFEKHE 267
            T  +  +++V +++   T+ +   LF  K+ +V +   +     G  + FGFV F   E
Sbjct: 230 TTPEY--SLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEE 287

Query: 268 DAAKAVEELNGTEFKDQTLFVSRAQKK 294
           +  +A+ E+NG  F+ +TL V+ A  +
Sbjct: 288 ERRRALIEMNGVHFQGRTLRVAYATPR 314

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 62/134 (46%), Gaps = 15/134 (11%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEE 275
           T V+V  +     +++  ++F  +GN+LS  +        K  GFV FE   DA  A++ 
Sbjct: 467 TTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPG-----KNCGFVKFEHKIDAEAAIQG 521

Query: 276 LNGTEFKDQTLFVSRAQKKYER--MQELKKQYEAS---RLEKMAKYQGVNLFVKNLDDSI 330
           L G    +  + +S  +    +  + +L  QY +S   R E   +YQ  +  + N  ++I
Sbjct: 522 LQGFVLVENPIRLSWGRNHVAKNMINKLPPQYVSSGNQRQELRPQYQDPSTMLAN--NNI 579

Query: 331 DDEKL---KEEFAP 341
           +++      E+F P
Sbjct: 580 NNQAYTYQHEQFYP 593

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRV 66
            +++VG L PTV E  L  IF P G++ SI++
Sbjct: 467 TTVFVGGLGPTVQEQQLRKIFQPFGNILSIKI 498

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 24/35 (68%)

Query: 34 PASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCR 68
          P +L++G+LDP+  E  + +I+S +G   ++++ R
Sbjct: 45 PRTLWMGDLDPSYDEETIQEIWSHLGKHVTVKLIR 79

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAI 376
           +FV  L  ++ +++L++ F P+G I S+++        K  GFV F    +A  AI
Sbjct: 469 VFVGGLGPTVQEQQLRKIFQPFGNILSIKI-----PPGKNCGFVKFEHKIDAEAAI 519

>CAGL0H04763g 454589..455740 highly similar to sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3, hypothetical
           start
          Length = 383

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (55%), Gaps = 7/84 (8%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEE 275
           T ++V+   L+  + E NE+F  +G +    +       L GF FV+FE+ E A+KA+EE
Sbjct: 105 TRLFVRPFPLDVQESELNEIFGPFGAMKEVKI-------LNGFAFVEFEEAESASKAIEE 157

Query: 276 LNGTEFKDQTLFVSRAQKKYERMQ 299
           +NG  F +Q L V  ++   +R +
Sbjct: 158 VNGKTFANQPLEVMFSKMPVKRFR 181

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 65/164 (39%), Gaps = 20/164 (12%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +F++    D+    L E F  FG +   KI         GF FV FE   SA +AI+ +N
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKILN-------GFAFVEFEEAESASKAIEEVN 159

Query: 185 GMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLS 244
           G     Q + V              +       + +KN+    + +E  +L  +  N L 
Sbjct: 160 GKTFANQPLEV-----------MFSKMPVKRFRITLKNLPEGCSWQELKDLARE--NNLE 206

Query: 245 SSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFV 288
           ++          G G ++F   E    A+E+LN  EF+   + V
Sbjct: 207 TTFSSVNSRDFDGTGALEFPTEEIMNDALEKLNNIEFRGSVISV 250

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 71/159 (44%), Gaps = 15/159 (9%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L+V      V E+ L +IF P G++  +++          G+A+V F + E+  KAIE++
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKILN--------GFAFVEFEEAESASKAIEEV 158

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           N      +   +M+S+  P  R +    I +KNL      + L +      N L +  ++
Sbjct: 159 NGKTFANQPLEVMFSKM-PVKRFR----ITLKNLPEGCSWQELKDL--ARENNLETTFSS 211

Query: 157 DETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
             +    G G + F  E    +A++ LN +   G  I V
Sbjct: 212 VNSRDFDGTGALEFPTEEIMNDALEKLNNIEFRGSVISV 250

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 7/75 (9%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKN 380
           LFV+     + + +L E F P+G +  V+++        GF FV F   E A+KAI E N
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKIL-------NGFAFVEFEEAESASKAIEEVN 159

Query: 381 QQIVAGKPLYVAIAQ 395
            +  A +PL V  ++
Sbjct: 160 GKTFANQPLEVMFSK 174

>ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH]
           (1024792..1025754) [963 bp, 320 aa]
          Length = 320

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 45/85 (52%), Gaps = 7/85 (8%)

Query: 311 EKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPE 370
           E+  +Y    L VK     +++ +L E F+PYG +  V++M        GF FV F  PE
Sbjct: 29  EQEGEYSTTRLHVKPFPPDVEEHELDEIFSPYGALKEVKLM-------SGFAFVEFEKPE 81

Query: 371 EATKAITEKNQQIVAGKPLYVAIAQ 395
            A +AI + N ++ A  PL V+ ++
Sbjct: 82  SAEQAIKDVNGKMFADMPLTVSYSR 106

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 71/166 (42%), Gaps = 20/166 (12%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           + +K   PD++   L E FS +G +   K+ +       GF FV FE   SA++AI  +N
Sbjct: 39  LHVKPFPPDVEEHELDEIFSPYGALKEVKLMS-------GFAFVEFEKPESAEQAIKDVN 91

Query: 185 GMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLS 244
           G +     + V+       R             + ++N+      +E  +L  +  N L 
Sbjct: 92  GKMFADMPLTVSYSRMPMPR-----------FRIKIRNLPEGIAWQELKDLARE--NNLE 138

Query: 245 SSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSR 290
           ++    +     G G ++F   E   +A+E+LN  EF+   L V R
Sbjct: 139 TTFLSVDTSNFDGTGALEFSSEEILEEALEKLNNYEFRGNVLAVER 184

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 87/195 (44%), Gaps = 35/195 (17%)

Query: 197 PHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLK 256
           P+   +E++ +   T+ H     VK    +  + E +E+F+ YG +    L       + 
Sbjct: 23  PYGGHREQEGEYSTTRLH-----VKPFPPDVEEHELDEIFSPYGALKEVKL-------MS 70

Query: 257 GFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKY 316
           GF FV+FEK E A +A++++NG  F D  L VS     Y RM              M ++
Sbjct: 71  GFAFVEFEKPESAEQAIKDVNGKMFADMPLTVS-----YSRM-------------PMPRF 112

Query: 317 QGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAI 376
           +   + ++NL + I  ++LK + A    + +   +  D     G G + FS+ E   +A+
Sbjct: 113 R---IKIRNLPEGIAWQELK-DLARENNLETT-FLSVDTSNFDGTGALEFSSEEILEEAL 167

Query: 377 TEKNQQIVAGKPLYV 391
            + N     G  L V
Sbjct: 168 EKLNNYEFRGNVLAV 182

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 73/159 (45%), Gaps = 15/159 (9%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L+V    P V E  L +IFSP G++  +++          G+A+V F   E+ ++AI+ +
Sbjct: 39  LHVKPFPPDVEEHELDEIFSPYGALKEVKLMS--------GFAFVEFEKPESAEQAIKDV 90

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           N          + +S R P  R +    I I+NL   I  + L +  +   N+ ++ ++ 
Sbjct: 91  NGKMFADMPLTVSYS-RMPMPRFR----IKIRNLPEGIAWQEL-KDLARENNLETTFLSV 144

Query: 157 DETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
           D T    G G + F  E   +EA++ LN     G  + V
Sbjct: 145 D-TSNFDGTGALEFSSEEILEEALEKLNNYEFRGNVLAV 182

>Kwal_14.1851
          Length = 535

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 36  SLYVGELDPTVSEALLYDIFSP-IGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           SL+VG+L PT +EA L  +F     SV ++RV  D +T  S  + +V F D +  ++A+ 
Sbjct: 175 SLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALV 234

Query: 95  QLNYTPIKGRLCRIMWS 111
           ++N    +GR  R+ ++
Sbjct: 235 EMNGVWCQGRNLRVAYA 251

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 63/154 (40%), Gaps = 21/154 (13%)

Query: 77  GYAYVNFNDHEAGKKAIEQLNYTPIKGRLC---------------RIMWSQRDPALRKKG 121
           GY +V F      + A+  LN +P+    C               R+ W+     L    
Sbjct: 111 GYCFVEFESLADAQWALT-LNSSPLPDITCGNGHVSTNPSGLRNFRLNWASGATLLSAIP 169

Query: 122 SG---NIFIKNLHPDIDNKALFETFSV-FGNILSSKIATDE-TGKSKGFGFVHFEHESSA 176
           S    ++F+ +L P      L   F   F ++ + ++ TD  TG S+ FGFV F  E   
Sbjct: 170 STPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQER 229

Query: 177 KEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEE 210
           + A+  +NG+   G+ + VA    R     QL +
Sbjct: 230 RRALVEMNGVWCQGRNLRVAYATPRNNVMWQLTQ 263

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 116 ALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESS 175
           A     +  +FI  L   I  + L   FS FG I++ KI        KG GFV + +   
Sbjct: 389 AFTNPNNTTVFIGGLTSQISERQLHSLFSPFGAIINVKIP-----PGKGCGFVKYAYRID 443

Query: 176 AKEAIDALNGMLLNGQEIYVA 196
           A+ AI  + G ++ G  I ++
Sbjct: 444 AEAAIQGMQGFIVGGNPIRLS 464

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKN 380
           +F+  L   I + +L   F+P+G I +V++        KG GFV ++   +A  AI    
Sbjct: 398 VFIGGLTSQISERQLHSLFSPFGAIINVKI-----PPGKGCGFVKYAYRIDAEAAIQGMQ 452

Query: 381 QQIVAGKPLYVA 392
             IV G P+ ++
Sbjct: 453 GFIVGGNPIRLS 464

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 217 NVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTE--DGKLKGFGFVDFEKHEDAAKAVE 274
           +++V +++   T+     LF K    + +    T+   G  + FGFV F   ++  +A+ 
Sbjct: 175 SLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALV 234

Query: 275 ELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASR 309
           E+NG   + + L V+ A  +   M +L +    S+
Sbjct: 235 EMNGVWCQGRNLRVAYATPRNNVMWQLTQNSHQSQ 269

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/75 (21%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           ++++G L   +SE  L+ +FSP G++ ++++          G  +V +      + AI+ 
Sbjct: 397 TVFIGGLTSQISERQLHSLFSPFGAIINVKI------PPGKGCGFVKYAYRIDAEAAIQG 450

Query: 96  LNYTPIKGRLCRIMW 110
           +    + G   R+ W
Sbjct: 451 MQGFIVGGNPIRLSW 465

>Scas_717.41
          Length = 379

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 7/73 (9%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEE 275
           T ++V+    +  + E NE+F  +G +    +       L GF FV+FE+ + AAKA+EE
Sbjct: 83  TRLFVRPFPFDVQEAELNEIFTPFGPMKEVKI-------LNGFAFVEFEEADSAAKAIEE 135

Query: 276 LNGTEFKDQTLFV 288
           +NG  F +Q L V
Sbjct: 136 VNGKTFANQPLEV 148

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 70/166 (42%), Gaps = 20/166 (12%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +F++    D+    L E F+ FG +   KI         GF FV FE   SA +AI+ +N
Sbjct: 85  LFVRPFPFDVQEAELNEIFTPFGPMKEVKILN-------GFAFVEFEEADSAAKAIEEVN 137

Query: 185 GMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLS 244
           G     Q + V          S+L   +   T   ++N+    + +E  +L  ++   L 
Sbjct: 138 GKTFANQPLEVV--------YSKLPVKRYRLT---LRNLPEGCSWQELKDLAREHS--LE 184

Query: 245 SSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSR 290
           ++          G G ++F   E    A+E+LN  EF+   + V R
Sbjct: 185 TTFSSVNTRDFDGTGALEFANEETLDTALEKLNNIEFRGSVITVER 230

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 8/86 (9%)

Query: 319 VNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITE 378
             LFV+     + + +L E F P+G +  V+++        GF FV F   + A KAI E
Sbjct: 83  TRLFVRPFPFDVQEAELNEIFTPFGPMKEVKIL-------NGFAFVEFEEADSAAKAIEE 135

Query: 379 KNQQIVAGKPLYVAIAQRKDVRRSQL 404
            N +  A +PL V +  +  V+R +L
Sbjct: 136 VNGKTFANQPLEV-VYSKLPVKRYRL 160

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 69/150 (46%), Gaps = 15/150 (10%)

Query: 46  VSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRL 105
           V EA L +IF+P G +  +++          G+A+V F + ++  KAIE++N      + 
Sbjct: 94  VQEAELNEIFTPFGPMKEVKILN--------GFAFVEFEEADSAAKAIEEVNGKTFANQP 145

Query: 106 CRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGF 165
             +++S+  P  R +    + ++NL      + L +      + L +  ++  T    G 
Sbjct: 146 LEVVYSKL-PVKRYR----LTLRNLPEGCSWQELKDL--AREHSLETTFSSVNTRDFDGT 198

Query: 166 GFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
           G + F +E +   A++ LN +   G  I V
Sbjct: 199 GALEFANEETLDTALEKLNNIEFRGSVITV 228

>Scas_88.1
          Length = 256

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 339 FAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397
           F+PYG +  V V + T  G+SKGF ++ F  PE A  A  E ++QI  G+ L++  A+ K
Sbjct: 19  FSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIELDKQIFQGRLLHILPAEAK 78

Query: 398 DVRR 401
              R
Sbjct: 79  KSHR 82

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%)

Query: 54  IFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIM 109
           +FSP G +  + V  D  T  S G+AY+ F + E    A  +L+    +GRL  I+
Sbjct: 18  LFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIELDKQIFQGRLLHIL 73

 Score = 36.6 bits (83), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 141 ETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHL 199
           + FS +G +    +A D  TG+SKGF ++ F++  +A +A   L+  +  G+ +++ P  
Sbjct: 17  QLFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIELDKQIFQGRLLHILPAE 76

Query: 200 TRK 202
            +K
Sbjct: 77  AKK 79

>KLLA0D13420g complement(1157491..1157991) some similarities with
           sp|P40565 Saccharomyces cerevisiae YIR005w IST3
           singleton, hypothetical start
          Length = 166

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 62/145 (42%), Gaps = 16/145 (11%)

Query: 106 CRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDET-GKSKG 164
           C I+  +       K    I    +H ++    +   FS +G  +  K+  D+T GKSKG
Sbjct: 17  CGILKPESSWHHEYKDQAYINFGGMHLELTEADILTIFSQYGCPVDIKLVRDQTTGKSKG 76

Query: 165 FGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNIN 224
           FGF+ +E + S   A+D LNG  + G+ I V     R   D    E              
Sbjct: 77  FGFLKYEDQRSTILAVDNLNGAKVCGRLIRVDHAFYRPRSDEAEYE-------------- 122

Query: 225 LETTDEEFNELFAKYGNVLSSSLEK 249
            E   +E  + FAK G+V S  +++
Sbjct: 123 -EAVRQELEKDFAKTGDVPSEPMKQ 146

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 10/93 (10%)

Query: 223 INLETTDEEFNELFAKYGNVLSSSLEKTED-GKLKGFGFVDFEKHEDAAKAVEELNGTEF 281
           ++LE T+ +   +F++YG  +   L + +  GK KGFGF+ +E       AV+ LNG + 
Sbjct: 41  MHLELTEADILTIFSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKV 100

Query: 282 KDQTLFVSRA-------QKKYERM--QELKKQY 305
             + + V  A       + +YE    QEL+K +
Sbjct: 101 CGRLIRVDHAFYRPRSDEAEYEEAVRQELEKDF 133

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 339 FAPYGTITSVRVMRTDN-GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           F+ YG    ++++R    GKSKGFGF+ +        A+   N   V G+ + V
Sbjct: 54  FSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRV 107

>KLLA0B00979g 77439..78467 some similarities with sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3 nucleolar protein
           singleton, hypothetical start
          Length = 342

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 69/166 (41%), Gaps = 20/166 (12%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +F+K   PD+ +  + E F  FG +   KI         GF FV FE   SA +AI  + 
Sbjct: 54  LFVKPFPPDVTDAEMKEIFEPFGALKEIKILN-------GFAFVEFEEAESASQAIQNVA 106

Query: 185 GMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLS 244
           G +     + V    ++K         K  F  V ++N+      +E  +L     N L 
Sbjct: 107 GKMFADYPLEVV--FSKK--------LKPRF-RVIIRNLPEGCAWQELKDL--ARDNQLE 153

Query: 245 SSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSR 290
           ++          G G ++F   E   +A+E+LN  EF+   L V +
Sbjct: 154 TTFSSVNTRDFDGTGALEFPTEEILQEAIEKLNNIEFRGSVLAVEK 199

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 71/160 (44%), Gaps = 17/160 (10%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L+V    P V++A + +IF P G++  I++          G+A+V F + E+  +AI+ +
Sbjct: 54  LFVKPFPPDVTDAEMKEIFEPFGALKEIKILN--------GFAFVEFEEAESASQAIQNV 105

Query: 97  NYTPIKGRLCRIMWSQR-DPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIA 155
                      +++S++  P  R      + I+NL      + L +      N L +  +
Sbjct: 106 AGKMFADYPLEVVFSKKLKPRFR------VIIRNLPEGCAWQELKDL--ARDNQLETTFS 157

Query: 156 TDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
           +  T    G G + F  E   +EAI+ LN +   G  + V
Sbjct: 158 SVNTRDFDGTGALEFPTEEILQEAIEKLNNIEFRGSVLAV 197

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 7/89 (7%)

Query: 308 SRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFS 367
           +R++   +     LFVK     + D ++KE F P+G +  ++++        GF FV F 
Sbjct: 41  NRVDDDEELSDTRLFVKPFPPDVTDAEMKEIFEPFGALKEIKIL-------NGFAFVEFE 93

Query: 368 TPEEATKAITEKNQQIVAGKPLYVAIAQR 396
             E A++AI     ++ A  PL V  +++
Sbjct: 94  EAESASQAIQNVAGKMFADYPLEVVFSKK 122

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 50/99 (50%), Gaps = 12/99 (12%)

Query: 201 RKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGF 260
           R + D +L +T+     ++VK    + TD E  E+F  +G +    +       L GF F
Sbjct: 42  RVDDDEELSDTR-----LFVKPFPPDVTDAEMKEIFEPFGALKEIKI-------LNGFAF 89

Query: 261 VDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQ 299
           V+FE+ E A++A++ + G  F D  L V  ++K   R +
Sbjct: 90  VEFEEAESASQAIQNVAGKMFADYPLEVVFSKKLKPRFR 128

>Sklu_2182.3 YDR432W, Contig c2182 3920-5035
          Length = 371

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 7/73 (9%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEE 275
           T ++V+    +  + E NE+F+ +G +    +       L GF FV+FE+ E AAKA++E
Sbjct: 75  TRLFVRPFPFDVQESELNEIFSPFGPMKEVKI-------LNGFAFVEFEESESAAKAIDE 127

Query: 276 LNGTEFKDQTLFV 288
           +NG  F +Q L V
Sbjct: 128 VNGKTFANQPLEV 140

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 69/166 (41%), Gaps = 20/166 (12%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +F++    D+    L E FS FG +   KI         GF FV FE   SA +AID +N
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFGPMKEVKILN-------GFAFVEFEESESAAKAIDEVN 129

Query: 185 GMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLS 244
           G     Q + V       +R             + ++N+      +E  +L  +  N L 
Sbjct: 130 GKTFANQPLEVVYSKLPPQR-----------FRMILRNLPEGVAWQELKDLARE--NNLE 176

Query: 245 SSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSR 290
           ++       +  G G ++F   E   +A+E+LN  EF+   + V R
Sbjct: 177 TTFSSVNTREFDGTGALEFPTEEILEEALEKLNNIEFRGAVISVER 222

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 73/159 (45%), Gaps = 15/159 (9%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L+V      V E+ L +IFSP G +  +++          G+A+V F + E+  KAI+++
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFGPMKEVKILN--------GFAFVEFEESESAAKAIDEV 128

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156
           N      +   +++S+  P   +     + ++NL   +  + L +      N L +  ++
Sbjct: 129 NGKTFANQPLEVVYSKLPPQRFR-----MILRNLPEGVAWQELKDL--ARENNLETTFSS 181

Query: 157 DETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
             T +  G G + F  E   +EA++ LN +   G  I V
Sbjct: 182 VNTREFDGTGALEFPTEEILEEALEKLNNIEFRGAVISV 220

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 7/75 (9%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKN 380
           LFV+     + + +L E F+P+G +  V+++        GF FV F   E A KAI E N
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFGPMKEVKIL-------NGFAFVEFEESESAAKAIDEVN 129

Query: 381 QQIVAGKPLYVAIAQ 395
            +  A +PL V  ++
Sbjct: 130 GKTFANQPLEVVYSK 144

>Sklu_1790.3 YOL041C, Contig c1790 1701-3122
          Length = 473

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           S+++G LD    E  L+  FSP G V  IR+ RD+ T    G+AYV F D ++  KA+  
Sbjct: 308 SVFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKAL-L 366

Query: 96  LNYTPIKG 103
           LN   I G
Sbjct: 367 LNEKKING 374

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 50/88 (56%), Gaps = 2/88 (2%)

Query: 320 NLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITE 378
           ++F+ NLD    +E L + F+P G +  +R++R +     KGF +V F   +   KA+  
Sbjct: 308 SVFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKALL- 366

Query: 379 KNQQIVAGKPLYVAIAQRKDVRRSQLAQ 406
            N++ + G    + +++ K++R+SQ AQ
Sbjct: 367 LNEKKINGNGRKLRVSRCKNMRKSQPAQ 394

>YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleolar
           protein with similarity to Nsr1p, has two RNA
           recognition (RRM) domains [1212 bp, 403 aa]
          Length = 403

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 51/90 (56%), Gaps = 3/90 (3%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEK 379
           LFV NL   + D+ L++ F   G I  +R+    D+GK KGF F+ F   E +T  + +K
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNELKDK 300

Query: 380 NQQIVAGKPLYVAIAQRKDVRRSQLAQQIQ 409
           + + +AG+PL +   +  D  + Q+ ++++
Sbjct: 301 SCRKIAGRPLRMEYGE--DRSKRQVRKKVE 328

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 60/112 (53%), Gaps = 6/112 (5%)

Query: 161 KSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAP---HLTRKERDSQLEETKAHFTN 217
           K+KGF ++ F++    K A+  L+   LNG+ + +     +  R ++D  +  +K   + 
Sbjct: 181 KNKGFCYMFFKNVEQMK-AVLELSESHLNGRNMLIKDSENYSGRPDKDDLVAMSKNPPSR 239

Query: 218 V-YVKNINLETTDEEFNELFAKYGNVLSSSLEKTED-GKLKGFGFVDFEKHE 267
           + +V N++ + TD+   + F   G+++   +   ED GK KGF F+DF+  E
Sbjct: 240 ILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEE 291

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 58/108 (53%), Gaps = 12/108 (11%)

Query: 77  GYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQ-------RDP--ALRKKGSGNI-F 126
           G+ Y+ F + E   KA+ +L+ + + GR   I  S+       +D   A+ K     I F
Sbjct: 184 GFCYMFFKNVEQ-MKAVLELSESHLNGRNMLIKDSENYSGRPDKDDLVAMSKNPPSRILF 242

Query: 127 IKNLHPDIDNKALFETFSVFGNILSSKIAT-DETGKSKGFGFVHFEHE 173
           + NL  D+ +  L + F   G+I+  ++AT +++GK KGF F+ F++E
Sbjct: 243 VGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNE 290

>KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 391

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 79/168 (47%), Gaps = 10/168 (5%)

Query: 247 LEKTEDGKL--KGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQ 304
           L K ++ KL  KGF ++DF K E   +AV  L+ +    + L +  A   YE   +    
Sbjct: 160 LTKNDNKKLRNKGFAYIDF-KTEKQMEAVVGLSESALNGRNLLIKNAGS-YEGRPDKNDL 217

Query: 305 YEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMR-TDNGKSKGFGF 363
             AS+           LFV NL     ++ L++ F   G I  +R+    D GK KGF F
Sbjct: 218 VAASK-----NPPSRILFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAF 272

Query: 364 VCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR 411
           + F     AT A+ +K+ + +A +P+ +   + +  R+ +   ++ AR
Sbjct: 273 IDFKDETGATNALKDKSCRKIASRPIRMEYGEDRSKRQVRRRPELDAR 320

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 77/150 (51%), Gaps = 10/150 (6%)

Query: 161 KSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV---APHLTRKERDSQLEETKAHFTN 217
           ++KGF ++ F+ E    EA+  L+   LNG+ + +     +  R +++  +  +K   + 
Sbjct: 169 RNKGFAYIDFKTEKQM-EAVVGLSESALNGRNLLIKNAGSYEGRPDKNDLVAASKNPPSR 227

Query: 218 V-YVKNINLETTDEEFNELFAKYGNVLSSSLEKTED-GKLKGFGFVDFEKHEDAAKAVEE 275
           + +V N++ +TT++   + F   G ++   +   ED GK KGF F+DF+    A  A+++
Sbjct: 228 ILFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNALKD 287

Query: 276 LNGTEFKDQTLFV----SRAQKKYERMQEL 301
            +  +   + + +     R++++  R  EL
Sbjct: 288 KSCRKIASRPIRMEYGEDRSKRQVRRRPEL 317

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 57/120 (47%), Gaps = 22/120 (18%)

Query: 77  GYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRI---------------MWSQRDPALRKKG 121
           G+AY++F   E   +A+  L+ + + GR   I               + + ++P  R   
Sbjct: 172 GFAYIDFK-TEKQMEAVVGLSESALNGRNLLIKNAGSYEGRPDKNDLVAASKNPPSRI-- 228

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT-DETGKSKGFGFVHFEHESSAKEAI 180
              +F+ NL  D     L + F   G I+  ++AT ++TGK KGF F+ F+ E+ A  A+
Sbjct: 229 ---LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNAL 285

 Score = 36.2 bits (82), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 34/76 (44%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L+VG L    +E LL   F   G +  IR+     T    G+A+++F D      A++  
Sbjct: 229 LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNALKDK 288

Query: 97  NYTPIKGRLCRIMWSQ 112
           +   I  R  R+ + +
Sbjct: 289 SCRKIASRPIRMEYGE 304

>YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           and a glutamine-rich region [2019 bp, 672 aa]
          Length = 672

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 47/77 (61%), Gaps = 1/77 (1%)

Query: 36  SLYVGELDPTVSEALLYDIF-SPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           SL+VG+L PT +EA L  +F +   SV ++RV  D +T +S  + +V F D +  ++A+ 
Sbjct: 193 SLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERRRALI 252

Query: 95  QLNYTPIKGRLCRIMWS 111
           +++    +GR  R+ ++
Sbjct: 253 EMSGKWFQGRALRVAYA 269

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 60/140 (42%), Gaps = 21/140 (15%)

Query: 77  GYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPALRKK-----GSG-------- 123
           GY +V F   +  K A+  LN TP+         SQ +P  ++       SG        
Sbjct: 129 GYCFVEFETQKDAKFALS-LNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIP 187

Query: 124 -----NIFIKNLHPDIDNKALFETFSV-FGNILSSKIATDE-TGKSKGFGFVHFEHESSA 176
                ++F+ +L P      L   F   F ++ + ++ TD  TG S+ FGFV F  E   
Sbjct: 188 STPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDER 247

Query: 177 KEAIDALNGMLLNGQEIYVA 196
           + A+  ++G    G+ + VA
Sbjct: 248 RRALIEMSGKWFQGRALRVA 267

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEE 275
           T V+V  +  +TT+ +   LF  +G +L+  +        K  GFV FEK  DA  +++ 
Sbjct: 360 TTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNG-----KNCGFVKFEKRIDAEASIQG 414

Query: 276 LNG 278
           L G
Sbjct: 415 LQG 417

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKN 380
           +FV  L     + +L+  F P+G I +VR+    NGK+   GFV F    +A  +I    
Sbjct: 362 VFVGGLVPKTTEFQLRSLFKPFGPILNVRI---PNGKN--CGFVKFEKRIDAEASIQGLQ 416

Query: 381 QQIVAGKPLYVA 392
             IV G P+ ++
Sbjct: 417 GFIVGGSPIRLS 428

>YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein
           important for the synthesis of 25S pre-rRNA [1380 bp,
           459 aa]
          Length = 459

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           S++VG LD    E  L+  F P G +  +R+ RD+ T    G+AYV F D ++  KA+  
Sbjct: 280 SIFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKAL-L 338

Query: 96  LNYTPIKGR 104
           LN  P+K +
Sbjct: 339 LNEKPMKSQ 347

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 320 NLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAI 376
           ++FV NLD    +E L + F P G I  VR++R +     KGF +V F   +   KA+
Sbjct: 280 SIFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKAL 337

>CAGL0J01914g complement(189309..189818) similar to sp|P40565
           Saccharomyces cerevisiae YIR005w IST3, hypothetical
           start
          Length = 169

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 76/170 (44%), Gaps = 26/170 (15%)

Query: 91  KAIEQLNYTPIKGRLCR--IMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGN 148
           KAI+++N   ++  + +    W Q       K    IFI  L+  +    L   FS +G 
Sbjct: 5   KAIQRINEKELEAGILKPEHSWHQE-----YKDQAYIFIGGLNRQLTEGDLLTIFSQYGV 59

Query: 149 ILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQ 207
            +   +  D ET +SKGF F+ +E + S   A+D LNG+ + G++I V  H+    RD  
Sbjct: 60  PVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAGRQIKV-DHIFFTPRDDI 118

Query: 208 LEETKA------------HFTNVYVKNINLETT-----DEEFNELFAKYG 240
            E T+A            H  ++   NI  ET      ++E N+  A Y 
Sbjct: 119 PEYTEAVREFLSKDKIDIHKDHLSTDNIQKETKYTNNEEDELNDPMASYS 168

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (52%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           A +++G L+  ++E  L  IFS  G    + + RD  T  S G+A++ + D  +   A++
Sbjct: 34  AYIFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVD 93

Query: 95  QLNYTPIKGRLCRI 108
            LN   + GR  ++
Sbjct: 94  NLNGITVAGRQIKV 107

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 5/64 (7%)

Query: 218 VYVKNINLETTDEEFNELFAKYG---NVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVE 274
           +++  +N + T+ +   +F++YG   +VL    ++T + K  GF F+ +E       AV+
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESK--GFAFLKYEDQRSTILAVD 93

Query: 275 ELNG 278
            LNG
Sbjct: 94  NLNG 97

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRT-DNGKSKGFGFVCFSTPEEATKAITEK 379
           +F+  L+  + +  L   F+ YG    V ++R  +  +SKGF F+ +        A+   
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 380 NQQIVAGKPLYV 391
           N   VAG+ + V
Sbjct: 96  NGITVAGRQIKV 107

>Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement
          Length = 188

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           A +Y G L+  ++E  +  IFS  G    I++ RD  T+ S G+ Y+ + D  +   A++
Sbjct: 34  AYIYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVD 93

Query: 95  QLNYTPIKGRLCRI 108
            LN   I GR  ++
Sbjct: 94  NLNGATIAGRTIKV 107

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDAL 183
           I+  +L+ ++    +   FS +G  +  K+  D ET +SKGFG++ +E + S   A+D L
Sbjct: 36  IYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNL 95

Query: 184 NGMLLNGQEIYV 195
           NG  + G+ I V
Sbjct: 96  NGATIAGRTIKV 107

 Score = 36.6 bits (83), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGK-LKGFGFVDFEKHEDAAKAVEEL 276
           +Y  ++N E T+ +   +F++YG  +   L + ++ +  KGFG++ +E       AV+ L
Sbjct: 36  IYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNL 95

Query: 277 NGTEFKDQTLFVSRA 291
           NG     +T+ V  A
Sbjct: 96  NGATIAGRTIKVDHA 110

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 339 FAPYGTITSVRVMRT-DNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           F+ YG    ++++R  +  +SKGFG++ +        A+   N   +AG+ + V
Sbjct: 54  FSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGRTIKV 107

>CAGL0D05236g 499006..500337 weakly similar to sp|P43607
           Saccharomyces cerevisiae YFR032c, hypothetical start
          Length = 443

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 61/108 (56%), Gaps = 9/108 (8%)

Query: 218 VYVKNINLETTDEEFNELFA--KYGNVL--SSSLEKTEDGKLKGFG--FVDFEKHEDAAK 271
           +Y+ N++  +++E+  E      + +VL    ++ +    + + FG  +VDF   E+A +
Sbjct: 6   IYIANVSYSSSEEDLREFLKDFNFSSVLIPCHTVRRFRRNEARSFGIAYVDFTSSEEAVR 65

Query: 272 AVEELNGTEFKDQTLFVSRAQKKYERMQELKKQY--EASRLEKMAKYQ 317
           AVEELNG EF  + L V R    Y+  + +K+++  +  +L+K AKY+
Sbjct: 66  AVEELNGKEFGGRVLRV-RTHNPYQPPKPIKERFGTKLQQLKKFAKYE 112

 Score = 32.3 bits (72), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 75  SLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRI 108
           S G AYV+F   E   +A+E+LN     GR+ R+
Sbjct: 49  SFGIAYVDFTSSEEAVRAVEELNGKEFGGRVLRV 82

>Scas_709.2*
          Length = 171

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 5/120 (4%)

Query: 91  KAIEQLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNIL 150
           K+I+Q+N   ++     I+ +++    + K    I+I  L  ++    +   FS +G  +
Sbjct: 5   KSIQQINERELQ---SGILTTEQSWHYQYKDQAYIYIGGLDKELTEGDIISVFSQYGVPV 61

Query: 151 SSKIATD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLE 209
              +  D +TG+SKGF F+ +E + S   AID LNG+ +    I V  H   + RD Q +
Sbjct: 62  DLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNLNGVKVGSNTIQV-DHTFYEPRDEQWD 120

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 35 ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
          A +Y+G LD  ++E  +  +FS  G    + +  D  T  S G+A++ + D  +   AI+
Sbjct: 34 AYIYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLAID 93

Query: 95 QLN 97
           LN
Sbjct: 94 NLN 96

 Score = 35.0 bits (79), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSL-EKTEDGKLKGFGFVDFEKHEDAAKAVEEL 276
           +Y+  ++ E T+ +   +F++YG  +   L    + G+ KGF F+ +E       A++ L
Sbjct: 36  IYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNL 95

Query: 277 NGTEFKDQTLFVSRA 291
           NG +    T+ V   
Sbjct: 96  NGVKVGSNTIQVDHT 110

>YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in
           splicing and spliceosome assembly, has a role in sodium
           tolerance [447 bp, 148 aa]
          Length = 148

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 120 KGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKE 178
           K +  I+I NL+ ++    +   FS +G  +   ++ DE TG+S+GF ++ +E + S   
Sbjct: 28  KDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTIL 87

Query: 179 AIDALNGMLLNGQEIYVAPHLTRKERDSQ 207
           A+D LNG  + G+ + +     R +R  Q
Sbjct: 88  AVDNLNGFKIGGRALKIDHTFYRPKRSLQ 116

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           A +Y+G L+  ++E  +  +FS  G    + + RD  T  S G+AY+ + D  +   A++
Sbjct: 31  AYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVD 90

Query: 95  QLNYTPIKGRLCRI 108
            LN   I GR  +I
Sbjct: 91  NLNGFKIGGRALKI 104

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 3/95 (3%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTED-GKLKGFGFVDFEKHEDAAKAVEEL 276
           +Y+ N+N E T+ +   +F++YG  +   L + E+ G+ +GF ++ +E       AV+ L
Sbjct: 33  IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNL 92

Query: 277 NGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLE 311
           NG +   + L +      Y   + L+K YEA + E
Sbjct: 93  NGFKIGGRALKIDHT--FYRPKRSLQKYYEAVKEE 125

>KLLA0F07799g complement(734889..736463) similar to sp|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, start by
           similarity
          Length = 524

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           S++VG LD    E  L+  F P G +  +R+ RD+ T    G+AYV F D ++  KA+  
Sbjct: 360 SVFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLL 419

Query: 96  LNYTPIKGRLCRIMWSQRDPALRK 119
                 +G+  R +   R   +RK
Sbjct: 420 HEKKIHEGKKARKLRISRCKNMRK 443

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 2/101 (1%)

Query: 320 NLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITE 378
           ++FV NLD    +E L + F P G I  VR++R +     KGF +V F   +  +KA+  
Sbjct: 360 SVFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLL 419

Query: 379 KNQQIVAGKPLY-VAIAQRKDVRRSQLAQQIQARTQMRYQQ 418
             ++I  GK    + I++ K++R++Q  Q      ++  QQ
Sbjct: 420 HEKKIHEGKKARKLRISRCKNMRKAQGNQSSLQNNKLNDQQ 460

>Kwal_33.13496
          Length = 330

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDAL 183
           +FI  L+P    K L   FS FG I   +I  D ETG S  +GF+ F ++SS + A   +
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 184 NGMLLNGQEIYV 195
            G+L++ + I+V
Sbjct: 309 EGVLIDDRRIHV 320

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 36/76 (47%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L++ +L+P      L  IFS  G++  + + RD  T  SL Y ++ F +  + + A  ++
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 97  NYTPIKGRLCRIMWSQ 112
               I  R   + + Q
Sbjct: 309 EGVLIDDRRIHVDFCQ 324

>CAGL0F01023g complement(108155..109345) similar to tr|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, hypothetical
           start
          Length = 396

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           S++VG LD    E  L+  F   GS+  +R+ RD  T    G+AYV FN+ ++  KA+  
Sbjct: 229 SVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKAL-L 287

Query: 96  LNYTPI 101
           LN  P+
Sbjct: 288 LNEKPM 293

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 50/88 (56%), Gaps = 14/88 (15%)

Query: 320 NLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMR---TDNGKSKGFGFVCFSTPEEATKAI 376
           ++FV NLD   D+E L + F   G+I  VR++R   T+ G  KGF +V F+  +  +KA+
Sbjct: 229 SVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMG--KGFAYVQFNELQSVSKAL 286

Query: 377 TEKNQQIVAGKPLYVAIAQRKDVRRSQL 404
                 ++  KP+   I+Q + +++ +L
Sbjct: 287 ------LLNEKPM---ISQNEHLKKRKL 305

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 3/91 (3%)

Query: 91  KAIEQLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNIL 150
           K I++LN      R  R+  S   PA   K   ++F+ NL  + D ++L++ F   G+I 
Sbjct: 198 KLIKRLNGQVFSNRHLRVD-SITHPAPHDK-QRSVFVGNLDFEEDEESLWKHFGACGSIE 255

Query: 151 SSKIATD-ETGKSKGFGFVHFEHESSAKEAI 180
             +I  D +T   KGF +V F    S  +A+
Sbjct: 256 YVRIVRDPKTNMGKGFAYVQFNELQSVSKAL 286

>Scas_316.1
          Length = 483

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 74/169 (43%), Gaps = 28/169 (16%)

Query: 161 KSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEE----TKAHFT 216
           K +GFGFV F  E   KEA+       L G  + V     R++R ++  E     K   T
Sbjct: 3   KFRGFGFVSFAVEDDTKEALKQARKAKLKGHLLRV-DIAKRRDRSNKPGEGDKPEKKTRT 61

Query: 217 NVYVKNINLETTDE----------------------EFNELFAKYGNVLSSSLEKTEDGK 254
           +   ++ N E  +E                      +  ++F+++G V+ +S+ K  DGK
Sbjct: 62  DTIARDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGK 121

Query: 255 LKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKK 303
           L GF FV  +K  +   A+E     +   +++ V  A +K  R ++ KK
Sbjct: 122 LCGFAFVTMKKLSNCTIALENTKDLKIDGRSVAVDFAVQK-NRWEDYKK 169

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 72/160 (45%), Gaps = 15/160 (9%)

Query: 254 KLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQ--ELKKQYEASRLE 311
           K +GFGFV F   +D  +A+++    + K   L V  A+++    +  E  K  + +R +
Sbjct: 3   KFRGFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTD 62

Query: 312 KMAKYQGV------------NLFVKNLDDSIDD-EKLKEEFAPYGTITSVRVMRTDNGKS 358
            +A+ +               L ++N+  S  D  +LK+ F+ +GT+    + +  +GK 
Sbjct: 63  TIARDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKL 122

Query: 359 KGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD 398
            GF FV        T A+       + G+ + V  A +K+
Sbjct: 123 CGFAFVTMKKLSNCTIALENTKDLKIDGRSVAVDFAVQKN 162

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 61/150 (40%), Gaps = 31/150 (20%)

Query: 77  GYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPALRKKGSGN------------ 124
           G+ +V+F   +  K+A++Q     +KG L R+  ++R     K G G+            
Sbjct: 6   GFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTDTIA 65

Query: 125 ------------------IFIKNLHPDI-DNKALFETFSVFGNILSSKIATDETGKSKGF 165
                             + I+N+     D   L + FS FG ++ + I     GK  GF
Sbjct: 66  RDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKLCGF 125

Query: 166 GFVHFEHESSAKEAIDALNGMLLNGQEIYV 195
            FV  +  S+   A++    + ++G+ + V
Sbjct: 126 AFVTMKKLSNCTIALENTKDLKIDGRSVAV 155

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%)

Query: 355 NGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD 398
           N K +GFGFV F+  ++  +A+ +  +  + G  L V IA+R+D
Sbjct: 1   NKKFRGFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRD 44

>ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH]
           complement(734486..735007) [522 bp, 173 aa]
          Length = 173

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 120 KGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKE 178
           K    I    L+ ++    +   FS FG     K+  D ETG+S+GFGF+ +E + S   
Sbjct: 31  KDQAYIHFSGLNVELTEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVL 90

Query: 179 AIDALNGMLLNGQEIYVAPHLTRKERD 205
           A+D LNG+ L G+ + V  H   + RD
Sbjct: 91  AVDNLNGVNLCGRVLKV-DHCFYEPRD 116

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 209 EETKAHF-----TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKT-EDGKLKGFGFVD 262
           EE   H+       ++   +N+E T+ +   +F+++G      L +  E G+ +GFGF+ 
Sbjct: 22  EEASWHYQYKDQAYIHFSGLNVELTEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLK 81

Query: 263 FEKHEDAAKAVEELNGTEFKDQTLFVSRA 291
           +E       AV+ LNG     + L V   
Sbjct: 82  YEDQRSTVLAVDNLNGVNLCGRVLKVDHC 110

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 339 FAPYGTITSVRVMRT-DNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           F+ +G  T ++++R  + G+S+GFGF+ +        A+   N   + G+ L V
Sbjct: 54  FSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVLKV 107

>Kwal_26.7179
          Length = 456

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI-- 93
           S++VG LD   +E  L+  F   G +  +R+ RD+ T    G+AYV F D +   KA+  
Sbjct: 294 SVFVGNLDFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKALLL 353

Query: 94  --EQLNYTPIKGRLCRI 108
             ++LN T  K R+ R 
Sbjct: 354 DGQKLNGTGRKLRVTRC 370

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 55/117 (47%), Gaps = 12/117 (10%)

Query: 79  AYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMW----SQRDPALRKKGSGNIFIKNLHPDI 134
           AYV + D  A K A EQLN T  +    R+      +Q D         ++F+ NL  + 
Sbjct: 251 AYVVYADKAAVKIACEQLNGTLFQNHHLRVDSVTHPTQHD------NKRSVFVGNLDFEE 304

Query: 135 DNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNG 190
             + L++ F   G+I   ++  D +T   KGF +V F    +  +A+  L+G  LNG
Sbjct: 305 TEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKAL-LLDGQKLNG 360

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 53/122 (43%), Gaps = 20/122 (16%)

Query: 272 AVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSID 331
           A E+LNGT F++  L V               Q++  R          ++FV NLD    
Sbjct: 264 ACEQLNGTLFQNHHLRVDSVTHPT--------QHDNKR----------SVFVGNLDFEET 305

Query: 332 DEKLKEEFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIV-AGKPL 389
           +E L + F   G I  VR++R +     KGF +V F   +   KA+    Q++   G+ L
Sbjct: 306 EENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKALLLDGQKLNGTGRKL 365

Query: 390 YV 391
            V
Sbjct: 366 RV 367

>KLLA0B10472g complement(914512..915108) similar to sgd|S0006099
           Saccharomyces cerevisiae YPL178w SAE1 small subunit of
           the nuclear cap-binding protein complex CBC, start by
           similarity
          Length = 198

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 66/131 (50%), Gaps = 20/131 (15%)

Query: 198 HLTRKER---DSQLEETKAHF--TNVYVKNINLETTDEEFNELFAKYGNV--LSSSLEKT 250
           +L RK R   DS L++ +       VYV N++  T++E+  ELF+K G +  +   L++ 
Sbjct: 24  YLIRKARRDPDSGLQQLRKSMKSCTVYVGNLSFYTSEEQIYELFSKCGTIKKIIMGLDRF 83

Query: 251 EDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFV------------SRAQKKYERM 298
           +     GF F+ F+K EDA  +++ L  T+  D+ + +             R +   +  
Sbjct: 84  KFTPC-GFCFIIFDKMEDALNSIKYLGDTKLDDRHITIDLDPGFEEGRQFGRGKNGGQVS 142

Query: 299 QELKKQYEASR 309
            E++ +++ASR
Sbjct: 143 DEMRFEFDASR 153

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
            ++YVG L    SE  +Y++FS  G++  I +  D    T  G+ ++ F+  E    +I+
Sbjct: 47  CTVYVGNLSFYTSEEQIYELFSKCGTIKKIIMGLDRFKFTPCGFCFIIFDKMEDALNSIK 106

Query: 95  QLNYTPIKGR 104
            L  T +  R
Sbjct: 107 YLGDTKLDDR 116

>AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH]
           (639306..641444) [2139 bp, 712 aa]
          Length = 712

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 69/321 (21%), Positives = 127/321 (39%), Gaps = 63/321 (19%)

Query: 114 DP-ALRKKGSGNIFIKNLHPDIDNKALF----ETFSVFGNILSSKIATDETGKSKGFGFV 168
           DP   R + S  +F+ +L   + +  L     E F  +G +   K+  D + +   + FV
Sbjct: 151 DPKTWRGRPSSCVFVASLAASLTDDDLCVSVTEAFKKYGELSMVKVLRDPSNRP--YAFV 208

Query: 169 HFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINL--- 225
            + +++ AK A+    G LLNG+ I             + E+ K + T +++   N    
Sbjct: 209 QYTNDNDAKRALKQAQGTLLNGRTI-------------RCEKAKVNRT-LFISTRNRKAP 254

Query: 226 ETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGF--------GFVDFEKHEDAAKAVEELN 277
           E T +E  +L + +G  L   +   E    K +         FV F   +DA +A   +N
Sbjct: 255 EVTSDEIIQLCSSFGE-LEQLVASREYAFKKNYYPIDRSSAWFVQFAYRDDAIRAF--IN 311

Query: 278 GTEFKDQTLFVSRAQKKYERMQELKK---------------------------QYEASRL 310
                D T+  ++  +  +R+  L+K                             E    
Sbjct: 312 LKPGYDWTVEWAQNIEVPKRLNLLRKTKVRGTKSGNSESEEDEEEYEDEDEDEDDEDEDD 371

Query: 311 EKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPE 370
            +       ++FV  LD S+  EKL + F+ +G +  V ++  DN  +K F F+ + T E
Sbjct: 372 SRDILIDKKSIFVSQLDPSVTKEKLTQRFSKHGKVEDVNLIFKDN-NTKVFAFIKYETEE 430

Query: 371 EATKAITEKNQQIVAGKPLYV 391
               A+  +N      + ++V
Sbjct: 431 ATATALERENHASFLNRTMHV 451

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 121/304 (39%), Gaps = 72/304 (23%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           ASL   +L  +V+EA     F   G +S ++V RD   +    YA+V + +    K+A++
Sbjct: 170 ASLTDDDLCVSVTEA-----FKKYGELSMVKVLRDPSNRP---YAFVQYTNDNDAKRALK 221

Query: 95  QLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLH---PDIDNKALFETFSVFGNILS 151
           Q   T + GR  R          + K +  +FI   +   P++ +  + +  S FG  L 
Sbjct: 222 QAQGTLLNGRTIRCE--------KAKVNRTLFISTRNRKAPEVTSDEIIQLCSSFGE-LE 272

Query: 152 SKIATDETGKSKGF--------GFVHFEHESSAKEAIDALNGMLLNGQEIYV--APHLTR 201
             +A+ E    K +         FV F +   A  A   +N  L  G +  V  A ++  
Sbjct: 273 QLVASREYAFKKNYYPIDRSSAWFVQFAYRDDAIRAF--IN--LKPGYDWTVEWAQNIEV 328

Query: 202 KERDSQLEETKAHFT-------------------------------------NVYVKNIN 224
            +R + L +TK   T                                     +++V  ++
Sbjct: 329 PKRLNLLRKTKVRGTKSGNSESEEDEEEYEDEDEDEDDEDEDDSRDILIDKKSIFVSQLD 388

Query: 225 LETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQ 284
              T E+  + F+K+G V   +L   +D   K F F+ +E  E  A A+E  N   F ++
Sbjct: 389 PSVTKEKLTQRFSKHGKVEDVNL-IFKDNNTKVFAFIKYETEEATATALERENHASFLNR 447

Query: 285 TLFV 288
           T+ V
Sbjct: 448 TMHV 451

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIR-VCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           S++V +LDP+V++  L   FS  G V  +  + +D  TK    +A++ +   EA   A+E
Sbjct: 381 SIFVSQLDPSVTKEKLTQRFSKHGKVEDVNLIFKDNNTKV---FAFIKYETEEATATALE 437

Query: 95  QLNYTPIKGRLCRIMWSQ 112
           + N+     R   + + +
Sbjct: 438 RENHASFLNRTMHVQYRE 455

>Sklu_2353.5 YIL061C, Contig c2353 10817-11575
          Length = 252

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           ++++G L   V+E  L   FS  G +  +RV RD  T  S GYA++ F D    + A ++
Sbjct: 58  TVFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAACKE 117

Query: 96  L 96
           +
Sbjct: 118 I 118

>Scas_701.3
          Length = 321

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           ++++G L    +E  L  +F   G +  IR+ RD +T  S GYA++ F D  + K A ++
Sbjct: 107 TIFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKE 166

Query: 96  LNY---TPIKGRLC 106
           +       IKGR C
Sbjct: 167 IGVHRGIDIKGRTC 180

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 54/120 (45%), Gaps = 15/120 (12%)

Query: 173 ESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEF 232
           E   KE I  +N  + N       PH      D  +++T  + T +++  +  +TT+ E 
Sbjct: 74  EEVEKERISKMNESIRNWD-----PH-----NDPNIKDTDPYRT-IFIGRLPYDTTELEL 122

Query: 233 NELFAKYGNVLSSSLEKTE-DGKLKGFGFVDFEKHEDAAKAVEEL---NGTEFKDQTLFV 288
            +LF K+G +    + + +   K KG+ F+ F     +  A +E+    G + K +T  V
Sbjct: 123 QKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKEIGVHRGIDIKGRTCIV 182

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTD-NGKSKGFGFVCFSTPEEATKAITE 378
           +F+  L     + +L++ F  +G I  +R++R     KSKG+ F+ F  P  +  A  E
Sbjct: 108 IFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKE 166

>Scas_582.10
          Length = 283

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 7/82 (8%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNV-------LSSSLEKTEDGKLKGFGFVDFEKHEDAA 270
           +YV NI+  T+  +   LF+KYG +       L+  + + E G  KG   V +EK E   
Sbjct: 43  IYVSNISKHTSQLDLITLFSKYGKIRRTREEALNCKMYQDEKGNFKGDALVVYEKPESVQ 102

Query: 271 KAVEELNGTEFKDQTLFVSRAQ 292
            A++ ++GT F   T+ V RAQ
Sbjct: 103 LAIDMVDGTIFNKSTIKVERAQ 124

>AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,
           218 aa]
          Length = 218

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%)

Query: 217 NVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEEL 276
            V+V     ET   +    F   G ++   +      + + F FV FE HE+  +AVEEL
Sbjct: 6   TVHVSGFPAETRARDMAPDFEAVGKIVRIDIPPMRPFQDRPFAFVKFETHEECVRAVEEL 65

Query: 277 NGTEFKDQTLFVSRAQ 292
           +G  F   T F    Q
Sbjct: 66  DGRPFTPDTRFTYHVQ 81

>CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I, hypothetical start
          Length = 280

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 1/88 (1%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           +Y+G +    +E  + D+ S +G V S+++  D+ T  S GYA+V + D E+   A+  L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGN 124
           N   +  RL +  +S  +  +  +G GN
Sbjct: 78  NGYQLGSRLLKCGYS-SNSDITDQGVGN 104

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLE-KTEDGKLKGFGFVDFEKHEDAAKAVEEL 276
           VY+ +I  + T+E+  +L +  G V+S  +   ++ GK KG+ FV ++  E +A AV  L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 277 NGTEFKDQTL 286
           NG +   + L
Sbjct: 78  NGYQLGSRLL 87

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDAL 183
           +++ ++  D   + + +  S  G ++S K+  D +TGKSKG+ FV ++   S+  A+  L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 184 NG 185
           NG
Sbjct: 78  NG 79

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 332 DEKLKEEFAPYGTITSVRVM-RTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 390
           +E++ +  +  G + S+++M  +  GKSKG+ FV +   E +  A+   N   +  + L 
Sbjct: 29  EEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNLNGYQLGSRLLK 88

Query: 391 VAIAQRKDV 399
              +   D+
Sbjct: 89  CGYSSNSDI 97

>ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH]
           complement(569855..569857,569915..570874) [963 bp, 320
           aa]
          Length = 320

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +++VG L   V E  L   F   G +  +R+ RD +T    GYA+V F D E  KKA  +
Sbjct: 108 TIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

Query: 96  L 96
           +
Sbjct: 168 I 168

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 51/99 (51%), Gaps = 13/99 (13%)

Query: 293 KKYERMQELKKQYEASRLEKMAKY--------QGVN----LFVKNLDDSIDDEKLKEEFA 340
           ++YE ++ +  + E    E++AK+        QG +    +FV  L   +D+ +L++ F 
Sbjct: 69  QRYEELKTINSRKEQELEEELAKWAPENDTNIQGTDPFRTIFVGRLHYDVDELELQKHFI 128

Query: 341 PYGTITSVRVMRTD-NGKSKGFGFVCFSTPEEATKAITE 378
            +G I  VR++R     K +G+ FV F  PE + KA  E
Sbjct: 129 KFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEA--- 179
            IF+  LH D+D   L + F  FG I   +I  D+ T K +G+ FV F     +K+A   
Sbjct: 108 TIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

Query: 180 IDALNGMLLNGQEIYV 195
           I    G+++ G+   V
Sbjct: 168 IGVHRGLMIRGRSAIV 183

>CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces
           cerevisiae YIL061c SNP1 U1 small nuclear
           ribonucleoprotein, hypothetical start
          Length = 299

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 3/75 (4%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAK---EAI 180
            +F+  L  D D   L + F+ +G I+  ++  D+  KS+G+ FV F+   SA+     I
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSARVCTRDI 175

Query: 181 DALNGMLLNGQEIYV 195
               G+ +NG+   V
Sbjct: 176 GVHRGIQINGRRCIV 190

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%)

Query: 320 NLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEA 372
            +FV  L    D+ +L++ FA YG I  VRV+R    KS+G+ FV F   + A
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSA 168

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +++VG L     E  L  +F+  G +  +RV RD   K S GYA+V F + ++ +     
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNK-SRGYAFVLFKETDSARVCTRD 174

Query: 96  LNY---TPIKGRLC 106
           +       I GR C
Sbjct: 175 IGVHRGIQINGRRC 188

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 39/69 (56%), Gaps = 2/69 (2%)

Query: 205 DSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFE 264
           D+ + +T  + T V+V  +  +T + +  ++FAKYG ++   + + +  K +G+ FV F 
Sbjct: 105 DNHMRDTDPYKT-VFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLF- 162

Query: 265 KHEDAAKAV 273
           K  D+A+  
Sbjct: 163 KETDSARVC 171

>Scas_621.16
          Length = 314

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 4/111 (3%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           +Y+G +    +E  + D+ + +G V ++++  D  T  S GYA++ F D E    AI  L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFG 147
           N   +  R  +  +S  +  +    SGN+   N+   +DN   +E  S  G
Sbjct: 106 NGYQLGSRFLKCGYSSNND-ISASSSGNVHEGNI---LDNDGSYENNSKMG 152

 Score = 35.8 bits (81), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLE-KTEDGKLKGFGFVDFEKHEDAAKAVEEL 276
           VY+ +I  + T+E+  +L    G V++  +    + GK KG+ F++F+  E +A A+  L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 277 NGTEF 281
           NG + 
Sbjct: 106 NGYQL 110

 Score = 32.3 bits (72), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDAL 183
           +++ ++  D   + + +  +  G +++ K+  D +TGKSKG+ F+ F+   ++  AI  L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 184 NG 185
           NG
Sbjct: 106 NG 107

>KLLA0E00484g complement(45755..46483) similar to sp|P10080
           Saccharomyces cerevisiae YHL034c SBP1 single-strand
           nucleic acid binding protein singleton, start by
           similarity
          Length = 242

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 87/221 (39%), Gaps = 41/221 (18%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKS--KGFGFVHFEHESSAKEAID 181
           +IF+ NL P+   + L +   VFG  +  +I T ++ ++  + F FV F+ +   ++   
Sbjct: 18  SIFVGNLSPETSPEDLQK---VFGESVKVEIPTLQSDRTYPRIFAFVTFDDKVDVEDLRS 74

Query: 182 ALNGMLLNGQEIYVAPHLT------------------------RKERDSQ--LEETKAHF 215
             +  ++  + IYV   LT                        +K +++Q  LE+ +   
Sbjct: 75  KFDKTVIKDKSIYVTKVLTPEEQQLKKQKRRANQRGKAVPAPPKKNKEAQVPLEQMERSK 134

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLK----------GFGFVDFEK 265
             +YV NI   TT  E    F      +   + + +D   K          G  FV F +
Sbjct: 135 DTLYVNNIPYHTTKAEIASFFGTTEESVILPMRRMKDTTTKRVFFSRKFNRGIAFVSFPE 194

Query: 266 HEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYE 306
             D      E NG  F+D+ L V  A  K    + ++ + E
Sbjct: 195 GTDIEAKAAEFNGKNFEDRELTVDVAANKPAHTEPVQTEAE 235

>Scas_643.16
          Length = 448

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
           S++VG LD    E  L++ F   G +  +R+ RD  T    G+AYV F + E+  KA+
Sbjct: 276 SIFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKAL 333

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 5/67 (7%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMR---TDNGKSKGFGFVCFSTPEEATKAIT 377
           +FV NLD   D+E L   F   G I  VR++R   T+ G  KGF +V F   E   KA+ 
Sbjct: 277 IFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMG--KGFAYVQFKELESVNKALL 334

Query: 378 EKNQQIV 384
              +Q+ 
Sbjct: 335 LNEKQMT 341

>CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces
           cerevisiae YNL110c, hypothetical start
          Length = 255

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAI 180
           SG I++  L      + L + FS FG++   ++A ++ TG S+ +GFV F +   ++ A 
Sbjct: 124 SGIIYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAY 183

Query: 181 DALNGMLLNGQEIYV 195
           D +N  LL G  + V
Sbjct: 184 DTMNNYLLMGHLLQV 198

>AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073)
           [933 bp, 310 aa]
          Length = 310

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDAL 183
           +F+  L+P      L   F+ FG++ S +I  D ++G+S G+GFV F  +++ + A   +
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 184 NGMLLNGQEIYV 195
           +G L++ + ++V
Sbjct: 292 DGALIDDRRVHV 303

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           L+V +L+P    A L  +F+  G V+S+ + RD  +  SLGY +V F    A + A  ++
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 97  NYTPIKGRLCRIMWSQ 112
           +   I  R   + +SQ
Sbjct: 292 DGALIDDRRVHVDFSQ 307

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRT-DNGKSKGFGFVCFSTPEEATKAITEK 379
           LFV  L+       L   FA +G + SV ++R  D+G+S G+GFV F+T      A T+ 
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 380 NQQIVAGKPLYVAIAQ 395
           +  ++  + ++V  +Q
Sbjct: 292 DGALIDDRRVHVDFSQ 307

 Score = 35.8 bits (81), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTED-GKLKGFGFVDFEKHEDAAKAVEEL 276
           ++V  +N  T   +   +FA++G+V S  + +  D G+  G+GFV+F        A  ++
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 277 NGTEFKDQTLFVSRAQ 292
           +G    D+ + V  +Q
Sbjct: 292 DGALIDDRRVHVDFSQ 307

>ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH]
           complement(854587..855867) [1281 bp, 426 aa]
          Length = 426

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           S++VG LD   SE  L+  F   G +  +R+ RD  T    G+AYV F D  +  KA+  
Sbjct: 260 SVFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKAL-L 318

Query: 96  LNYTPI---KGRLCRI 108
           LN   +   KGR  R+
Sbjct: 319 LNDKKMAVGKGRKLRV 334

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 52/102 (50%), Gaps = 5/102 (4%)

Query: 320 NLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMR---TDNGKSKGFGFVCFSTPEEATKAI 376
           ++FV NLD    +E L + F   G I  VR++R   T+ G  KGF +V F+      KA+
Sbjct: 260 SVFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVG--KGFAYVQFADLVSVNKAL 317

Query: 377 TEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQMRYQQ 418
              ++++  GK   + + + +++++ Q      A  ++  QQ
Sbjct: 318 LLNDKKMAVGKGRKLRVTRCRNMQKVQRQSNTAALPKLTDQQ 359

>YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1
           snRNA-associated protein with RNA recognition (RRM)
           domain, homologous to human 70 kDa U1 snRNP protein [903
           bp, 300 aa]
          Length = 300

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           ++++G L   + E  L   F   G +  IR+ +D +T+ S GYA++ F D  + K A ++
Sbjct: 108 TIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKE 167

Query: 96  LNY---TPIKGRLC 106
           +       IK R+C
Sbjct: 168 IGVHRGIQIKDRIC 181

 Score = 36.2 bits (82), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEA 179
           IFI  L  D+D   L + F  FG I   +I  D+ T KSKG+ F+ F+   S+K A
Sbjct: 109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMA 164

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTD-NGKSKGFGFVCFSTPEEATKAITE 378
           +F+  L   +D+ +L++ F  +G I  +R+++     KSKG+ F+ F  P  +  A  E
Sbjct: 109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKE 167

>CAGL0J02200g complement(215042..215476) similar to sp|P40561
           Saccharomyces cerevisiae YIR001c SGN1, hypothetical
           start
          Length = 144

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query: 199 LTRKERDS-QLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLS-SSLEKTEDGKLK 256
           LTR+++ + QLE   A   ++Y+ NI+L+TT EE +E F   G +   + L     G   
Sbjct: 30  LTREQKHALQLE---ADACSIYIGNISLDTTPEEIDEHFKSCGVIKRITMLYDKNTGPSI 86

Query: 257 GFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSR 290
           G+ +V+F+  +   KA+ + NGT  +   + V R
Sbjct: 87  GYAYVEFDSIDSRDKAL-DFNGTNLRQHVISVER 119

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
            S+Y+G +    +   + + F   G +  I +  D  T  S+GYAYV F+  ++  KA++
Sbjct: 45  CSIYIGNISLDTTPEEIDEHFKSCGVIKRITMLYDKNTGPSIGYAYVEFDSIDSRDKALD 104

>Kwal_26.7522
          Length = 262

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           ++Y+G +    +E  + D+ S +G V ++++  D  T  S GYA+V + D EA   A+  
Sbjct: 13  TVYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAVRN 72

Query: 96  LNYTPIKGRLCRI 108
           LN   +  RL + 
Sbjct: 73  LNGYQLGNRLLKC 85

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLE-KTEDGKLKGFGFVDFEKHEDAAKAVEEL 276
           VY+ +I  + T+E+  +L +  G V++  +    + GK KG+ FV+++  E +A AV  L
Sbjct: 14  VYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAVRNL 73

Query: 277 NGTEFKDQTL 286
           NG +  ++ L
Sbjct: 74  NGYQLGNRLL 83

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAI 180
           S  +++ ++  D   + + +  S  G +++ K+  D +TGKSKG+ FV ++   ++  A+
Sbjct: 11  SRTVYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAV 70

Query: 181 DALNG 185
             LNG
Sbjct: 71  RNLNG 75

>Scas_530.4
          Length = 684

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 70/339 (20%), Positives = 123/339 (36%), Gaps = 75/339 (22%)

Query: 114 DPALRKKGSGNIFI----KNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVH 169
           +P  R + S  +F+     NLH D    ++ + F  FG I+  K+  D+  +   + FV 
Sbjct: 132 EPTFRGRPSSCVFVASLASNLHDDELCLSVTDYFKKFGEIIRVKVLRDQANRP--YAFVQ 189

Query: 170 FEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTD 229
           + +++ A  A+   +G +LNG+ +             + E  + + T     N  +E   
Sbjct: 190 YTNDNDANVALKEAHGSILNGRRL-------------RCERARVNRTLFITHNSPIELF- 235

Query: 230 EEFNELFAKYGNVLSSSLEKTEDGKL----------KGFGFVDFEKHEDAAKAVEELNGT 279
            E + +  K+G  L   + K +D                 F  F   +DA +A   L   
Sbjct: 236 -EVHAICRKFGE-LDQLVPKRDDNPFMRRCSYPISNSSSWFAQFTFRDDAIRAFANLK-- 291

Query: 280 EFKDQTLFVSRAQK----------------KYERMQELKKQYEASRLEKMAKYQGVN--- 320
              D    V  AQ                   E +     Q + +  +        N   
Sbjct: 292 --TDSNWAVQWAQNIRVPKFFNLLNKDSPMDKENITNFNSQEDGADTDPTHDNNLNNDNM 349

Query: 321 ---------LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKG-FGFVCFSTPE 370
                    +FV  L +   +E LK  F+ +G I  + ++     K K  F F+ + T  
Sbjct: 350 QPVTIDKKSIFVGQLPEETTEEVLKIHFSKHGKILDLNLIH----KPKNVFAFIQYETEN 405

Query: 371 EATKAITEKNQQIVAGKPLYV------AIAQRKDVRRSQ 403
            A  A+  +N  I   K ++V       I  R++ +RSQ
Sbjct: 406 AAAIALETENHSIFISKTIHVQYKEIGGIHGRRNSKRSQ 444

>Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement
          Length = 309

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 8/76 (10%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLS-----SSLEKTEDGKLK--GFGFVDFEKHEDAA 270
           VY+ N++ +TT++E      +Y NVLS      ++    + +++  G  + DFE  + A 
Sbjct: 24  VYISNLSFDTTEDELTGYLLEY-NVLSVLIPSQTIRGFRNSRVRPLGIAYADFESADKAK 82

Query: 271 KAVEELNGTEFKDQTL 286
           +A+E LNG  F ++TL
Sbjct: 83  EAIEALNGKVFNNRTL 98

 Score = 36.6 bits (83), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 9/65 (13%)

Query: 164 GFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPH-------LTRKERDSQLEETKAHFT 216
           G  +  FE    AKEAI+ALNG + N + + + P+       ++RK   +  EE++  F+
Sbjct: 69  GIAYADFESADKAKEAIEALNGKVFNNRTLRLKPYVAYSPAVVSRKPSKANKEESR--FS 126

Query: 217 NVYVK 221
            + VK
Sbjct: 127 KLKVK 131

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 50  LLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRI 108
           L Y++ S +    +IR  R++  +  LG AY +F   +  K+AIE LN      R  R+
Sbjct: 43  LEYNVLSVLIPSQTIRGFRNSRVR-PLGIAYADFESADKAKEAIEALNGKVFNNRTLRL 100

>AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH]
           (1162117..1163397) [1281 bp, 426 aa]
          Length = 426

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 87/195 (44%), Gaps = 14/195 (7%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFG-NILSSKIATDETGKSKGFGFVHFEHESSAKEAIDA 182
            +++ N  P  D + L   F   G   LS ++ +      + F +V      SA  A + 
Sbjct: 109 TLWVTNFPPRYDGRELRRFFEDLGFQCLSVRLPSLRYNAGRRFAYVDLPSPQSADAAANT 168

Query: 183 LNGMLLNGQEIYVA---PHLTRKERDSQLEETKAHFTNVYVKNIN-LETTDEEFNELFAK 238
           LNGM L+G  + V    P    +  D+   E +     V ++ ++ ++ T E+   L   
Sbjct: 169 LNGMDLDGYNLVVKLSDPESRAQRSDAGTIEKR----EVLIRGLDFIKVTIEKLQGLVEP 224

Query: 239 YGNV---LSSSLEKTEDGKL-KGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKK 294
           +G V   +      + DG+  +GF FV + K   AA+A   L+ T F+D+ L V+ A +K
Sbjct: 225 FGEVEKLIMPPSSDSADGRHNRGFAFVTY-KDAAAAEAALALHNTVFEDRRLTVAMADRK 283

Query: 295 YERMQELKKQYEASR 309
               ++  KQ   SR
Sbjct: 284 PYLERQKVKQILVSR 298

>YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein with
           possible role in protein translation, has one RNA
           recognition (RRM) domain [753 bp, 250 aa]
          Length = 250

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 2/76 (2%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAI 180
           S +IF+ N+ PD+  + + + F   G I    +  D  TG  KG+G++ FE  +  ++A+
Sbjct: 63  SRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKAL 122

Query: 181 DALNGMLLNGQEIYVA 196
             LNG  L G++I V+
Sbjct: 123 -QLNGGELKGKKIAVS 137

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           S++VG + P V+   + D F   G +  I +  D  T T  GY Y+ F      +KA+ Q
Sbjct: 65  SIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKAL-Q 123

Query: 96  LNYTPIKGR 104
           LN   +KG+
Sbjct: 124 LNGGELKGK 132

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 59/113 (52%), Gaps = 6/113 (5%)

Query: 180 IDALNGMLLNGQEIYVAPHLTRKERDS-QLEETKAHFTNVYVKNINLETTDEEFNELFAK 238
           +D L G L       V+  L+++E+ + QLE   A   +++V NI  + T E+  + F  
Sbjct: 30  LDELVGKLSIEGTPQVSQKLSKEEKHAHQLE---ADSRSIFVGNITPDVTPEQIEDHFKD 86

Query: 239 YGNVLSSSLEKTED-GKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSR 290
            G +   +L    + G  KG+G+++FE      KA+ +LNG E K + + VSR
Sbjct: 87  CGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKAL-QLNGGELKGKKIAVSR 138

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDN-GKSKGFGFVCFSTPEEATKAI 376
           +FV N+   +  E++++ F   G I  + ++   N G  KG+G++ F +P    KA+
Sbjct: 66  IFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKAL 122

>Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement
          Length = 257

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%)

Query: 37 LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
          +Y+G +    +E  + D+ S +G V+++++  D  T  S GYA+V + D EA   A+  L
Sbjct: 15 VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVRNL 74

Query: 97 N 97
          N
Sbjct: 75 N 75

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLE-KTEDGKLKGFGFVDFEKHEDAAKAVEEL 276
           VY+ +I  + T+E+  +L +  G V +  +    + GK KG+ FV+++  E +  AV  L
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVRNL 74

Query: 277 NGTEFKDQTL 286
           NG +  ++ L
Sbjct: 75  NGYQLGNRFL 84

 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDAL 183
           +++ ++  D   + + +  S  G + + K+  D +TGKSKG+ FV ++   ++  A+  L
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVRNL 74

Query: 184 NG 185
           NG
Sbjct: 75  NG 76

>ACL071C [978] [Homologous to ScYHL034C (SBP1) - SH; ScYLL046C
           (RNP1) - SH] (229767..230663) [897 bp, 298 aa]
          Length = 298

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 84/223 (37%), Gaps = 53/223 (23%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGK--SKGFGFVHFEHESSAKEAID 181
            IFI NL  D   + L +   VFG  +  +I +++TGK   + + FV F  +   +E  +
Sbjct: 25  TIFIGNLAGDCSEEDLKQ---VFGAHVEVEIPSNKTGKFYKQRYAFVKFPAKIDFEEVKE 81

Query: 182 ALNGMLLNGQEIYVAPHLTRKERDSQ---------------------------------- 207
             +  ++  + IYV   LT+++RD                                    
Sbjct: 82  KYDKTVVRERSIYVRQALTKEQRDLHKQAQRGSRVATRGSRRGKRFVRGQAVPAPPQREK 141

Query: 208 --LEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTED----------GKL 255
             L++ +     +YV NI   TT EE  E F     ++   + +  D             
Sbjct: 142 VPLDQLERSSDTLYVNNIPYYTTKEEIAEFFGTKPELIVLPMRRMRDTVSNRFFYSKSMN 201

Query: 256 KGFGFVDFEKHEDAA--KAVEELNGTEFKDQTLFVSRAQKKYE 296
           +G  FV FE  E  A    +E+  G   KD+ + V  A  K E
Sbjct: 202 RGIVFVAFEGMEGDAIVHKMEQFQGKVLKDREITVDVAAIKPE 244

>Kwal_23.5864
          Length = 278

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 45/85 (52%), Gaps = 4/85 (4%)

Query: 320 NLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMR-TDNGKSKGFGFVCFST---PEEATKA 375
            +FV  L  ++ + +L++EF  +G I  VRV+R   + KS+G+GF+ F        A + 
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACRE 161

Query: 376 ITEKNQQIVAGKPLYVAIAQRKDVR 400
           I       + G+P+ V I + + V+
Sbjct: 162 IGVHRGVEIGGRPVIVDIERGRTVK 186

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           +++VG L  TV+E  L   F   G +  +RV RD  +  S GY ++ F +    + A  +
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACRE 161

Query: 96  L 96
           +
Sbjct: 162 I 162

 Score = 35.8 bits (81), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETG-KSKGFGFVHFEHESSAKEA--- 179
            +F+  L   +    L + F  FG I   ++  D+T  KS+G+GF+ F+ E  A+ A   
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACRE 161

Query: 180 IDALNGMLLNGQEIYV 195
           I    G+ + G+ + V
Sbjct: 162 IGVHRGVEIGGRPVIV 177

>Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement
          Length = 207

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           A++YVG L    SE  +Y++FS  G++  I +  D    T  G+ +V +N  +    A++
Sbjct: 46  ATIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNTPKEALSAVK 105

Query: 95  QLNYTPIKGRLCRI 108
            L+ T +  R   I
Sbjct: 106 YLSDTKLDDRHISI 119

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 66/130 (50%), Gaps = 19/130 (14%)

Query: 198 HLTRKERDSQ--LEETKAHFTN--VYVKNINLETTDEEFNELFAKYGNV--LSSSLEKTE 251
           +L RK R +   LE+ +   ++  +YV N++  T++E+  ELF+K G +  +   L++ +
Sbjct: 24  YLIRKARKNPHGLEDLRKSMSSATIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFK 83

Query: 252 DGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFV------------SRAQKKYERMQ 299
                GF FV +   ++A  AV+ L+ T+  D+ + +             R +   +   
Sbjct: 84  FTPC-GFCFVIYNTPKEALSAVKYLSDTKLDDRHISIDLDPGFEDGRQFGRGKSGGQVSD 142

Query: 300 ELKKQYEASR 309
           EL+ +++ASR
Sbjct: 143 ELRFEFDASR 152

>YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component of
           pre-mRNA cleavage and polyadenylation factor I (CFI),
           involved in poly(A) site choice, interacts with Rna14p,
           Pap1p, and Pcf11p, contains one RNA recognition (RRM)
           domain [891 bp, 296 aa]
          Length = 296

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%)

Query: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96
           +Y+G +    +E  + D+ S +G V ++++  D  T  S GYA++ F D E+   A+  L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 97  NYTPIKGRLCRIMWS 111
           N   +  R  +  +S
Sbjct: 80  NGYQLGSRFLKCGYS 94

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLE-KTEDGKLKGFGFVDFEKHEDAAKAVEEL 276
           VY+ +I  + T+E+  +L +  G V++  +    + G+ KG+ F++F   E +A AV  L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 277 NGTEFKDQTL 286
           NG +   + L
Sbjct: 80  NGYQLGSRFL 89

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDAL 183
           +++ ++  D   + + +  S  G +++ K+  D +TG+SKG+ F+ F    S+  A+  L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 184 NG 185
           NG
Sbjct: 80  NG 81

>AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH]
           complement(345624..346280) [657 bp, 218 aa]
          Length = 218

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           A++YVG L    SE  LY++FS  GS+  I +  D    T  G+ ++ +   +    A++
Sbjct: 46  ATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQTPQEALAALK 105

Query: 95  QLNYTPIKGR 104
            L+ T +  R
Sbjct: 106 YLSKTKLDDR 115

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 68/134 (50%), Gaps = 27/134 (20%)

Query: 198 HLTRKERDSQ--LEETKAHFTN--VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDG 253
           +L RK R +   LEE +   T+  +YV N++  T++E+  ELF+K G     S+EK   G
Sbjct: 24  YLKRKARKTPGGLEELRKSMTSATIYVGNLSFYTSEEQLYELFSKCG-----SIEKIIMG 78

Query: 254 --KLK----GFGFVDFEKHEDAAKAVEELNGTEFKDQTLFV------------SRAQKKY 295
             + K    GF F+ ++  ++A  A++ L+ T+  D+ + +             R +   
Sbjct: 79  LDRFKFTPCGFCFIIYQTPQEALAALKYLSKTKLDDREITIDLDPGFEEGRQFGRGKNGG 138

Query: 296 ERMQELKKQYEASR 309
           +   EL+ +++ASR
Sbjct: 139 QVSDELRFEFDASR 152

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 310 LEKMAK-YQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGK--SKGFGFVCF 366
           LE++ K      ++V NL     +E+L E F+  G+I  + +M  D  K    GF F+ +
Sbjct: 36  LEELRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKI-IMGLDRFKFTPCGFCFIIY 94

Query: 367 STPEEATKAI 376
            TP+EA  A+
Sbjct: 95  QTPQEALAAL 104

>CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor,
           hypothetical start
          Length = 381

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 71/157 (45%), Gaps = 23/157 (14%)

Query: 256 KGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAK 315
           + F +VD    E   KA++ LNG +     L V ++       +   K+ +A  LE+   
Sbjct: 141 RRFAYVDLPNMESLDKAIQLLNGKDINGYKLVVKKSNP-----ENRDKRSDAPVLERRE- 194

Query: 316 YQGVNLFVKNLDDS-IDDEKLKEEFAPYGTITSVRV----MRTDNGKSKGFGFVCFSTPE 370
                + ++NL  + +  + L + F  YG I  +R+    +   +  + G  FV ++ PE
Sbjct: 195 -----IIIRNLPKTMLVKDTLLDIFKKYGAIDDLRIPKKQLEMLSDLNHGCAFVVYTNPE 249

Query: 371 EATKAITEKNQQIVAGKPLYVAIA------QRKDVRR 401
           +A  A+ E N  ++    + V ++      +RK+V R
Sbjct: 250 DAKSAL-EMNNHVIDDIKISVNLSDSHAYLERKEVNR 285

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 100/227 (44%), Gaps = 23/227 (10%)

Query: 78  YAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPALRKKGSG-------NIFIKNL 130
           +AYV+  + E+  KAI+ LN   I G   +++  + +P  R K S         I I+NL
Sbjct: 143 FAYVDLPNMESLDKAIQLLNGKDINGY--KLVVKKSNPENRDKRSDAPVLERREIIIRNL 200

Query: 131 HPDIDNK-ALFETFSVFGNILSSKIATDE----TGKSKGFGFVHFEHESSAKEAIDALNG 185
              +  K  L + F  +G I   +I   +    +  + G  FV + +   AK A++ +N 
Sbjct: 201 PKTMLVKDTLLDIFKKYGAIDDLRIPKKQLEMLSDLNHGCAFVVYTNPEDAKSALE-MNN 259

Query: 186 MLLNGQEIYV-----APHLTRKERDSQLEETKAH-FTNVYVKNINLETTDEEFNELFAKY 239
            +++  +I V       +L RKE +  +       +  +Y   I+ +T+ E+        
Sbjct: 260 HVIDDIKISVNLSDSHAYLERKEVNRIINSKHTEKYAAIYP--ISDKTSKEQIRNFINDK 317

Query: 240 GNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTL 286
             VL   L+           F+ FE+   AAKA+ +LN + F  +T+
Sbjct: 318 NAVLVEELKNIYLVTDYKAVFLKFERESTAAKAMLQLNNSTFDRKTI 364

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 80/189 (42%), Gaps = 16/189 (8%)

Query: 135 DNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIY 194
           D + +F+   +    L+ ++ +     ++ F +V   +  S  +AI  LNG  +NG ++ 
Sbjct: 115 DIRNIFKDHKIVA--LNVRLPSLRFNSNRRFAYVDLPNMESLDKAIQLLNGKDINGYKLV 172

Query: 195 VA---PHLTRKERDSQLEETKAHFTNVYVKNI-NLETTDEEFNELFAKYGNVLSSSLEKT 250
           V    P    K  D+ + E +     + ++N+       +   ++F KYG +    + K 
Sbjct: 173 VKKSNPENRDKRSDAPVLERRE----IIIRNLPKTMLVKDTLLDIFKKYGAIDDLRIPKK 228

Query: 251 EDGKLK----GFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKK-YERMQELKKQY 305
           +   L     G  FV +   EDA  A+ E+N     D  + V+ +    Y   +E+ +  
Sbjct: 229 QLEMLSDLNHGCAFVVYTNPEDAKSAL-EMNNHVIDDIKISVNLSDSHAYLERKEVNRII 287

Query: 306 EASRLEKMA 314
            +   EK A
Sbjct: 288 NSKHTEKYA 296

>YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein
           with weak similarity to S. pombe poly(A)-binding protein
           (SP:P31209), has one RNA recognition (RRM) domain [870
           bp, 289 aa]
          Length = 289

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 77/175 (44%), Gaps = 24/175 (13%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTED------------GKLKGFGFVDFEK 265
           VY+ N+    ++ + +     YG   SS L  T+              K  G  F  F  
Sbjct: 20  VYISNLPFTASERDLHAFLNNYG--ASSVLIPTQTVRRFSKRHNSNPRKPLGIAFAQFAN 77

Query: 266 HEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQ----ELKKQYEASRLEKMAKYQGVNL 321
           +  A KA+++LNGT F++Q LF+ +    YE       ++KK  E ++++K  +     +
Sbjct: 78  NTLALKAIQDLNGTVFQNQKLFL-KLHVPYEADSTPDTDVKKPKEKNKVKKTPETAADTV 136

Query: 322 FVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAI 376
           +  +L D I D +++E F  Y     + + R+   + K   F     P + T A+
Sbjct: 137 YCHDLPDDITDSEIRELFQLYSP-QEIWIYRSKVYRRKCIPFA----PHQITAAL 186

>Scas_570.14
          Length = 113

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 7/79 (8%)

Query: 321 LFVKNLDDSIDDEKLKEE----FAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAI 376
           L+V NLD+ I+ ++L+      F+ YG +  V +      K +G  F+   T +EA  A+
Sbjct: 32  LYVNNLDEKINTKRLRTNLFLLFSIYGEVLKVAI---SAKKQRGQAFITMRTVDEANLAL 88

Query: 377 TEKNQQIVAGKPLYVAIAQ 395
              N +    KPL++  ++
Sbjct: 89  ISLNNEPFFDKPLHIQFSK 107

>Kwal_27.11096
          Length = 201

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           A++YVG L    SE  +Y++FS  G +  I +  D    T  G+ +V +N  E    A++
Sbjct: 46  ATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPEEALNAVK 105

Query: 95  QLNYTPIKGR 104
            L+ T +  R
Sbjct: 106 YLSDTKLDDR 115

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 53/106 (50%), Gaps = 15/106 (14%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLK--GFGFVDFEKHEDAAKAVEE 275
           +YV N++  T++E+  ELF+K G V+   +   +  K    GF FV +   E+A  AV+ 
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKSG-VIKRIIMGLDRFKFTPCGFCFVIYNTPEEALNAVKY 106

Query: 276 LNGTEFKDQTLFV------------SRAQKKYERMQELKKQYEASR 309
           L+ T+  D+ + +             R +   +   EL+ +++ASR
Sbjct: 107 LSDTKLDDRNISLDLDPGFEDGRQFGRGKSGGQVSDELRFEFDASR 152

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 22/100 (22%)

Query: 298 MQELKKQYEASRLEKMAKY-------------------QGVNLFVKNLDDSIDDEKLKEE 338
             E+K  + A+RL+  + Y                   +   ++V NL     +E++ E 
Sbjct: 6   FDEIKYDHSANRLDVPSNYLMKKARRNPDGLEDLRRSMRSATIYVGNLSFYTSEEQIYEL 65

Query: 339 FAPYGTITSVRVMRTDNGKSK--GFGFVCFSTPEEATKAI 376
           F+  G I  + +M  D  K    GF FV ++TPEEA  A+
Sbjct: 66  FSKSGVIKRI-IMGLDRFKFTPCGFCFVIYNTPEEALNAV 104

>YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein
           that may be involved in coping with heat stresses,
           contains one RNA recognition (RRM) domain [663 bp, 220
           aa]
          Length = 220

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAI 180
           SG I++  L      K L + F+ FG++   ++A ++ TG S+ +GF+ F ++  A  A 
Sbjct: 90  SGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQ 149

Query: 181 DALNGMLLNGQEIYV 195
           +++N  LL G  + V
Sbjct: 150 ESMNNYLLMGHLLQV 164

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 2/82 (2%)

Query: 313 MAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTD-NGKSKGFGFVCFSTPEE 371
           + +Y G+ ++V  L     +++L + FA +G +  VR+ R    G S+ +GF+ F   E+
Sbjct: 86  LEEYSGI-IYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKED 144

Query: 372 ATKAITEKNQQIVAGKPLYVAI 393
           A  A    N  ++ G  L V +
Sbjct: 145 AMIAQESMNNYLLMGHLLQVRV 166

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 54/121 (44%), Gaps = 21/121 (17%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTED-GKLKGFGFVDFEKHEDAAKAVEEL 276
           +YV  +     ++E ++ FA++G++    L + +  G  + +GF++F   EDA  A E +
Sbjct: 93  IYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESM 152

Query: 277 NGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKY-------QGVNLFVKNLDDS 329
           N        L V    K              +++EK+ KY       +G+   VK L D+
Sbjct: 153 NNYLLMGHLLQVRVLPK-------------GAKIEKLYKYKKRVLVEKGITKPVKQLKDN 199

Query: 330 I 330
           +
Sbjct: 200 M 200

>Scas_666.11
          Length = 224

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAI 180
           S  +++  L      + L + FS FG++   ++A ++ TG S+ +GF+ F ++  A  A 
Sbjct: 93  SSILYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQ 152

Query: 181 DALNGMLLNGQEIYV 195
           DA+N  L+ G  + V
Sbjct: 153 DAMNNYLVMGHLLQV 167

>CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces
           cerevisiae YPL190c NAB3 polyadenylated RNA-binding
           protein, hypothetical start
          Length = 775

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 73/174 (41%), Gaps = 28/174 (16%)

Query: 71  VTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNL 130
           +TK       V +ND+  G+  I +++  P K RL                 GN+ +KN 
Sbjct: 298 ITKPMTPEESVRYNDYLKGENKITEMHSIPPKSRLF---------------IGNLPLKN- 341

Query: 131 HPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNG 190
              +  + LF  FS FG+IL   I          FGF+ +++  S + AI+  +  +  G
Sbjct: 342 ---VSKQDLFRLFSPFGHILQINIKN-------AFGFIQYDNPKSVRAAIECESQEINFG 391

Query: 191 QEIY--VAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNV 242
           +++   V+    R + D     T +  T +       +  DEE  +++A+  N 
Sbjct: 392 KKLILEVSSSNNRPQYDHGDHGTNSSSTFISTSKRPFQHEDEEPVDMYAENNNA 445

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 8/75 (10%)

Query: 321 LFVKNLD-DSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEK 379
           LF+ NL   ++  + L   F+P+G I  + +          FGF+ +  P+    AI  +
Sbjct: 332 LFIGNLPLKNVSKQDLFRLFSPFGHILQINI-------KNAFGFIQYDNPKSVRAAIECE 384

Query: 380 NQQIVAGKPLYVAIA 394
           +Q+I  GK L + ++
Sbjct: 385 SQEINFGKKLILEVS 399

>KLLA0B11594g complement(1018044..1018388) some similarities with
           sp|P40567 Saccharomyces cerevisiae YIR009w MSL1 U2
           snRNA-associated protein with singleton, hypothetical
           start
          Length = 114

 Score = 37.4 bits (85), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 8/84 (9%)

Query: 321 LFVKNLDDSIDDEKLKEE----FAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAI 376
           ++VKNL+D I  + ++E     FA YG +  V +      K +G  F+ F + +EA  A+
Sbjct: 34  VYVKNLNDQIKIQTVRESLYMLFATYGEVIKVSM----TPKQRGQAFITFKSVDEANLAL 89

Query: 377 TEKNQQIVAGKPLYVAIAQRKDVR 400
                ++   KPL +  +++   +
Sbjct: 90  LSLKDELFFNKPLVLQFSKQTTTK 113

 Score = 34.3 bits (77), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 8/85 (9%)

Query: 218 VYVKNIN----LETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAV 273
           VYVKN+N    ++T  E    LFA YG V+  S+      K +G  F+ F+  ++A  A+
Sbjct: 34  VYVKNLNDQIKIQTVRESLYMLFATYGEVIKVSM----TPKQRGQAFITFKSVDEANLAL 89

Query: 274 EELNGTEFKDQTLFVSRAQKKYERM 298
             L    F ++ L +  +++   ++
Sbjct: 90  LSLKDELFFNKPLVLQFSKQTTTKL 114

>KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces
          cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
          processing factor CF I singleton, hypothetical start
          Length = 258

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 36 SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
          ++Y+G +    +E  + D+   IG V+++++  D  T  S GYA++ F D      A+  
Sbjct: 9  TVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSASAVRN 68

Query: 96 LN-YT 99
          LN YT
Sbjct: 69 LNGYT 73

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 118 RKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSA 176
           R   S  +++ ++  D   + + +     G + + K+  D  TGKSKG+ F+ F+  +++
Sbjct: 3   RGNPSRTVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATS 62

Query: 177 KEAIDALNGMLLNGQEI 193
             A+  LNG  L  + +
Sbjct: 63  ASAVRNLNGYTLGSRSL 79

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 217 NVYVKNINLETTDEEFNELFAKYGNVLSSSLE-KTEDGKLKGFGFVDFEKHEDAAKAVEE 275
            VY+ +I  + T+++  +L    G V +  +      GK KG+ F++F+    +A AV  
Sbjct: 9   TVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSASAVRN 68

Query: 276 LNGTEFKDQTL 286
           LNG     ++L
Sbjct: 69  LNGYTLGSRSL 79

>Scas_565.8
          Length = 322

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 45/92 (48%), Gaps = 10/92 (10%)

Query: 205 DSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTED------GKLK-- 256
           DS ++  +     +   N+   T+D E  EL   +G V  S L  TE        K+   
Sbjct: 6   DSNVDPIEITTHKLVFTNVRFNTSDAELEELLKPFGKV--SVLTPTESLFGFRGTKVVSI 63

Query: 257 GFGFVDFEKHEDAAKAVEELNGTEFKDQTLFV 288
           G+ +V FE  + AA A  EL+ TEFK +TL++
Sbjct: 64  GYAYVIFETPQLAATAFNELHKTEFKGRTLYI 95

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 47  SEALLYDIFSPIGSVSSIRVCRDAV----TKT-SLGYAYVNFNDHEAGKKAIEQLNYTPI 101
           S+A L ++  P G VS +           TK  S+GYAYV F   +    A  +L+ T  
Sbjct: 29  SDAELEELLKPFGKVSVLTPTESLFGFRGTKVVSIGYAYVIFETPQLAATAFNELHKTEF 88

Query: 102 KGRLCRI 108
           KGR   I
Sbjct: 89  KGRTLYI 95

>AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH]
           (736609..737409) [801 bp, 266 aa]
          Length = 266

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 38/76 (50%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           ++Y+G +    +E  + D+ S +G V+ +++  D  T  S GYA++ F D      A+  
Sbjct: 12  TVYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATSSSAVRN 71

Query: 96  LNYTPIKGRLCRIMWS 111
           LN   +  R  +  ++
Sbjct: 72  LNGYALGNRTLKCGYT 87

 Score = 36.6 bits (83), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 43/82 (52%), Gaps = 5/82 (6%)

Query: 117 LRKKGSG----NIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFE 171
           + K G+G     +++ ++  D   + + +  S  G +   K+  D +TGKSKG+ F+ F+
Sbjct: 1   MNKSGNGRPSRTVYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFK 60

Query: 172 HESSAKEAIDALNGMLLNGQEI 193
             +++  A+  LNG  L  + +
Sbjct: 61  DLATSSSAVRNLNGYALGNRTL 82

 Score = 35.8 bits (81), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLE-KTEDGKLKGFGFVDFEKHEDAAKAVEEL 276
           VY+ +I  + T+++  +L +  G V    +    + GK KG+ F++F+    ++ AV  L
Sbjct: 13  VYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATSSSAVRNL 72

Query: 277 NGTEFKDQTL 286
           NG    ++TL
Sbjct: 73  NGYALGNRTL 82

>ADL126C [1615] [Homologous to ScYFR032C - SH] (469991..471391)
           [1401 bp, 466 aa]
          Length = 466

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 8/76 (10%)

Query: 218 VYVKNINLETTDEEFNELFAKYG--NVLSSS-----LEKTEDGKLKGFGFVDFEKHEDAA 270
           VY+ N++ + T+E   E    +   +VL  S      +KT    L G  +V+F+  + AA
Sbjct: 51  VYISNLSQDATEEALTEFLKDFHPVSVLIPSQSVRGFQKTSVRPL-GIAYVEFKDADTAA 109

Query: 271 KAVEELNGTEFKDQTL 286
           K + ELNG  F D+ L
Sbjct: 110 KVILELNGVTFMDREL 125

>KLLA0A03531g 320828..323026 similar to sp|P06103 Saccharomyces
           cerevisiae YOR361c PRT1 translation initiation factor
           eIF3 subunit singleton, start by similarity
          Length = 732

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 137 KALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVA 196
           K L + FS  G +L  +I   E GK+KG  F+  E  S+AKEAI   NG  L+ +   + 
Sbjct: 57  KVLTKLFSQAGKVLDMQIPV-EDGKTKGHLFIEMESVSAAKEAIQLFNGKKLDAKHRLLV 115

Query: 197 PHLTRKER 204
             L   E+
Sbjct: 116 NSLNDMEK 123

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 8/83 (9%)

Query: 203 ERDSQLEETKAHFTNVYVKN-------INLETTDEEFNELFAKYGNVLSSSLEKTEDGKL 255
           ER+ Q+++   +F N  V +         +   ++   +LF++ G VL   +   EDGK 
Sbjct: 23  EREFQIQDGGVNFDNFLVVDGAPVAPEAKVPVLEKVLTKLFSQAGKVLDMQI-PVEDGKT 81

Query: 256 KGFGFVDFEKHEDAAKAVEELNG 278
           KG  F++ E    A +A++  NG
Sbjct: 82  KGHLFIEMESVSAAKEAIQLFNG 104

>YDR429C (TIF35) [1252] chr4 complement(1324465..1325289)
           Translation initiation factor eIF3, p33 subunit,
           contains an RRM (RNA recognition motif) domain [825 bp,
           274 aa]
          Length = 274

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 319 VNLFVKNLDDSIDDEKLKEEFA-PYGTITSVRVMRT-DNGKSKGFGFVCFSTPEEATKAI 376
             L +  ++++ D+  L+EE   P+  I  V V+R  + GKS+G  FV FS+ E A +A+
Sbjct: 191 CTLKIMQVNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQAL 250

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 45  TVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGR 104
           ++ E LL+  F+PI  VS   V R+  T  S G A+V F+  E  ++A+  L+       
Sbjct: 206 SLREELLFP-FAPIPRVS---VVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNL 261

Query: 105 LCRIMWSQ 112
           + R+ WS+
Sbjct: 262 ILRVEWSK 269

 Score = 32.3 bits (72), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 152 SKIATDETGKSKGFGFVHFEHESSAKEAIDALNG 185
           S +   ETGKS+G  FV F  E  A++A+  L+G
Sbjct: 222 SVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDG 255

>Kwal_55.20903
          Length = 147

 Score = 37.4 bits (85), Expect = 0.009,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAID 181
           S +IF++++  DI   +L + F   G+I    + + +     G+ +V F  ++SA+ A++
Sbjct: 58  SRSIFLRDIPSDISLPSLEDHFRDMGSICRITMISKQRKSGTGYAYVEFATKASAERALE 117

Query: 182 ALNGMLLNGQEIYVAPHLTRKER 204
            L+G +L G ++ VA   T   R
Sbjct: 118 -LDGSILRGHKLRVARKRTNVPR 139

 Score = 33.5 bits (75), Expect = 0.19,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 56/124 (45%), Gaps = 10/124 (8%)

Query: 289 SRAQKKYERMQELKKQYEASRLEKMAKYQGVN--------LFVKNLDDSIDDEKLKEEFA 340
           S+   K      LK    +S  E  AK + ++        +F++++   I    L++ F 
Sbjct: 21  SKKPVKIRHSPALKSSNRSSHQESAAKGENIDQSETDSRSIFLRDIPSDISLPSLEDHFR 80

Query: 341 PYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVR 400
             G+I  + ++        G+ +V F+T   A +A+ E +  I+ G  L VA  +R +V 
Sbjct: 81  DMGSICRITMISKQRKSGTGYAYVEFATKASAERAL-ELDGSILRGHKLRVA-RKRTNVP 138

Query: 401 RSQL 404
           R ++
Sbjct: 139 RMRV 142

 Score = 30.4 bits (67), Expect = 2.2,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           S+++ ++   +S   L D F  +GS+  I +      K+  GYAYV F    + ++A+E 
Sbjct: 60  SIFLRDIPSDISLPSLEDHFRDMGSICRITMISKQ-RKSGTGYAYVEFATKASAERALE- 117

Query: 96  LNYTPIKGRLCRIMWSQRD-PALRKK 120
           L+ + ++G   R+   + + P +R K
Sbjct: 118 LDGSILRGHKLRVARKRTNVPRMRVK 143

>Scas_714.59
          Length = 233

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 319 VNLFVKNLDDSIDDEKLKEEFA-PYGTITSVRVMRT-DNGKSKGFGFVCFSTPEEATKAI 376
             L +  L+++ D+  L+EE   P+  I    V+R  + G+SKG  FV FS+ + A KA+
Sbjct: 150 CTLKIMQLNENADENNLREELLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQMAEKAL 209

 Score = 32.3 bits (72), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 35  ASLYVGELDPTVSEA-LLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
            +L + +L+    E  L  ++  P   +    V R+  T  S G A+V F+  +  +KA+
Sbjct: 150 CTLKIMQLNENADENNLREELLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQMAEKAL 209

Query: 94  EQLNYTPIKGRLCRIMWSQRDPAL 117
             L+       + R+ WS+  P +
Sbjct: 210 HFLDGRGFMNLILRVEWSKPKPKV 233

 Score = 32.0 bits (71), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 154 IATDETGKSKGFGFVHFEHESSAKEAIDALNG 185
           +   ETG+SKG  FV F  E  A++A+  L+G
Sbjct: 183 VRNRETGRSKGLAFVTFSSEQMAEKALHFLDG 214

>YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein with
           weak similarity to RNA-binding proteins, contains one
           RNA recognition (RRM) domain [2007 bp, 668 aa]
          Length = 668

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%)

Query: 354 DNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           DNG  +G  F  F+TPEE T+ IT  N + ++G+ L V
Sbjct: 121 DNGIFRGLAFANFTTPEETTQVITSLNGKEISGRKLKV 158

>CAGL0E03630g complement(335091..337331) weakly similar to sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation,
           hypothetical start
          Length = 746

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 62/137 (45%), Gaps = 10/137 (7%)

Query: 262 DFEKHEDAA-KAVEELNGTEF-----KDQTLFVSRAQKKYERMQ-ELKKQYEASRLEKMA 314
           DFEK E A   +   LN  E       D    +S A K  +++  +LK  Y         
Sbjct: 312 DFEKDEKAKYGSTFSLNARESDFQQDTDSVSTISSASKSNDKIAADLKFAYRQINTRDKF 371

Query: 315 KYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATK 374
           +    ++FV  LD S   E L + F+ +G I ++ V+   +  +  F F+ + T + A  
Sbjct: 372 QIDKKSIFVGQLDLSTTKEILVKRFSTHGKIRNIDVV---SKPTTVFAFIEYETEQAAAA 428

Query: 375 AITEKNQQIVAGKPLYV 391
           A+ ++N  I+  K ++V
Sbjct: 429 ALDKENHSILLSKTMHV 445

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 43/77 (55%), Gaps = 4/77 (5%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           S++VG+LD + ++ +L   FS  G + +I    D V+K +  +A++ +   +A   A+++
Sbjct: 377 SIFVGQLDLSTTKEILVKRFSTHGKIRNI----DVVSKPTTVFAFIEYETEQAAAAALDK 432

Query: 96  LNYTPIKGRLCRIMWSQ 112
            N++ +  +   + + +
Sbjct: 433 ENHSILLSKTMHVQYKE 449

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 61/130 (46%), Gaps = 15/130 (11%)

Query: 279 TEFKDQTLFVSRAQKKYERMQELKKQYEAS------RLEKMAKYQG---VNLFVKNLDDS 329
           TE K+ T+    + +  +   +LK + E +        + +  Y+G     +FV +L  S
Sbjct: 46  TENKNTTIKSPVSHENDKYTNKLKAENETTPDNVTNTADTIGDYKGRPSACIFVASLASS 105

Query: 330 IDDEKL----KEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVA 385
           + D++L     + F  YG +  V+V+R D+ +   + FV +   ++A  A+   +  ++ 
Sbjct: 106 LPDDQLCMNVTKHFQNYGQLVGVKVLRDDHNRP--YAFVQYINDKDAKHALKNASGTVLN 163

Query: 386 GKPLYVAIAQ 395
           G+ L    A+
Sbjct: 164 GRKLRCEAAK 173

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 10/99 (10%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           IF+  L      + L + FS  G I +  + +  T     F F+ +E E +A  A+D  N
Sbjct: 378 IFVGQLDLSTTKEILVKRFSTHGKIRNIDVVSKPT---TVFAFIEYETEQAAAAALDKEN 434

Query: 185 GMLLNGQEIYV------APHLTRK-ERDSQLEETKAHFT 216
             +L  + ++V       PH  R  +R+S  +E    FT
Sbjct: 435 HSILLSKTMHVQYKEIGGPHGRRLFKRNSYFKEVSKTFT 473

>ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH]
           (708437..709411) [975 bp, 324 aa]
          Length = 324

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 42/76 (55%), Gaps = 2/76 (2%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAI 180
           S ++F+ ++ P+   + L E F   G I    I  ++ TG+ KG+ ++ FE  SS ++A+
Sbjct: 82  SRSVFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTGEPKGYAYIQFESISSVEKAL 141

Query: 181 DALNGMLLNGQEIYVA 196
             L+G   NG  I VA
Sbjct: 142 Q-LDGSSFNGNTISVA 156

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95
           S++V  + P  +  +L + F  +G +S I +  +  T    GYAY+ F    + +KA+ Q
Sbjct: 84  SVFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTGEPKGYAYIQFESISSVEKAL-Q 142

Query: 96  LNYTPIKGRLCRI 108
           L+ +   G    +
Sbjct: 143 LDGSSFNGNTISV 155

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLS--SSLEKTEDGKLKGFGFVDFEKHEDAAKAVEE 275
           V+V +I  E T E   E F   G V+S  + L   + G+ KG+ ++ FE      KA+ +
Sbjct: 85  VFVSSITPEATAEMLEEHFKDVG-VISRITILYNKKTGEPKGYAYIQFESISSVEKAL-Q 142

Query: 276 LNGTEFKDQTLFVSR 290
           L+G+ F   T+ V++
Sbjct: 143 LDGSSFNGNTISVAK 157

>KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4
           Ashbya gossypii Yib1, hypothetical start
          Length = 345

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 304 QYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTD-NGKSKGFG 362
           Q  A RLEK  +    ++FV N+      E L+E F   G +  V ++     G  KG+ 
Sbjct: 88  QSRAERLEKQIELDSRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYA 147

Query: 363 FVCFSTPEEATKAITEKNQQIVAGKPLYVA 392
           ++ F + +   KA+  K+ ++  G+ + VA
Sbjct: 148 YIEFESSDSIPKALELKDSEL-HGETINVA 176

 Score = 33.5 bits (75), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAI 180
           S +IF+ N+  +   + L E F   G ++   I  ++ TG  KG+ ++ FE   S  +A+
Sbjct: 102 SRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYAYIEFESSDSIPKAL 161

Query: 181 DALNGMLLNGQEIYVA 196
           + L    L+G+ I VA
Sbjct: 162 E-LKDSELHGETINVA 176

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           S++VG +    +   L + F   G V  + +  + +T    GYAY+ F   ++  KA+E
Sbjct: 104 SIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYAYIEFESSDSIPKALE 162

>Scas_720.2
          Length = 245

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           A++YVG L    SE  +Y++FS  G +  I +  D    T  G+ +V +++ +    A++
Sbjct: 47  ATIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYSNAQEALNALK 106

Query: 95  QLNYTPIKGRLCRI 108
            L+ T +  +   I
Sbjct: 107 YLSDTKLDDKHITI 120

 Score = 32.7 bits (73), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 53/99 (53%), Gaps = 7/99 (7%)

Query: 196 APHLTRKERDS--QLEETKAHF--TNVYVKNINLETTDEEFNELFAKYGNV--LSSSLEK 249
           + +L RK R +   LEE +       +YV N++  T++E+  ELF+K G +  +   L++
Sbjct: 23  SAYLLRKARKNPNGLEELRQSLQSATIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDR 82

Query: 250 TEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFV 288
            +     GF FV +   ++A  A++ L+ T+  D+ + +
Sbjct: 83  FKFTPC-GFCFVIYSNAQEALNALKYLSDTKLDDKHITI 120

>KLLA0B14432g 1267356..1267877 weakly similar to sp|P36036
           Saccharomyces cerevisiae YKL214c singleton, start by
           similarity
          Length = 173

 Score = 36.6 bits (83), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 210 ETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDA 269
           + +   T + ++NI LET+D E  +   + G V S  +   ++ ++   GF D +     
Sbjct: 45  DRRKRITLLRIRNIPLETSDYEIEDWINEIGEVESIRINDRKENRVATVGFKDVQL---L 101

Query: 270 AKAVEELNGTEFKDQTLFV 288
             AVE+LNG E     L V
Sbjct: 102 GTAVEKLNGKEVHGSQLEV 120

>AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH]
           complement(18862..19482) [621 bp, 206 aa]
          Length = 206

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 116 ALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHES 174
           A R   SG I+I  L      + L   F+ FG++   ++A + +TG S+ + F+ F +  
Sbjct: 71  AARTDLSGIIYISRLPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFANPD 130

Query: 175 SAKEAIDALNGMLLNGQEIYVA 196
            A  A + ++  LL G  + V+
Sbjct: 131 DAVVAQETMHNYLLMGHLLQVS 152

>CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces
           cerevisiae YPL178w SAE1, start by similarity
          Length = 236

 Score = 36.6 bits (83), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           +++YVG L    SE  +Y++FS  G +  I +  D    T  G+ ++ +N  +    A++
Sbjct: 46  STIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNAVK 105

Query: 95  QLNYTPIKGRLCRI 108
            L  T +  +   I
Sbjct: 106 YLGDTKLDDKSITI 119

 Score = 35.4 bits (80), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 55/108 (50%), Gaps = 15/108 (13%)

Query: 216 TNVYVKNINLETTDEEFNELFAKYGNV--LSSSLEKTEDGKLKGFGFVDFEKHEDAAKAV 273
           + +YV N++  T++E+  ELF+K G +  +   L++ +     GF F+ +   ++A  AV
Sbjct: 46  STIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPC-GFCFIIYNTPQEALNAV 104

Query: 274 EELNGTEFKDQTLFV------------SRAQKKYERMQELKKQYEASR 309
           + L  T+  D+++ +             R +   +   EL+ +++ASR
Sbjct: 105 KYLGDTKLDDKSITIDLDPGFEDGRQFGRGKSGGQVSDELRFEFDASR 152

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 45/100 (45%), Gaps = 22/100 (22%)

Query: 298 MQELKKQYEASRLEKMAKY---------QGVN----------LFVKNLDDSIDDEKLKEE 338
             E+K  +   RL+  +KY          G+N          ++V NL     +E++ E 
Sbjct: 6   FDEIKYDHSVKRLDSPSKYLLRKARRNPNGLNDLRQSLKSSTIYVGNLSFYTSEEQIYEL 65

Query: 339 FAPYGTITSVRVMRTDNGK--SKGFGFVCFSTPEEATKAI 376
           F+  G I  + +M  D  K    GF F+ ++TP+EA  A+
Sbjct: 66  FSKCGFIKRI-IMGLDRFKFTPCGFCFIIYNTPQEALNAV 104

>KLLA0D16049g complement(1352380..1353657) some similarities with
           sp|P43607 Saccharomyces cerevisiae YFR032c singleton,
           hypothetical start
          Length = 425

 Score = 37.0 bits (84), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 8/76 (10%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLK-------GFGFVDFEKHEDAA 270
           VY+ N++ E ++ +  E    Y NV+S  +       LK       G  + +F   EDA 
Sbjct: 7   VYISNLSFEASENQLYEYLQDY-NVISVLIPSQTVRGLKNKAVRPFGIAYAEFSNEEDAN 65

Query: 271 KAVEELNGTEFKDQTL 286
           K ++ELNG  F ++ L
Sbjct: 66  KVIQELNGKLFMERHL 81

>Kwal_26.8458
          Length = 219

 Score = 36.2 bits (82), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAI 180
           SG I++  L      + L + FS FG++   ++A ++ TG S+ +GFV F ++  +  A 
Sbjct: 89  SGIIYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVAQ 148

Query: 181 DALNGMLLNGQEIYV 195
           + ++  LL G  + V
Sbjct: 149 ETMHNYLLMGHLLQV 163

>Kwal_55.20718
          Length = 594

 Score = 36.6 bits (83), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKN 380
           +FV  LD    +EKL + F+ +G+IT + ++   N     F F+ F+T E A  A+  +N
Sbjct: 202 IFVGQLDPMATEEKLLKRFSRHGSITDINLITKPNNV---FAFIKFTTEEAAAAALEMEN 258

Query: 381 QQIVAGKPLYVAIAQRKDVRRSQLAQQ 407
             I   K ++V   +   ++R +   Q
Sbjct: 259 HAIFLSKTMHVQYREIGGIKRFRRGNQ 285

 Score = 32.7 bits (73), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 4/48 (8%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNF 83
           S++VG+LDP  +E  L   FS  GS++ I +    +TK +  +A++ F
Sbjct: 201 SIFVGQLDPMATEEKLLKRFSRHGSITDINL----ITKPNNVFAFIKF 244

>Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement
          Length = 281

 Score = 36.2 bits (82), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 321 LFVKNLDDSIDDEKLKEEFA-PYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAI 376
           L +  L++  D+  +++E   P+G I  V V+R T+ G+S+G  ++ F T E A  A+
Sbjct: 200 LKITQLNEHADESTIRQELLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETAL 257

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 146 FGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDALNG 185
           FG I    +  + ETG+S+G  ++ FE E  A+ A++ L+G
Sbjct: 222 FGRIPKVVVVRNTETGRSRGISYITFETEEIAETALNFLDG 262

 Score = 29.3 bits (64), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 30/68 (44%), Gaps = 4/68 (5%)

Query: 45  TVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGR 104
           T+ + LL+    P G +  + V R+  T  S G +Y+ F   E  + A+  L+       
Sbjct: 213 TIRQELLF----PFGRIPKVVVVRNTETGRSRGISYITFETEEIAETALNFLDGRGFMNL 268

Query: 105 LCRIMWSQ 112
           +    WS+
Sbjct: 269 ILHAEWSK 276

>Kwal_23.3650
          Length = 299

 Score = 35.8 bits (81), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 46/115 (40%), Gaps = 10/115 (8%)

Query: 196 APHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKL 255
           AP   ++   + LE  +     +YV N+    T EE  + F     ++   L +  + K 
Sbjct: 161 APPKKQERTRAPLESMERSTDTLYVNNVPYFATKEELADFFGTTPELVVLPLRRMRNVKT 220

Query: 256 K----------GFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQE 300
           K          G  FV FE  +D  + V+E  G    D+ L V  A  K  R ++
Sbjct: 221 KQFFYHKRMNRGIAFVTFENCQDITQKVQEFQGKSLNDRELAVDVAALKPPREEQ 275

>Kwal_26.6824
          Length = 739

 Score = 36.2 bits (82), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 9/64 (14%)

Query: 136 NKALFETFSVFGNILSSKIATDETGK-SKGFGFVHFEHESSAKEAIDALNG--------M 186
           +K L + FS  G ++   +  DE  K +KG+ FV F+   SA++AI  LNG        +
Sbjct: 57  SKVLTKLFSQAGKVVDINLPLDEAKKCTKGYLFVEFDSAVSARKAIKLLNGKKLDVKHRL 116

Query: 187 LLNG 190
           L+NG
Sbjct: 117 LVNG 120

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 44  PTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLN 97
           P +S+ +L  +FS  G V  I +  D   K + GY +V F+   + +KAI+ LN
Sbjct: 54  PVLSK-VLTKLFSQAGKVVDINLPLDEAKKCTKGYLFVEFDSAVSARKAIKLLN 106

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 232 FNELFAKYGNVLSSSLEKTEDGKL-KGFGFVDFEKHEDAAKAVEELNG 278
             +LF++ G V+  +L   E  K  KG+ FV+F+    A KA++ LNG
Sbjct: 60  LTKLFSQAGKVVDINLPLDEAKKCTKGYLFVEFDSAVSARKAIKLLNG 107

>YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of
           nuclear cap-binding protein complex [627 bp, 208 aa]
          Length = 208

 Score = 35.4 bits (80), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 65/130 (50%), Gaps = 19/130 (14%)

Query: 198 HLTRKERDSQ--LEETKAHF--TNVYVKNINLETTDEEFNELFAKYGNV--LSSSLEKTE 251
           +L RK R +   L+E +     + +YV N++  T++E+  ELF+K G +  +   L++ +
Sbjct: 24  YLLRKARRNPNGLQELRESMKSSTIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFK 83

Query: 252 DGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVS------------RAQKKYERMQ 299
                GF F+ +   ++A  A++ L+ T+  ++T+ +             R +   +   
Sbjct: 84  FTPC-GFCFIIYSCPDEALNALKYLSDTKLDEKTITIDLDPGFEDGRQFGRGKSGGQVSD 142

Query: 300 ELKKQYEASR 309
           EL+  ++ASR
Sbjct: 143 ELRFDFDASR 152

 Score = 35.0 bits (79), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 36/67 (53%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
           +++YVG L    SE  +Y++FS  G++  I +  D    T  G+ ++ ++  +    A++
Sbjct: 46  STIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNALK 105

Query: 95  QLNYTPI 101
            L+ T +
Sbjct: 106 YLSDTKL 112

>CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces
           cerevisiae YBL051c, hypothetical start
          Length = 639

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%)

Query: 354 DNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           DNG  +G  F  FSTPE+ ++ I++ N + + G+ L V
Sbjct: 92  DNGIFRGLAFANFSTPEDTSRVISDLNGKEINGRKLKV 129

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 6/82 (7%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLE-KTEDGKLKGFGFVDFEKHEDAAKAVEEL 276
           + +KNI      E+  ++  + G  L  +     ++G  +G  F +F   ED ++ + +L
Sbjct: 58  IVIKNIPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFANFSTPEDTSRVISDL 117

Query: 277 NGTEFKDQTLFVSRAQKKYERM 298
           NG E   + L V     +Y++M
Sbjct: 118 NGKEINGRKLKV-----EYKKM 134

>Sklu_2434.14 YOR361C, Contig c2434 32150-34360
          Length = 736

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%)

Query: 50  LLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLN 97
           +L  +FS  G+V  + +  D   KT+ GY +V F+   A KKAI  LN
Sbjct: 59  VLTKLFSQAGTVVDMNLPLDEEKKTTKGYLFVEFDSAVAAKKAIALLN 106

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 137 KALFETFSVFGNILSSKIATDETGKS-KGFGFVHFEHESSAKEAIDALNGMLLN 189
           K L + FS  G ++   +  DE  K+ KG+ FV F+   +AK+AI  LNG  L+
Sbjct: 58  KVLTKLFSQAGTVVDMNLPLDEEKKTTKGYLFVEFDSAVAAKKAIALLNGKKLD 111

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 232 FNELFAKYGNVLSSSLEKTEDGKL-KGFGFVDFEKHEDAAKAVEELNG 278
             +LF++ G V+  +L   E+ K  KG+ FV+F+    A KA+  LNG
Sbjct: 60  LTKLFSQAGTVVDMNLPLDEEKKTTKGYLFVEFDSAVAAKKAIALLNG 107

>Kwal_30.12890
          Length = 280

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 125 IFIKNLHPDIDNKAL-FETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDA 182
           I I  L+ + D   L +E    FG I    +  + ETG+S+G  +V FE E  A+ A++ 
Sbjct: 199 IKIMQLNENADENTLRYELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNF 258

Query: 183 LNG 185
           LNG
Sbjct: 259 LNG 261

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 28/63 (44%)

Query: 50  LLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIM 109
           L Y++  P G +  + V R+  T  S G AYV F   E  + A+  LN       +    
Sbjct: 213 LRYELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLNGRGFMNLILNAD 272

Query: 110 WSQ 112
           WS+
Sbjct: 273 WSK 275

 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 323 VKNLDDSIDDEKLKEEFA-PYGTITSVRVMRT-DNGKSKGFGFVCFSTPEEATKAI 376
           +  L+++ D+  L+ E   P+G I  V V+R  + G+S+G  +V F T E A  A+
Sbjct: 201 IMQLNENADENTLRYELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETAL 256

>Scas_241.1
          Length = 186

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184
           +FI  L   +    L + F  FG+I+  KI T      KG GFV +    SA+ AI  + 
Sbjct: 28  VFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPT-----GKGCGFVQYVDRLSAELAISKMQ 82

Query: 185 GMLLNGQEIYVAPHLTRKER 204
           G  L    I ++   + K+ 
Sbjct: 83  GFPLANSRIRLSWGRSSKQH 102

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 35  ASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIE 94
            ++++G L   VSE  L   F P G +  +++       T  G  +V + D  + + AI 
Sbjct: 26  TTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKI------PTGKGCGFVQYVDRLSAELAIS 79

Query: 95  QLNYTPIKGRLCRIMWSQ 112
           ++   P+     R+ W +
Sbjct: 80  KMQGFPLANSRIRLSWGR 97

>Sklu_1192.1 YNL286W, Contig c1192 480-1322 reverse complement
          Length = 280

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 9/89 (10%)

Query: 116 ALRKKGSGNIFIKNLH-PDIDNKALFETFSVFGNI---LSS-----KIATDETGKSKGFG 166
            +++K +  IF+ NL   +     L   F+ FG I   LS+     K+  D TG  KG  
Sbjct: 36  TMKRKQNSAIFVSNLSVENTKRDELISEFNKFGMIRRDLSTNDYKCKLYFDSTGNFKGEA 95

Query: 167 FVHFEHESSAKEAIDALNGMLLNGQEIYV 195
            + +    S   AI+ ++G  LNG++I V
Sbjct: 96  LIVYVRPESVGMAINMMDGFELNGEKITV 124

>AFL070C [3123] [Homologous to ScYPL190C (NAB3) - SH]
           (303268..305541) [2274 bp, 757 aa]
          Length = 757

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 11/73 (15%)

Query: 123 GNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDA 182
           GN+ +KN    +  + LF  FS +G+I    I          FGF+ +++  S K+AI+ 
Sbjct: 294 GNLPLKN----VTKEDLFRIFSPYGHIFQINI-------KNAFGFIQYDNAQSVKDAIEC 342

Query: 183 LNGMLLNGQEIYV 195
            +G +  G+++ +
Sbjct: 343 ESGTMNFGKKLIL 355

>Scas_632.7*
          Length = 229

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 9/89 (10%)

Query: 103 GRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETF-SVFGNILSSKIATDETGK 161
            R+ +++ SQR+          + ++ L  DI   A+ E F S  G +    ++ +E G+
Sbjct: 65  ARVSKLLDSQRE--------VKVNVEGLPRDIKQDAVREFFASQVGGVQRVLLSYNERGQ 116

Query: 162 SKGFGFVHFEHESSAKEAIDALNGMLLNG 190
           S G   + F +   AK A+   NG  ++G
Sbjct: 117 STGMANITFRNAQQAKVAVTKFNGAPIDG 145

>Kwal_33.15208
          Length = 186

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 11/78 (14%)

Query: 217 NVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTE------DGKLKGFGFVDFEKHEDAA 270
           +V+V NI+   T EE   LF      + S + + E      +G  KGF +V+F + +D  
Sbjct: 54  SVFVGNISQSITAEELQLLFKD----VVSCVNRVEIQVNRVNGLTKGFAYVEFAQPKDVT 109

Query: 271 KAVEELNGTEFKDQTLFV 288
            AV EL+  +F  + L V
Sbjct: 110 AAV-ELDNVDFHGRRLRV 126

>ADR399C [2139] [Homologous to ScYOR361C (PRT1) - SH]
           (1420640..1422850) [2211 bp, 736 aa]
          Length = 736

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 137 KALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLN 189
           K L + FS  G+++   +  +E G++KG  F+ FE   +A+ AI   NG  L+
Sbjct: 57  KVLTKLFSQAGSVVDMDVPVEE-GRTKGHLFIEFEDAGAARRAIKMFNGKKLD 108

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 232 FNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNG 278
             +LF++ G+V+   +   E+G+ KG  F++FE    A +A++  NG
Sbjct: 59  LTKLFSQAGSVVDMDV-PVEEGRTKGHLFIEFEDAGAARRAIKMFNG 104

>Scas_611.5*
          Length = 787

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 26/93 (27%)

Query: 89  GKKAIEQLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGN 148
           G+  I +++  P K RL                 GN+ +KN    +  + LF  FS +G+
Sbjct: 299 GENKITEMHNIPAKSRLF---------------IGNLPLKN----VSKEDLFRIFSPYGH 339

Query: 149 ILSSKIATDETGKSKGFGFVHFEHESSAKEAID 181
           IL   I          FGF+ + +  S K+AI+
Sbjct: 340 ILQINIKN-------AFGFIQYNNPQSVKDAIE 365

>AAR022W [208] [Homologous to ScYIR009W (MSL1) - SH]
           complement(381754..382098) [345 bp, 114 aa]
          Length = 114

 Score = 32.3 bits (72), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 8/80 (10%)

Query: 320 NLFVKNLDDSIDDEKLKEE----FAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKA 375
            L++ NL+D +    L+      F+ +G +  + +    + K +G  FV  ST +EA  A
Sbjct: 33  TLYISNLNDQVKISTLRTNLYLLFSTFGEVLRIAM----SPKLRGQAFVVLSTVDEANLA 88

Query: 376 ITEKNQQIVAGKPLYVAIAQ 395
           +     +   GKPL +  ++
Sbjct: 89  MISLKDESFFGKPLRIQFSK 108

>YNL286W (CUS2) [4325] chr14 (95221..96078) Suppressor of U2 snRNA
           mutations and homolog of human Tat-SF1 protein, contains
           two RNA recognition motif (RRM) domains [858 bp, 285 aa]
          Length = 285

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 8/85 (9%)

Query: 216 TNVYVKNINLE-TTDEEFNELFAKYGNVLSS-------SLEKTEDGKLKGFGFVDFEKHE 267
           T++Y+  +  + TT E   E F KYG + ++        L   + G  KG   + + K E
Sbjct: 45  TSIYISGLPTDKTTKEGLTEQFCKYGMIRTNRDGEPLCKLYVNDKGAFKGDALITYSKEE 104

Query: 268 DAAKAVEELNGTEFKDQTLFVSRAQ 292
               A+E +N + F  + + V RAQ
Sbjct: 105 SVTLAIEMMNESIFLGKQIRVERAQ 129

>YLL046C (RNP1) [3376] chr12 complement(46713..47462)
           Ribonucleoprotein 1, contains two RNA recognition (RRM)
           domains which include RNP-1 octamer and RNP-2 hexamer
           motifs [750 bp, 249 aa]
          Length = 249

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 42/83 (50%), Gaps = 10/83 (12%)

Query: 165 FGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFT-------- 216
           F F+ F+   + K+  + +NG +   ++I +   LT++E+  +  +     T        
Sbjct: 79  FAFIEFQEGVNLKKVKEKMNGKIFMNEKIVIENILTKEEKSFEKNQKSNKKTAPDLKPLS 138

Query: 217 --NVYVKNINLETTDEEFNELFA 237
              +YVKNI +++T+E+  ++F 
Sbjct: 139 TNTLYVKNIPMKSTNEDLAKIFG 161

>YOR361C (PRT1) [5138] chr15 complement(1015357..1017648)
           Translation initiation factor eIF3 beta subunit (p90),
           has an RNA recognition (RRM) domain [2292 bp, 763 aa]
          Length = 763

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 137 KALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAIDALNGMLLN 189
           KAL   FS  G +++ +   DE TGK+KGF FV     + AK+ I + +G  L+
Sbjct: 97  KALTSLFSKAGKVVNMEFPIDEATGKTKGFLFVECGSMNDAKKIIKSFHGKRLD 150

>Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement
          Length = 761

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 11/90 (12%)

Query: 93  IEQLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSS 152
           IE+  YT       RI   Q  P   +   GN+ +KN    +  + LF  FS +G+I   
Sbjct: 316 IERQRYTEYLRGENRITEIQHFPPKSRLFIGNLPLKN----VTKEDLFRIFSPYGHIFQI 371

Query: 153 KIATDETGKSKGFGFVHFEHESSAKEAIDA 182
            I          FGF+ ++   S K+AI+ 
Sbjct: 372 NIKN-------AFGFIQYDDPQSVKDAIEC 394

>Kwal_23.5204
          Length = 294

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 41/92 (44%), Gaps = 10/92 (10%)

Query: 125 IFIKNLHPDIDNK-ALFETFSVFGNILS--------SKIATDETGKSKGFGFVHFEHESS 175
           I++ NL      K A+ + FS +G I           K+ TDE G  KG   V +    S
Sbjct: 49  IYVSNLPLGSTTKDAVVKEFSKYGIIQKDAKTNEPRCKLYTDEQGSFKGSALVVYMRRES 108

Query: 176 AKEAIDALNGMLLNGQEIYVAPHLTRKE-RDS 206
              AID +NG    G E+ V     +K+ RDS
Sbjct: 109 VDLAIDLMNGYRFLGNELKVEEATFKKDIRDS 140

 Score = 29.3 bits (64), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 9/87 (10%)

Query: 214 HFTNVYVKNINL-ETTDEEFNELFAKYG--------NVLSSSLEKTEDGKLKGFGFVDFE 264
           H   +YV N+ L  TT +   + F+KYG        N     L   E G  KG   V + 
Sbjct: 45  HNCAIYVSNLPLGSTTKDAVVKEFSKYGIIQKDAKTNEPRCKLYTDEQGSFKGSALVVYM 104

Query: 265 KHEDAAKAVEELNGTEFKDQTLFVSRA 291
           + E    A++ +NG  F    L V  A
Sbjct: 105 RRESVDLAIDLMNGYRFLGNELKVEEA 131

>Scas_663.15
          Length = 753

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 137 KALFETFSVFGNILSSKIATDE-TGKSKGFGFVHFEHESSAKEAIDALNGMLLN 189
           KAL   FS  G +++     DE +GKSKGF FV       AK+ + + NG  L+
Sbjct: 87  KALTGLFSKAGKVVNMDFPIDEASGKSKGFLFVECGSSDDAKKILKSFNGKRLD 140

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 235 LFAKYGNVLSSSLEKTE-DGKLKGFGFVDFEKHEDAAKAVEELNG 278
           LF+K G V++      E  GK KGF FV+    +DA K ++  NG
Sbjct: 92  LFSKAGKVVNMDFPIDEASGKSKGFLFVECGSSDDAKKILKSFNG 136

>Kwal_55.21039
          Length = 119

 Score = 31.6 bits (70), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 8/88 (9%)

Query: 217 NVYVKNIN----LETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKA 272
            +YV N+N    ++T  E    LF+ YG VL   + K    +++G  F+  +  ++A  A
Sbjct: 36  TLYVHNLNDRVKIQTLRENLFLLFSTYGEVLQIDMSK----RIRGQAFIVLKTVDEANIA 91

Query: 273 VEELNGTEFKDQTLFVSRAQKKYERMQE 300
           +  LN   F  + L +  ++K    + E
Sbjct: 92  LISLNNEPFFGKDLHIQFSKKDSRLLTE 119

>CAGL0K09966g complement(974102..976261) highly similar to sp|P06103
           Saccharomyces cerevisiae YOR361c PRT1, hypothetical
           start
          Length = 719

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 137 KALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLN 189
           KAL   FS  G ++  +   D+  KSKGF FV    +  AK+ I A +G  L+
Sbjct: 55  KALGGLFSKAGKVVDMEFPLDDDKKSKGFLFVECGSDVDAKKIIKAFHGKRLD 107

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%)

Query: 235 LFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKK 294
           LF+K G V+       +D K KGF FV+     DA K ++  +G     +      + + 
Sbjct: 60  LFSKAGKVVDMEFPLDDDKKSKGFLFVECGSDVDAKKIIKAFHGKRLDLKHRLFLYSMRD 119

Query: 295 YERMQE 300
            E++ E
Sbjct: 120 VEKLSE 125

>CAGL0E03960g 376334..377227 similar to sp|P10080 Saccharomyces
           cerevisiae YHL034c SBP1 single-strand nucleic acid
           binding protein, hypothetical start
          Length = 297

 Score = 32.7 bits (73), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 11/95 (11%)

Query: 208 LEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTED---GKL-------KG 257
           L E +     +Y+ N+  + T EE   LF      +S  + K+ D   G L       +G
Sbjct: 169 LSELERSTDTLYINNVPYDATKEELASLFGTTAENVSMPMRKSRDHETGALVASETLNRG 228

Query: 258 FGFVDFEKHE-DAAKAVEELNGTEFKDQTLFVSRA 291
             FV + +   D +    E NG   KD+ L V  A
Sbjct: 229 MAFVTYAEFTGDISAKASEFNGKTLKDRALIVDVA 263

>KLLA0B00847g complement(65983..66792) similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35 translation
           initiation factor eIF3 (p33 subunit) singleton, start by
           similarity
          Length = 269

 Score = 32.3 bits (72), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 320 NLFVKNLDDSIDDEKLKEEFA-PYGTITSVRVMRT-DNGKSKGFGFVCFSTPEEATKAI 376
            + +  +++  D+E LK E   P+G I  V V++  + G+S+G  +V F T E A +A+
Sbjct: 185 TIRLTQVNELADEEVLKRELLFPFGEIPRVFVVKNPETGRSRGVAYVTFQTEEIAAQAL 243

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 29/68 (42%)

Query: 48  EALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCR 107
           E L  ++  P G +  + V ++  T  S G AYV F   E   +A++ L        +  
Sbjct: 198 EVLKRELLFPFGEIPRVFVVKNPETGRSRGVAYVTFQTEEIAAQALKLLEGRGFMNFMLH 257

Query: 108 IMWSQRDP 115
             WS+  P
Sbjct: 258 AEWSKPKP 265

>YDR381W (YRA1) [1208] chr4 (1236546..1236830,1237597..1237992)
           Protein with RNA:RNA annealing activity, involved in
           mRNA packaging for export from the nucleus, contains one
           RNA recognition (RRM) domain [681 bp, 226 aa]
          Length = 226

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 125 IFIKNLHPDIDNKALFETF-SVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDAL 183
           + ++ L  DI   A+ E F S  G +    ++ +E G+S G   + F++   A+ A++  
Sbjct: 80  VNVEGLPRDIKQDAVREFFASQVGGVQRVLLSYNERGQSTGMANITFKNGELARRAVERF 139

Query: 184 NGMLLNG 190
           NG  ++G
Sbjct: 140 NGSPIDG 146

>YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for
           sporulation and formation of meiotic spindle, has two
           RNA recognition motif (RRM) domains [2142 bp, 713 aa]
          Length = 713

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 321 LFVKNLDDSIDDEKL----KEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAI 376
           +FV +L  ++ D++L     E F  YG +  V+V+R DN  ++ + FV ++   +A  A+
Sbjct: 95  IFVASLAAALSDDELCLSVTENFKKYGDLARVKVLR-DNA-NRPYAFVQYNNDHDAKHAL 152

Query: 377 TEKNQQIVAGKPLYVAIAQ 395
                 ++ G+ L    A+
Sbjct: 153 IRAQGTLLNGRRLRCEPAK 171

>CAGL0I08393g complement(818759..820051) similar to sp|P34167
           Saccharomyces cerevisiae YPR163c TIF3, start by
           similarity
          Length = 430

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 236 FAKYGNVLSSSLEKT--EDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQK 293
             K G V   SL K+  +  +LKG  F+  ++ ED  KA+   N T+  ++T++VS A  
Sbjct: 121 LGKEGAVEEVSLPKSIKDPTRLKGIAFITLKEREDLVKAL-TFNSTKLNERTVYVSVAAP 179

Query: 294 KYE 296
           + E
Sbjct: 180 RRE 182

>AFR149C [3341] [Homologous to ScYDR381W (YRA1) - SH]
           (705111..705524,706055..706303) [663 bp, 220 aa]
          Length = 220

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 125 IFIKNLHPDIDNKALFETF-SVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDAL 183
           + ++ L  DI   A+ + F S  G +    ++ +E G S G   + F +   A+EA+   
Sbjct: 68  VNVEGLPRDIKEDAVRDFFRSSVGGLQRVLLSYNERGNSTGMATLTFANAEKAREAVKKF 127

Query: 184 NGMLLNG 190
           NG  ++G
Sbjct: 128 NGAPIDG 134

>Kwal_27.11158
          Length = 567

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 9/64 (14%)

Query: 327 DDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAG 386
           D+ + ++KL+++ + YG I SV+++       KG  FV F +   A K ++     + A 
Sbjct: 260 DEVVTEQKLRDDLSFYGEIESVKII-----TEKGIAFVHFCSIFSAIKVVSS----LAAV 310

Query: 387 KPLY 390
            P Y
Sbjct: 311 NPYY 314

>YHL034C (SBP1) [2252] chr8 complement(33191..34075) Single-stranded
           nucleic acid-binding protein associated with small
           nucleolar RNAs (snoRNAs), contains two RNA recognition
           (RRM) domains, one of them highly degenerate [885 bp,
           294 aa]
          Length = 294

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 40/96 (41%), Gaps = 14/96 (14%)

Query: 207 QLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEK----------TEDGKLK 256
           Q+E +K     +Y+ N+  + T EE  E F    + +S  + K          T D   +
Sbjct: 180 QMERSK---DTLYINNVPFKATKEEVAEFFGTDADSISLPMRKMRDQHTGRIFTSDSANR 236

Query: 257 GFGFVDFE-KHEDAAKAVEELNGTEFKDQTLFVSRA 291
           G  FV F  ++ D     EE  G  F D+ L V  A
Sbjct: 237 GMAFVTFSGENVDIEAKAEEFKGKVFGDRELTVDVA 272

>CAGL0G05401g complement(508557..510572) similar to sp|P34761
           Saccharomyces cerevisiae YNL197c WHI3 involved in
           regulation of cell size, hypothetical start
          Length = 671

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 4/73 (5%)

Query: 218 VYVKNINLETTDEEFNELFA-KYGNVLSSSLEKTEDGKLKGFG---FVDFEKHEDAAKAV 273
           +YV N+  + T++E  +LF+ ++G    S   K  +G   G G   FV+F+    A +A+
Sbjct: 546 LYVGNLPSDATEQELRQLFSNQFGFRRLSFRNKNANGTGHGHGPMCFVEFDDVSCATRAL 605

Query: 274 EELNGTEFKDQTL 286
            EL G++    T+
Sbjct: 606 VELYGSQLPRATV 618

>CAGL0H04675g complement(447256..448080) highly similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35, start by
           similarity
          Length = 274

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 318 GVNLFVKNLDDSIDDEKLKEEFA-PYGTITSVRVMRT-DNGKSKGFGFVCFSTPEEATKA 375
              L +  L+++ D+  L+ E   P+  I  V V+R  + G+S+G  FV F   + A KA
Sbjct: 188 SCTLKILQLNENADENTLRNELLFPFEPIQKVVVVRNKETGRSRGLAFVTFINEDMAEKA 247

Query: 376 I 376
           +
Sbjct: 248 L 248

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 158 ETGKSKGFGFVHFEHESSAKEAIDALNG 185
           ETG+S+G  FV F +E  A++A+  L+G
Sbjct: 226 ETGRSRGLAFVTFINEDMAEKALHFLDG 253

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 35  ASLYVGELDPTVSE-ALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAI 93
            +L + +L+    E  L  ++  P   +  + V R+  T  S G A+V F + +  +KA+
Sbjct: 189 CTLKILQLNENADENTLRNELLFPFEPIQKVVVVRNKETGRSRGLAFVTFINEDMAEKAL 248

Query: 94  EQLNYTPIKGRLCRIMWSQ 112
             L+       + R+ WS+
Sbjct: 249 HFLDGRGFMNLILRVDWSK 267

>AFR062C [3254] [Homologous to ScYNL137C (NAM9) - SH]
           (537207..538628) [1422 bp, 473 aa]
          Length = 473

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 49/108 (45%), Gaps = 5/108 (4%)

Query: 81  VNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDID-NKAL 139
           +N N+ +  +K +  L  T  +  LC+++ + R+    K  S   F    + D +  KAL
Sbjct: 221 INHNNKQLDEKKLAVLKSTDKESLLCKVLAAAREHDGEKSISAATFRTASYGDAELAKAL 280

Query: 140 FETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGML 187
           FE +       + KI  D+T + +    +    +S+A E  DA+   L
Sbjct: 281 FEIYKTLEKSEALKILQDKTAEEQAKIIL----DSAAPEVSDAMKKKL 324

>ADL064W [1677] [Homologous to ScYER068W (MOT2) - SH]
           complement(567690..569630) [1941 bp, 646 aa]
          Length = 646

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 9/87 (10%)

Query: 218 VYVKNINLETTDEEFNEL------FAKYG--NVLSSSLEKTEDGKLKGFG-FVDFEKHED 268
           VYV  +N     EE   L      F +YG  N +  + +   +    G+G +V F + ED
Sbjct: 139 VYVIGLNPPVPYEEVGALLRSDKYFGQYGKINKIVVNRKTGHNDHQTGYGIYVTFSRKED 198

Query: 269 AAKAVEELNGTEFKDQTLFVSRAQKKY 295
           AA+ ++ ++GT    + +  +    KY
Sbjct: 199 AARCIQAVDGTFMDGRQVKAAYGTTKY 225

>YBR214W (SDS24) [395] chr2 (651372..652955) Nuclear protein with
           similarity to S. pombe sds23/moc1 protein [1584 bp, 527
           aa]
          Length = 527

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 6/87 (6%)

Query: 164 GFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNI 223
           G   +H E  SS   A+    G LL    +    H+TR  +   L +T  HF +V + + 
Sbjct: 301 GLYKMHVERISSI--AVIDKQGNLLGNISVTDVKHVTRTSQYPLLHKTCRHFISVILNSR 358

Query: 224 NLETTDEEFNELFAKYGNVLSSSLEKT 250
            LET  + F  +F  Y    SSSL +T
Sbjct: 359 GLETGKDSF-PIFHVYP---SSSLART 381

>Scas_500.6
          Length = 621

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 46/98 (46%), Gaps = 14/98 (14%)

Query: 303 KQYEASRLEKMAKYQGV---NLFVKNLDDSIDDEKLKEEFA------PYGTITSVRVMRT 353
           +Q++AS L+ +   + +    + +KN+  +I  E+L +  A      PY           
Sbjct: 34  EQHDASNLDDVEIDEDIIPTAIVIKNIPFAIKREQLLDIMAKMDLPLPYAF-----NYHF 88

Query: 354 DNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 391
           DNG  +G  F  F+T +E T+ I   N + + G+ L V
Sbjct: 89  DNGVFRGLAFANFTTTDETTRVIECLNGKEIGGRKLRV 126

>Kwal_55.22147
          Length = 468

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 51/108 (47%), Gaps = 13/108 (12%)

Query: 218 VYVKNI--NLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAA--KAV 273
           V+V NI  + +T+  E    F ++G   S   E         FG+V+ E   +AA  K  
Sbjct: 7   VFVGNIYNDHDTSLTELYRRFQRFGKCTSDKFESH-----AHFGYVNMEFENEAAFAKLK 61

Query: 274 EELNGTEFKDQTLFVSRA----QKKYERMQELKKQYEASRLEKMAKYQ 317
           +  NG +FK   L V  A    Q+++++ QE  +  E  + ++M K Q
Sbjct: 62  QSFNGVKFKGNILKVDVAKMGWQERWKKDQEEGQHIEEEKQKQMEKSQ 109

>Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement
          Length = 284

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 51/111 (45%), Gaps = 5/111 (4%)

Query: 91  KAIEQLNYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNIL 150
           ++++ L +T  + +L R     R   L  +   +IF+ N+ P    ++L   F   G I 
Sbjct: 54  ESMKGLGFTASEHQLSREDRQARQIELDSR---SIFVGNISPSTTPESLEAHFEDAGVIK 110

Query: 151 SSKIATDE-TGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLT 200
              I  ++ TG  KG+ ++ FE + S  E   A +    NG+ I VA   T
Sbjct: 111 RVTILYNKHTGAPKGYAYIEFESKDSV-EKGSAFDQSDFNGKTITVAKKRT 160

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 23/48 (47%)

Query: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNF 83
           S++VG + P+ +   L   F   G +  + +  +  T    GYAY+ F
Sbjct: 84  SIFVGNISPSTTPESLEAHFEDAGVIKRVTILYNKHTGAPKGYAYIEF 131

>YLL013C (PUF3) [3406] chr12 complement(122074..124713) Protein
           involved in metabolism of COX17 mRNA, has eight
           Pumilio-homology domains [2640 bp, 879 aa]
          Length = 879

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 13/24 (54%)

Query: 449 PFNGPNPQQMNGVPPQQFRNGPGY 472
           P N   P  MNG PP QF  GP Y
Sbjct: 297 PANNNFPPYMNGFPPNQFHQGPHY 320

>ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH]
           complement(1034093..1034902) [810 bp, 269 aa]
          Length = 269

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 54  IFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQ 112
           + SP  +V  + V R+  T  S G AYV F   +  + A+  L+       + ++ WS+
Sbjct: 208 LLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAETALRLLHGRGFMNLILQVDWSK 266

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 143 FSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAIDALNG 185
            S F N+    +  + ETG+S+G  +V F  E  A+ A+  L+G
Sbjct: 209 LSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAETALRLLHG 252

>CAGL0C01419g complement(153063..154982) similar to sp|Q08925
           Saccharomyces cerevisiae YPL184c, hypothetical start
          Length = 639

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 14/96 (14%)

Query: 330 IDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAIT---EKN-----Q 381
           + +EKL+E+   YG I S++++       K   FV FS+   A K ++   +KN     +
Sbjct: 335 LTEEKLREDLKEYGEIDSIKII-----PEKDIAFVHFSSIATAIKVVSTLAQKNPFYQEK 389

Query: 382 QIVAGKPLYVAIAQRKDVRRSQ-LAQQIQARTQMRY 416
           +I  GK     I + +    +Q L  Q +    MRY
Sbjct: 390 KIFYGKDRCAFITKTQQHNAAQFLGVQPEMEHLMRY 425

>ACR235W [1282] [Homologous to ScYBL051C (PIN4) - SH]
           complement(771971..773707) [1737 bp, 578 aa]
          Length = 578

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 11/77 (14%)

Query: 321 LFVKNLDDSIDDEKLKEEFA------PYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATK 374
           + +KN+  +I  E+L E  A      PY           DNG  +G  F  F+T EE  +
Sbjct: 51  IVIKNIPFAIKKEQLLEVIAKMDLPLPYAF-----NYHFDNGVFRGLAFANFTTTEETMQ 105

Query: 375 AITEKNQQIVAGKPLYV 391
            +   N + + G+ L V
Sbjct: 106 VVQHLNGKEIGGRRLRV 122

>KLLA0C07194g 624694..625587 no similarity, hypothetical start
          Length = 297

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 29/75 (38%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277
           V+V      T   E    F   G ++   +      K   + FV++E   DA  A+   +
Sbjct: 7   VHVSGFPAGTRANELAPQFENVGRLVRIDIPPLGRFKSIPYAFVEYESSHDAENAIRSCD 66

Query: 278 GTEFKDQTLFVSRAQ 292
           GT F+    F  R Q
Sbjct: 67  GTPFEMNKSFSLRVQ 81

>Scas_620.12
          Length = 735

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 35/95 (36%), Gaps = 30/95 (31%)

Query: 432 GQFMP----PMFYGVMPPRGVP---------------FNGPNPQQ---------MNGVPP 463
           G +MP    PMFY  MPP   P                + P+PQ          M G P 
Sbjct: 608 GMYMPFQPQPMFYPGMPPMMTPGATGTGAVSKEGLDSGSSPSPQAASPHIPPAYMAGAPG 667

Query: 464 QQFRNGPGY--GMPPQGGFPRNGVPNQFYQKNQRQ 496
            Q   G GY   MP QG    N  PN   ++N  Q
Sbjct: 668 NQAMGGFGYPGAMPFQGMMGGNVAPNGMPRQNYHQ 702

>AER449W [2949] [Homologous to ScYKL214C - SH]
           complement(1499913..1500419) [507 bp, 168 aa]
          Length = 168

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 28/67 (41%), Gaps = 3/67 (4%)

Query: 222 NINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEF 281
           NI L+ +D E ++L       L S     ED +   F   +FE H    K VE  NG E 
Sbjct: 41  NIPLDVSDYEIDDLLKDLPKPLYSKFYDHEDSRSAVF---EFEDHSILDKCVELYNGLEL 97

Query: 282 KDQTLFV 288
               + V
Sbjct: 98  HGAKITV 104

>Kwal_23.3638
          Length = 427

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 12/108 (11%)

Query: 230 EEFNELFAKYGNVL-------SSSLEKTEDGKLKGFGFVDF--EKHEDAAKAVEELNGTE 280
           E F +L  KY  +L       S  L+     K+K F F+     K ++  + +E L G +
Sbjct: 179 ERFVDLARKYETLLWFGDVTMSEGLQVANSLKVKQFPFLGLLAMKGDNKIELIERLEG-D 237

Query: 281 FKDQTL--FVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNL 326
             D  L    S+  K Y R+ EL++Q++ S L ++ + Q  + F  +L
Sbjct: 238 LLDYNLNSLESKLAKAYPRLIELRQQHQNSELRRLMREQQDSRFQTSL 285

>CAGL0G05511g complement(522026..524050) similar to sp|P34761
           Saccharomyces cerevisiae YNL197c WHI3 involved in
           regulation of cell size, start by similarity
          Length = 674

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLE-KTEDGKLKGFG---FVDFEKHEDAAKAV 273
           +YV N+  +T+++E  +LF+        S + K  +G   G G   FV+FE    A +A+
Sbjct: 560 LYVGNLPPDTSEQELRQLFSPQPGFRRLSFKNKNNNGHTHGHGPMCFVEFEDVSFATRAL 619

Query: 274 EELNGTEF 281
            EL G + 
Sbjct: 620 AELYGRQL 627

>KLLA0C02585g 229274..235831 similar to sp|P21951 Saccharomyces
            cerevisiae YNL262w POL2 DNA-directed DNA polymerase
            epsilon, catalytic subunit A singleton, start by
            similarity
          Length = 2185

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 12/65 (18%)

Query: 131  HPDIDNKALFETF---SVFGNILSSK---------IATDETGKSKGFGFVHFEHESSAKE 178
            +PDI +  +FE     SV   +LSS          +A + T K + FGFV     SSA  
Sbjct: 1693 NPDIYDDVIFEISVYNSVVNTVLSSTMLNEAEGTDLAQNSTSKEESFGFVEDSFSSSALS 1752

Query: 179  AIDAL 183
             + AL
Sbjct: 1753 VLRAL 1757

>Sklu_2412.4 YMR124W, Contig c2412 7729-10719
          Length = 996

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 6/34 (17%)

Query: 448 VPFNGPNPQQMNGVPPQQFRNGPGYGMPPQGGFP 481
           +P  GP    +   PPQ+FR       PPQGG+P
Sbjct: 260 MPHYGPRANSLMSGPPQRFR------QPPQGGYP 287

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,752,605
Number of extensions: 807188
Number of successful extensions: 3878
Number of sequences better than 10.0: 297
Number of HSP's gapped: 3278
Number of HSP's successfully gapped: 738
Length of query: 575
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 468
Effective length of database: 12,891,983
Effective search space: 6033448044
Effective search space used: 6033448044
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)